Telling Stories / Geschichten erzählen: Literature and Evolution / Literatur und Evolution 9783110268683, 9783110268591

Citation preview

Telling Stories / Geschichten erzählen

spectrum Literaturwissenschaft / spectrum Literature Komparatistische Studien / Comparative Studies

Herausgegeben von / Edited by Angelika Corbineau-Hoffmann · Werner Frick

Wissenschaftlicher Beirat / Editorial Board Sam-Huan Ahn · Peter-Andre´ Alt · Aleida Assmann · Francis Claudon Marcus Deufert · Wolfgang Matzat · Fritz Paul · Terence James Reed Herta Schmid · Simone Winko · Bernhard Zimmermann Theodore Ziolkowski

26

De Gruyter

Telling Stories / Geschichten erzählen Literature and Evolution / Literatur und Evolution Edited by / Herausgegeben von Carsten Gansel · Dirk Vanderbeke

De Gruyter

ISBN 978-3-11-026859-1 e-ISBN 978-3-11-026868-3 ISSN 1860-210X Library of Congress Cataloging-in-Publication Data A CIP catalog record for this book has been applied for at the Library of Congress. Bibliografische Information der Deutschen Nationalbibliothek Die Deutsche Nationalbibliothek verzeichnet diese Publikation in der Deutschen Nationalbibliografie; detaillierte bibliografische Daten sind im Internet über http://dnb.d-nb.de abrufbar. 쑔 2012 Walter de Gruyter GmbH & Co. KG, Berlin/Boston Einbandabbildung: Ralf Hiemisch/Getty Images Druck: Hubert & Co. GmbH & Co. KG, Göttingen ⬁ Gedruckt auf säurefreiem Papier Printed in Germany www.degruyter.com

Contents/Inhalt

V

Contents / Inhalt Carsten Gansel / Dirk Vanderbeke Evolution and Literature. Preface . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 Evolution und Literatur. Vorbemerkungen . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5

I. Theoretical Approaches / Theoretische Ansätze Karl Eibl How Can Evolutionary Biology Enrich the Study of Literature? . . . . . . . . . 11 Katja Mellmann Is Storytelling a Biological Adaptation? Preliminary Thoughts on How to Pose that Question . . . . . . . . . . . . . . . . . . 30 Joseph Carroll The Adaptive Function of the Arts. Alternative Evolutionary Hypotheses . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 50 Brian Boyd Evolution and Literary Response . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64 Carsten Gansel Storytelling from the Perspective of Evolutionary Theory . . . . . . . . . . . . . . 77 Dirk Vanderbeke The Unlovely Little Sister. Storytelling as an Exaptive Phenomenon . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 Olaf Breidbach Evolution des Kognitiven. Nervenzellen, Sprache und kulturelle Adaptationen . . . . . . . . . . . . . . . . . . 121 Michaela Schrage-Früh “The Roots of Art Are in the Dream”. Dreams, Literature and Evolution . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 156 Felix Frey Erfahrungshaftigkeit als Attraktivitätspotential narrativer Formen. Evolutionäre Argumente für ein Primat der erfahrungshaften Medienrezeption . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 172

VI

Contents/Inhalt

Christiane Heibach Durch Analyse zur Synthese. Paradigmen und kulturelle Voraussetzungen der Synästhesieforschung . 195 Jörg Thomas Richter Phantoms in the Retroscape. Remarks on Anglo-American Evolutionary Aesthetics around 1900 . . . . 216 Norman Kasper Genetische Methode oder „Instinktschöpfung“ wider die Schmerzen der „Höherentwicklung des Organismus“? Evolutionäre Kulturtheorie in völkerpsychologischer Absicht bei Wundt, Schmarsow und Worringer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 235 Robert Charlier Evolutive Kanonbildung? „Natur“ und „Kultur“ im Prozess literarischer Wertung. . . . . . . . . . . . . . . 262

II. Case Studies / Fallstudien Anja Müller-Wood Shakespeare and the (Evolved) Pleasures of Revenge . . . . . . . . . . . . . . . . . 279 Judith P. Saunders Nepotism in Hawthorne’s “My Kinsman, Major Molineux”. A Darwinian Approach to a Classic Text . . . . . . . . . . . . . . . . . . . . . . . . . . . . 296 Wolfram R. Keller Evolutionary Art. Charles Dickens’s “Bleak House” and the Ovidian Metamorphosis of the Victorian Novel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 310 Brett Cooke Liebestod Revisited. Wasted Reproductivity in Wagner’s Operas . . . . . . . . . . . . . . . . . . . . . . . . . . 327 Mathias Clasen “Can’t Sleep, Clowns Will Eat Me”. Telling Scary Stories . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 338 Stephanie Catani „Wir nehmen nicht wahr, wofür wir keine Sensoren haben“. Zur Evolution der Geschichte in fiktionaler Literatur . . . . . . . . . . . . . . . . . . . . . 361

Contents/Inhalt

VII

Tina Schneider Welterfolge von „All-Age-Titeln“. Evolutionspsychologische Perspektiven auf die Bis(s)-Bestseller (Twilight) von Stephenie Meyer. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 377 List of Contributors Verzeichnis der Beiträger umd Beiträgerinnen . . . . . . . . . . . . . . . . . . . . . . . 399

Evolution and Literature

1

Evolution and Literature Preface Carsten Gansel / Dirk Vanderbeke

When Edward O. Wilson published his book Sociobiology: The New Synthesis in 1975, followed by On Human Nature (1978) and Consilience (1998), they were rejected almost unanimously by scholars in the humanities. In the meantime, however, a re-orientation has taken place. Where faculties were once happily segregated, they now strive to communicate and to solve problems in cooperation. Today, Wilson’s publications count among the fundamental works at the interface of the sciences and the humanities. Along with some more controversial developments in the fields of genetics and brain research, evolutionary theory has captured the interest of a multitude of scholars from diverse faculties and stimulated the formation of independent theories in a large number of disciplines. Economics has developed a subdiscipline called “evolutionary management”, philosophers discuss questions of “evolutionary epistemology”, and the approaches of “evolutionary psychology” have gained considerable influence in many different areas of research. Thus the life sciences have arguably taken on the role of a new “Leitwissenschaft” (a leading or guiding science) in our time, and their empirical and theoretical achievements are of great interest to sociology, literary studies, linguistics, media studies and communication science. The fact that the Congress on German Studies (Germanistentag) in 2007 was dedicated to topics relating to “Nature – Culture: Universality and Diversity in Language, Literature and Education” is a strong indication of this new connection between the humanities and the sciences. In Graham Swift’s novel Waterland (1983), a history teacher defines man as the “story-telling animal” (Swift 1984, p. 53), and indeed stories are a part of our lives from our early childhood days; they constitute an indispensable component of all human cultures. Questions about the evolutionary conditions and origins of storytelling, and in consequence also of literature, have become crucial for various disciplines, and the number of books and essay collections investigating it is increasing rapidly. In this context, the research on the evolution of human linguistic development is also of vital importance to literary studies, touching central and much debated aspects of linguistic, reading and media competence. As early as 1925, Ernst Cassirer suggested

2

Carsten Gansel/Dirk Vanderbeke

in his essay on “Sprache und Mythos” (“Language and Myth”) that these fundamental elements of human nature and culture are two sides of the same coin (cf. Cassirer 1994, p. 145). Storytelling, then, would not be a subsequent phenomenon but concurrent with the development of language. Narrative elements can, indeed, be found in all discourses, a fact that allows us to assume that beside the genetic capacity for language there may also be a universal predisposition to process and convey the experience of reality in the form of stories. It is thus of urgent interest, not only for the humanities, but also for biology and the neurosciences, to investigate the conditions, the origins and the development of this fundamental feature which concerns such large parts of human life and takes effect even in the academic construction of knowledge and scientific descriptions of reality. The equally rhetorical and provocative question posed by a literary scholar, “Literary Darwinism may not be wrong, but is it relevant?”, can thus, presumably against the author’s intentions, be answered in the affirmative. Recent studies on the connections between evolution and art have come to assume that art, in its broadest sense, can be regarded a “human universal” and that the production of art constitutes an adaptive, or at least exaptive feature of human nature. The ethological perspective is then compatible with theories that see art as a “human problem-solving activity” and characterise poetic texts as “hyper-coherent” (cf. Eibl, 1991, p. 363). Such texts are not only particularly useful for a fairly invariant transmission of knowledge and ideologies, their specific form also serves to capture the audiences’ attention (ibid.). Finally, the “theory of mind” necessarily assumes a fundamental role of universals within the human cognitive apparatus, a human mind which “contains a rich array of innate structures that have evolved through the adaptive process of natural selection” (Carroll 2004, p. 103). In this context, research on the neurocognitive foundations of aesthetics may well prove to be of use to literary studies and may open up theoretical and methodical paths for future investigations. Such considerations of evolutionary psychology by no means support notions of “biological determinism”, and neither do we question the importance of cultural interaction for social behaviour. Instead, we aim for a transdisciplinarity, which avoids C. P Snow’s now almost proverbial division between two separate, if not mutually hostile, cultures and shapes innovative methods for textual analysis. In this sense, we are inclined to assume that there are universal mechanisms behind the variables of human behaviour and that biological and cultural co-evolution forms the basis from which the most diverse aesthetic and narrative forms may spring. This volume is a compilation of papers from a conference which took place in spring 2009 at Friedrich-Schiller-University Jena, Germany. We

Evolution and Literature

3

would like to thank the Deutsche Forschungsgemeinschaft for their generous financial support without which it would not have been possible to assemble such a wide range of highly acclaimed international scholars. The contributions have been put into two different thematic sections. The essays in the first part discuss, sometimes controversially, basic theoretic concepts. They differ considerably in the importance they attribute to evolutionary processes for the development of storytelling, especially the narration of fiction. The authors highlight different aspects of human cognition as basic prerequisites for the development of storytelling, and they come to different conclusions as to which mental functions might have contributed to the further evolution of literature. Admittedly, because approaches inspired by evolutionary psychology constitute only one trend in the humanities, it is not yet possible to speak of a fully-developed research area with clear methods and paradigmatic concepts. In consequence, the theories, models and interpretations presented in this volume are not intended to represent final verdicts, but are meant to contribute to an ongoing fruitful academic discussion. The final essays in the first section of this volume look back into the history of evolutionary theory. They demonstrate that scholars already discussed the connection between evolution and literature at early stages, until explanatory models and approaches that tried to integrate the sciences with the humanities began to be frowned upon and were generally rejected by arts scholars for a considerable period of time. The second part of this volume presents studies that investigate, and raise questions about, aspects of evolutionary psychology within specific texts or text types. Apparently, some elements of human behaviour such as revenge or nepotism that are quite common in literary texts lend themselves more readily to evolutionary explanations than phenomena like love-death, which has been a persistent literary motif ever since antiquity, or the strangely pleasant horrors evoked in some sub-genres of fantasy literature. Rejecting simplistic explanations and interpretative models, however, these contributions demonstrate yet again that even aspects which seem to be intuitively plausible will have to be investigated cautiously and with a careful attention to detail. An international conference and, subsequently, the publication of selected contributions can only be realised with the help of many. We would like to thank Norman Ächtler, Heike Müller and Christiane Görtz who were in the hub of the organisation of the conference, Doreen Liebing and Romina Proenza who took part in the process of copy-editing the texts, and all the students whose commitment and effort contributed greatly to the success of this project. Our particular thanks go to Christine Henschel who took care of the copy-editing of the manuscript and the preparation for print.

4

Carsten Gansel/Dirk Vanderbeke

References Carroll, Joseph, Literary Darwinism. Evolution, Human Nature, and Literature, New York and London: Routledge, 2004. Cassirer, Ernst, “Sprache und Mythos – Ein Beitrag zum Problem der Götternamen [1925]”, in: Wesen und Wirkung des Symbolbegriffs, Darmstadt: Wissenschaftliche Buchgesellschaft, 1994, pp. 71–158. Eibl, Karl, “Zurück zu Darwin. Bausteine zur historischen Funktionsbestimmung von Dichtung”, in: Modelle literarischen Strukturwandels, ed. by Michael Titzmann, Tübingen: Niemeyer, 1991, pp. 347–366. Swift, Graham, Waterland, London: Picador, 1984.

Evolution und Literatur

5

Evolution und Literatur Vorbemerkungen Carsten Gansel / Dirk Vanderbeke

Als Edward O. Wilson 1975 sein Buch Sociobiology: The New Synthesis veröffentlichte, gefolgt von On Human Nature (1978) und Consilience (1998), reagierten die Geisteswissenschaften fast durchweg ablehnend. Inzwischen hat allerdings eine Neuorientierung eingesetzt. An die Stelle der ehemaligen Abgrenzungen zwischen den Fakultäten trat der Versuch, in einen Austausch zu treten und gemeinsame Anstrengungen bei der Lösung von Problemen zu unternehmen. Inzwischen zählen Wilsons Publikationen zu den grundlegenden Werken an der Schnittstelle zwischen Natur- und Geisteswissenschaften. Wenn in diesem Zusammenhang ein Wissenschaftszweig im letzten Jahrzehnt in den Vordergrund getreten ist, dann sind es die Bio- und Humanwissenschaften. Neben den teilweise kontrovers diskutierten Entwicklungen in der Gen- und Hirnforschung hat besonders die Evolutionstheorie in einer Vielzahl von Wissensbereichen neue und fruchtbare Theoriebildungen hervorgebracht oder auch frühere, teilweise fast vergessene Ansätze aufgegriffen und weitergeführt. In den Wirtschaftswissenschaften hat sich eine Richtung des „Evolutionären Managements“ ausgebildet, in der Philosophie wird eine „Evolutionäre Erkenntnistheorie“ diskutiert, und die „Evolutionäre Psychologie“ hat sich in diversen Forschungszusammenhängen als ein wesentlicher Ansatz etabliert. Insofern lässt sich durchaus sagen, dass die Biowissenschaften in der Gegenwart die Rolle einer neuen Leitwissenschaft übernommen haben und ihre Erkenntnisse von großem Interesse auch für die Soziologie, die Literatur-, Sprach-, Medien- und Kommunikationswissenschaften sind. Ein Indiz für das neue Verhältnis von Geistesund Naturwissenschaften lässt sich auch an dem Umstand ablesen, dass das Programm des Deutschen Germanistentages 2007 unter dem Thema stand: „Natur – Kultur. Universalität und Vielfalt in Sprache, Literatur und Bildung“. In Graham Swifts Roman Waterland (1983) definiert ein Geschichtslehrer den Menschen als das „Geschichten erzählende Tier“ (vgl. Swift 1984, S. 53), und in der Tat: Geschichten begleiten uns seit der frühesten Kindheit, sie sind unabdinglicher Bestandteil aller menschlichen Kulturen. Die Frage nach den evolutionären Bedingungen oder Ursprüngen des Erzählens

6

Carsten Gansel/Dirk Vanderbeke

und damit auch der Literatur bildet daher einen Bezugspunkt für verschiedene Disziplinen und wurde in den letzten Jahren in einer Reihe von Büchern und Aufsatzsammlungen vertieft. Davon sind selbstverständlich auch die Forschungen zur Evolution der menschlichen Sprachentwicklung betroffen, die zentrale literaturwissenschaftliche Fragestellungen bis hin zu den viel diskutierten Aspekten einer Sprach-, Lese- und Medienkompetenz berühren. Bereits 1925 hat Ernst Cassirer in seiner Schrift über „Sprache und Mythos“ vermutet, dass Sprache und Mythos die Kehrseiten einer Medaille darstellen (vgl. Cassirer 1994, S. 145), die Herkunft des Erzählens wäre daher kein nachträgliches Phänomen, sondern der Entwicklung der Sprache gleichgestellt. Narrative Elemente finden sich tatsächlich in allen Diskursen, und sie lassen die Vermutung zu, dass es neben einer genetisch kodierten Fähigkeit zur Sprache möglicherweise auch die universelle Prädisposition gibt, die Erfahrung der Wirklichkeit in Form von Geschichten zu verarbeiten und zu vermitteln. Die Frage nach den Bedingungen, der Herkunft und der Entwicklung dieser fundamentalen Eigenschaft, die so weite Teile des menschlichen Lebens betrifft und nicht nur neben, sondern auch in den Wissenschaften bei der Konstruktion unseres Wissens und bei der Beschreibung der Wirklichkeit wirksam wird, ist damit von vordringlichem Interesse, nicht nur für die Geisteswissenschaften, sondern auch für die Biologie und die Neurowissenschaften. Die gleichermaßen rhetorische wie provokante Frage eines Literaturwissenschaftlers, „Literary Darwinism may not be wrong, but is it relevant?“, lässt sich damit, vermutlich gegen die Intention des Autors, durchaus bejahen. Neuere Forschungen zum Zusammenhang von Evolution und Kunst gehen davon aus, dass Kunst im weiten Sinne als „menschliche Universalie“ gelten kann und dass es sich bei der „Kunstproduktion“ um ein adaptives oder zumindest exaptives Merkmal der menschlichen Natur handelt. Der ethologische Blickwinkel ist dabei vereinbar mit Auffassungen, die Kunst – in diesem Fall Dichtung – als „menschliche Problemlösungsaktivität“ sehen und etwa den poetischen Text als einen „überkohärenten Text“ bestimmen (vgl. Eibl 1991, S. 363). Solche Texte sind nicht nur geeignet, Wissen und Überzeugungen weitgehend invariant zu transportieren, sie ziehen auch durch ihre spezifische Form die Aufmerksamkeit auf sich (ebd.). Schließlich ist mit der Theorie eines angepassten Bewusstseins („theory of mind“) von einem – durch die biologische Evolution bedingten – fundamentalen Anteil an „Universalien“ in Hinblick auf den menschlichen Wahrnehmungsapparat auszugehen. „Angepasst“ bezeichnet dabei ein Bewusstsein, „das mit einer reichen und komplexen Struktur angeborener Dispositionen und Entwicklungsprogramme ausgestattet ist“ (Carroll 2001, S. 246). In diesem Zusammenhang lassen sich auch Forschungen zu den neurokognitiven Grundlagen der Ästhetik für die Literaturwissenschaft

Evolution und Literatur

7

fruchtbar machen oder weisen den theoretischen und methodischen Weg für künftige Untersuchungen. Die Aufnahme evolutionspsychologischer Überlegungen in geisteswissenschaftliche Forschungszusammenhänge – das sei explizit betont – darf nicht als Hinwendung zu einem „biologischen Determinismus“ verstanden werden, und ebenso wenig wird die Bedeutsamkeit der kulturellen Interaktion für das soziale Verhalten in Frage gestellt. Vielmehr ist eine Transdiziplinarität angestrebt, die die nach C. P. Snow inzwischen fast sprichwörtliche Spaltung von Natur- und Geisteswissenschaften in zwei getrennte, wenn nicht sogar einander feindliche Kulturen vermeidet und für die Methodik der Textanalyse nutzbar gemacht wird. In diesem Sinne werden hinter Variablen des Verhaltens universelle Mechanismen angenommen; die biologische und kulturelle Koevolution bildet eine Grundlage, auf der sich vielfältige und weit divergierende ästhetische und narrative Formen herausbilden können. Der vorliegende Band geht auf eine Konferenz zurück, die im Frühjahr 2009 an der Friedrich-Schiller-Universität in Jena stattfand. Wir möchten uns an dieser Stelle für die großzügige Unterstützung durch die Deutsche Forschungsgemeinschaft bedanken, durch die es überhaupt erst möglich wurde, ein so breit gefächertes Spektrum an internationalen Wissenschaftlern und Wissenschaftlerinnen zusammenzubringen. Die Beiträge sind in zwei wesentliche Bereiche gegliedert. Der erste Teil beschäftigt sich mit grundlegenden theoretischen Konzepten, die dabei durchaus kontrovers diskutiert werden. Die Bandbreite der Forschungsansätze erweist sich beispielsweise in der unterschiedlichen Gewichtung, die evolutionären Prozessen bei der Entstehung des Erzählens und speziell auch des fiktionalen Erzählens zugeordnet wird. Zudem werden verschiedene Vorschläge unterbreitet, welche Aspekte der menschlichen Kognition als Grundbedingungen an der Entstehung von Erzählen und Literatur mitgewirkt und welche mentalen Funktionen Einfluss auf die Entwicklung und weitere Ausformung genommen haben könnten. Freilich stellen evolutionspsychologische Ansätze in den Geisteswissenschaften nur einen turn neben anderen dar, und es ist aus diesem Grund noch nicht möglich, hier von einem vollständig entwickelten Forschungsbereich mit klarer Methodik und paradigmatischen Konzepten zu sprechen. Die in dem vorliegenden Band entwickelten Theorien, Modelle und Interpretationen sollten daher auch nicht als abschließende Urteile, sondern als Beiträge zu einer fortschreitenden und fruchtbaren wissenschaftlichen Diskussion verstanden werden. Den Abschluss dieses Teiles bilden Beiträge, die in die Geschichte der Evolutionstheorie zurückgreifen und zeigen, dass bereits früh über das Verhältnis von Evolution und Literatur nachgedacht wurde, bis dann Ansätze, die naturwissenschaftliche Erklärungsmodelle in die Geisteswissenschaften zu

8

Carsten Gansel/Dirk Vanderbeke

integrieren suchten, über einen längeren Zeitraum distanziert betrachtet wurden und partiell in Verruf gerieten. Der zweite Teil des Bandes umfasst evolutionspsychologisch intendierte Untersuchungen zu konkreten Texten und Textsorten, die ebenfalls Fragen und Probleme markieren. So sind etwa Rache oder Nepotismus als Elemente menschlichen Verhaltens und damit auch als Handlungsdispositionen literarischer Texte zunächst einmal unproblematischer evolutionstheoretisch zu begründen als dies für das gleichfalls in der Literatur seit ihren Anfängen auftauchende Motiv des Liebestodes oder bei Episoden, die in phantastischen Texten eine Art wohligen Schrecken erzeugen, der Fall ist. Indem sie einfache Erklärungen und Modelle zurückweisen, zeigen die Beiträge einmal mehr, dass selbst intuitiv scheinbar plausible Phänomene einer genauen Untersuchung zu unterziehen sind. Eine internationale Tagung und die Veröffentlichung ausgewählter Beiträge kommen nur durch die Mitarbeit vieler Beteiligter zustande. Wir möchten uns an dieser Stelle bei Norman Ächtler, Heike Müller und Christiane Görtz bedanken, die als Schaltstellen bei der Organisation gewirkt haben, bei Doreen Liebing und Romina Proenza, die an der redaktionellen Bearbeitung der Beiträge beteiligt waren, sowie auch bei den Studierenden, die durch ihren tatkräftigen Einsatz zum Erfolg des Projektes beigetragen haben. Unser besonderer Dank gilt Christine Henschel für die sachkundige Betreuung des Manuskripts und das profunde Lektorat.

Literaturverzeichnis Carroll, Joseph, „Universalien in der Literaturwissenschaft“, in: Universalien und Konstuktivismus, hg. von Peter Michael Hejl, Frankfurt/M.: Suhrkamp, 2001, S. 235–256. Cassirer, Ernst, „Sprache und Mythos – Ein Beitrag zum Problem der Götternamen [1925]“, in: Wesen und Wirkung des Symbolbegriffs, Darmstadt: Wissenschaftliche Buchgesellschaft, 1994, S. 71–158. Eibl, Karl, „Zurück zu Darwin. Bausteine zur historischen Funktionsbestimmung von Dichtung“, in: Modelle literarischen Strukturwandels, hg. von Michael Titzmann, Tübingen: Niemeyer, 1991, S. 347–366. Swift, Graham, Waterland, London: Picador, 1984.

I. Theoretical Approaches / Theoretische Ansätze

10

Carsten Gansel, Dirk Vanderbeke

How Can Evolutionary Biology Enrich the Study of Literature?

11

How Can Evolutionary Biology Enrich the Study of Literature?1 Karl Eibl

Evolutionary theory is simple and plausible. That’s its fatal flaw. Without too much thought, you can fill whole books with the kind of insights generated over a beer in the local pub. And you are rewarded with the satisfying sense of having had a glimpse behind the thin veneer of civilization. Opponents of evolutionary theory can avoid straining their grey matter as well. Depending on the context, they can content themselves with associating it with distasteful things and mentioning three catchwords – social Darwinism, reductionism and “just so stories”. This allows them to bury the serious variants along with the vulgar ones. Yet in fact the historical sciences have always thought in evolutionary terms. They do so whenever they explain a phenomenon by seeking to ascertain its function within a given context and determine the conditions which make it possible.2 In what follows, however, I am concerned not with the application of a “general” evolutionary theory, but with how the findings of biological evolutionary theory might contribute to the scientific investigation of literature and literary behaviour.3

I. Discovering the Naked Ape in Literature? “The first poet to rhyme ‘Herz’ with ‘Schmerz’ was a genius, the thousandth a cretin.”4 In this spirit, I would like to cite the first consistently and explicitly sociobiological examination of a literary work of which I am aware (cf. Vogel

1 2

3 4

Translated by Alex Skinner. I would like to thank Katja Mellmann, Volker Heeschen and Eckart Voland for comments of earlier drafts. Biological analogies, currently found in such forms as so-called “meme theory,” represent a special problem, as does the problem of “cultural evolution” as the evolution of culture. This is not my concern in the present article. But see Eibl 2009d, esp. chapter 6: “Gibt es kulturelle Evolution?”. I use the term “scientific” in a programmatic sense here. For a look at fundamental aspects of the relationship between the human sciences and humanities, see my dispute with Frank Kelleter: Eibl 2007. “Der erste, der – vor Jahrhunderten! – auf Sonne Wonne reimte, auf Herz Schmerz und auf Brust Lust, war ein Genie; der tausendste, vorausgesetzt, dass ihn diese Folge nicht bereits genierte, ein Kretin.” (Holz 1962, p. 69).

12

Karl Eibl

1991).5 It dates from 1990. To mark the sixty-fifth birthday of the great Göttingen German studies scholar Albrecht Schöne, the great Göttingen primatologist Christian Vogel delivered a lecture entitled “‘She’s not the first’. A sociobiological version of the tragedy of Gretchen.” He wove his lecture around seven questions. Why does Faust choose Gretchen? Why does Gretchen choose Faust? Why does Faust not marry Gretchen? Why does Gretchen hope to maintain contact with Faust? Why does he end up in a duel with Valentin? Why does Gretchen kill her child? Why is Gretchen sentenced to death? Vogel answers each of these questions in terms of reproductive strategy. Let’s take the sixth question as an example: Why does Gretchen kill her child? Explanation in terms of reproductive strategy: With an illegitimate child she has poor marriage prospects, in other words she has squandered her ‘residual reproductive value’. Without the protection and investment provided by a male, her illegitimate child has reduced chances of survival in any case, and the ‘poor thing’ will have scant prospects of reproduction later on. So the early killing of this unfortunate child serves to avoid bad investment and might help improve the mother’s reproductive value. Many mammalian mothers commit infanticide in comparable circumstances. (Vogel 1991, p. 33)

Mice and certain other rodents even exhibit the pregnancy block effect (Bruce effect), a kind of automatic abortion. If a new alpha male takes over within three days of conception, pregnant females within the harem detect the new pasha’s unfamiliar pheromones. This automatically triggers a miscarriage, readying them for more promising reproduction. Yet these very parallels alert us to certain differences. In the mouse’s case, the hormones decide things, as it were, among themselves. But the case of Gretchen involves something we refer to as “consciousness” or “conscience”, something that operates with categories such as honour, shame, sin, guilt etc. And she is punished not by Faust, despite having ruined his feat of reproduction, but by the anonymous legal system. In the second part of the drama the object of Faust’s desire is no less a figure than Helen, the ancient world’s most beautiful woman. His efforts in this regard, highly commendable from a reproductive point of view, are in fact crowned with success when Helen bears Faust a son. Yet Euphorion, the gene bearer, suffers an early death, and Helen too disappears, merely leaving behind her robe. An immensely rich and powerful one-hundred-year-old Faust ultimately ends up alone and without heirs. In keeping with the occasion, Vogel’s remarks amounted to a scholarly joke against a serious background. Such a perspective can direct our attention to facts that have so far been generally ignored, without immediately coming to any firm conclusions about their relevance. A growing number (though not yet thousands) of sociobiological interpretations of literary works have now appeared (cf. Cooke and Turner 1999; Gottschall and Wil5

My thanks to Eckart Voland for pointing this out to me.

How Can Evolutionary Biology Enrich the Study of Literature?

13

son 2005; Gottschall 2008),6 a character strip-tease at the end of which it is always the same naked ape who stands on the stage before us. A brief diversion, which served to break the monotony a little, came when the focus shifted to the audience. But once again, the aim was merely to reveal the purely Pleistocene motivation for behaviour. So the erotic preferences of first-year American female students were tested with the help of literary dummies, with the satisfying result that the young women were shown to have the “correct” preferences, in other words those that promote reproduction (in a Stone Age context) (cf. Kruger et al. 2005, pp. 225ff.). It has also been established that readers of nineteenth-century novels have a preference for non- or even anti-authoritarian heroes; this is said to be a legacy of the Stone Age (cf. Johnson et al. 2008, pp. 716ff.). Of course, the preference for strong, dominant heroes represents almost the same kind of legacy. But it would surely be worth examining under what conditions this or that legacy holds sway. Then, however, we would have to make a few other distinctions. Are we referring to reality, to texts or to recipients? Those of the nineteenth century or the present? Some of the exponents of a biologicallyinclined approach to literature (or of a biology with literary inclinations) pay dearly here for failing to move beyond pre-1990 sociobiology of human behaviour and resisting certain later developments in evolutionary psychology. From the point of view of a more recent evolutionary psychology it seems advisable to consider the importance of numerous complex psychological mechanisms sensitive to specific features of the environment; the importance of historical, developmental, and situational contexts; and the importance of differences and similarities across genders, across cultures, and across individuals (DeKay and Buss 1992, p. 188).7

II. Adaptation or Spandrel? As we would expect from approaches anchored in evolutionary biology, attempts at a biological aesthetics are concerned with the benefits of art and / or literature, with their reproductive value and, since you can only reproduce if you survive long enough to do so, with their survival value.8 While there is no fundamental reason to condemn this approach, it has two weaknesses. We must begin by shedding light on these if we are to avoid rushing into an im6 7 8

Almost a satirical parody: Barash and Barash 2005. Also see Buss 1995. On the theoretical framework see esp. the programmatic contributions by Tooby and Cosmides 1990; Symons 1992. See also recent studies of cognitive evolutionary psychology, such as Cosmides and Tooby 2000; Tooby et al. 2005; Tooby and Cosmides 2005. Alongside all kinds of popular works dealing with “beauty” (but which mostly deal solely with attractiveness), the following are well worth a look: Rentschler et al. 1988; Voland and Grammer 2003; Menninghaus 2003. Recent attempts (ignoring these books): Boyd 2009; Dutton 2009.

14

Karl Eibl

passe. The first weakness is a highly generalized concept of art. The second is the risk of a very limited notion of utility. Let’s turn first to the concept of art. The term “art” is one under which we bring together all kinds of peculiar phenomena – body art, epics, songs, dances, rock paintings, stories, games, buildings, sculptures, rubbish in the wrong place etc. – that correspond to our (very imprecise) everyday notion of art. Much the same applies, as it happens, to religion, culture, freedom, love, marriage, family, property and many other elevated terms of everyday usage.9 Such “cluster concepts” (cf. Gaut 2000, pp. 25ff.)10 serve as trawl nets and are quite useful for quick and fuzzy information, but not for deeper research. “Art” (singular) is a late invention. In the eighteenth century, people still generally referred to “arts” in the plural, by which they meant the broadest range of physical and intellectual skills. Only with philosophical aesthetics (and the cultural discourse of the educated classes) did the search for the essential “nature” of art begin. If we use such terms as if they referred to universals, we fall victim to our own lexical naivety. The problematic consequences are evident, among other things, in the fact that some biologically inspired reflections treat “art” (or literature) as a biological adaptation and declare all manner of useful effects of “art” evidence of this.11 One common argument states that art attracts attention. This is indeed often the case, but applied to literature it would mean that anyone who talks particularly loudly or gesticulates wildly while speaking is producing some sort of art. Another typical argument (also applied, as it happens, to religion) is that it enhanced group cohesion and thus made the art-producing populations superior to those without art.12 This does seem fairly plausible prima 9 On the special problems of ethnological “universals” see Antweiler 2007. 10 Gaut reformulates the notions of Wittgenstein and Searle. The “main features” of “cluster accounts […] are multiple criteria for the application of such concepts, though none of them are necessary. There is also a great deal of indeterminacy in how many of these criteria must apply if an object is to fall under the concept, though at the extremes there are clear cases where it does and clear cases where it does not.” (p. 26). Dutton 2009 collects 12 “cluster criteria” (Gaut has 10) and offers this “cluster concept” of art as “a neutral basis for theoretical speculation” (p. 51). “While the cluster-criteria approach to understanding art does not specify in advance how many of the criteria need to present to justify calling an object art, the list nevertheless presents in its totality a definition of art” (p. 61). But it is not a “definition of art” as an object of investigation, but a collection of real everyday uses of the word “art”, feasible for the first steps. 11 Because of this and a tendency towards panadaptationism in his work, I am unable to agree entirely with Brian Boyd’s On the Origin of Stories. But some of his ideas, especially the key term “cognitive play”, are well worth considering. See also my own numerous remarks on cognitive play and pleasure, e.g., Eibl 1993; Eibl 1994; Eibl 2004, esp. pp. 338ff., “Erzählspiele” and “Kognitionslust”, and, more recent: Eibl 2009c. 12 Several scholars, namely David Sloan Wilson, recently have reanimated the idea of “group selection”. However, we should bear in mind that biological selection must always pass through the eye of a needle, namely individual gene transmission and thus individual reproductive competition. So group selection functions only if the trait in question offers benefits

How Can Evolutionary Biology Enrich the Study of Literature?

15

facie, but is very difficult to prove; it is probably wrong when applied to certain historical conjunctures. At any rate it is very unspecific. It is true of everything that people (or animals) do together or for one another. In his novel The Flounder, Günter Grass suggested that group defecation (“Hordenschiss”) helped promote a sense of community among our ancestors. Literature especially is seen as a kind of pommel-horse for socially useful theory-of-mind exercises. And this may be true in specific instances (cf. Zunshine 2006). But for us to view these literary exercises as a relevant factor in natural selection, their effects would have to be generally demonstrable. They are not.13 Quite another case is crediting literature with an especially prodigious capacity for storing and transporting information. Shared information is a cement of human cultures.14 But would it not be enough to refer to language (and to narrative as a “parole”-phenomenon) here? There must be some reason why some (which?) information is processed in such a roundabout way, and featuring made-up stories that we would call lies in everyday life. It is this reason that a literary investigation would want to get at (cf. Scalise Sugiyama 2005 and 2008).15 Control of attention, enhanced group cohesion, the cultivation of communicative skills (creativity, edification, sublimation of the libido etc.) – they all are occasional adaptive effects; but they do not work as selection pressures producing a biological adaptation “literature” or “art”. It is crucial for any historical investigation to distinguish between biologically evolved adaptations and biologically fortuitous (but historically determined!) effects.16 “Art” is a component of human cultures and is a result of evolution for the simple reason that the human capacity for culture and the variability of the phenotypes of human culture are the outcomes of evolution (cf. Eibl 2009d). But rather than a head-on preoccupation with a biological entity called “art”, it seems to me more appropriate and more analytically fruitful to look for universal biological dispositions, which, under varying cultural

13

14 15 16

both with respect to competition between groups as well as competition between individuals within a group. Every claim of “multilevel selection” must therefore show a mechanism or an adaption (or set of adaptations) to combine individual and group interests. On the literary treatment of a particular ingenious mechanism, “altruistic punishment”, see Flesch 2007. For an empirical study see Fehr and Gächter 2002. We should at least take a sceptical view of the common notion that art or literature makes people especially sensitive. Tsiknaki 2005 looked for a correlation between the reading of literature and emotional intelligence and came to the conclusion that there is no such correlation. This negative conclusion was accompanied by a positive one: natural scientists enjoy a higher degree of emotional intelligence (of statistical significance) than their colleagues in the arts and humanities! On the importance of shared attention and shared information and the role of language constructing the “common ground” of cultures see Tomasello 2008. For an anthropological framework see Pinker 2003. On this distinction of adaptation and fortuitous effect see the seminal work Williams 1970.

16

Karl Eibl

conditions, facilitate varying forms of what we call “art” (and perhaps much else besides). A prerequisite for music is that pitch and rhythm can be identified and endowed with a specific sentiment, from the alarm signal to the Queen of the Night aria, and also that the noise caused by the making of physical objects is classified in a particular way. The biological origin of this probably lies in the calibration of hearing and the synchronization of physical activities. Painting and sculpture probably depends on processes of calibration in the machinery of visual perception. The principle of iconic imitation requires the capacity for depiction, a human privilege (cf. Hauser 2003, p. 58), similar to symbolic language, evolved as a device for mapping the world. Much the same applies to literature of course. It is a cultural composition and application of biological dispositions. The detailed symbolic description of the world, including non-present parts of the world, and the detailed envisaging of possible worlds are peculiarities of the species homo sapiens and building materials of human cultures (cf. Eibl 2009d).17 So we can also include narration among the biological prerequisites for literature – factual narration as verbal representation of non-random sequences of events (cf. Eibl 2004, pp. 255f.). The capacity to be responsive to psychological processes in others is also indispensable, those abilities, in other words, referred to as empathy and the theory of mind (cf. Mellmann 2010). The language structures to which this capacity gives rise may be linked with other dispositions and may look quite different and have different adaptive effects depending on the historical context (“literature” too, of course, is one of those everyday “cluster”-terms that can mean all kinds of things). But there is one disposition that I would like to single out right now, one which is presumably indispensable to a great deal of what we call “art”. I am referring to the capacity for play, for decoupling capacities from their original contexts of genesis, and the way such actions are rewarded not by immediate success but by something that goes by the name of “pleasure” (Aristotle: ήδονή, Horace: delectatio) in poetic theory. Of which more later. The second point, the aspect of utility, seems essential to any evolutionary explanation, even if it is not “art” that we wish to explain but rather the dispositions that make art possible in the sense outlined above. This stands in stark contrast to the category of play which we have just addressed as well as to other central categories of philosophical aesthetics or poetics. An attempt has been made to mitigate the imperative of utility by positing a theory of by-products. I cite it here in the shape of the spandrel “theory” put forward by Stephen J. Gould and Richard Lewontin as this version has become fairly widely known among biologically-inclined humanities scholars (biologists tend to regard it as the literary interpretation of a triviality) (cf. 17 On the objectifying function of human language in particular see Eibl 2004, pp. 232–276.

How Can Evolutionary Biology Enrich the Study of Literature?

17

Gould and Lewontin 1979).18 In San Marco in Venice, Gould had a flash of inspiration. The spandrels formed by two arches in the shape of an upsidedown triangle serve no structural purpose, but can be used as a surface for elaborate mosaics. And Gould believes that the same thing applies to evolution. Adaptations are accompanied by by-products that in themselves have no adaptive utility. This is the idea that Gould puts forward to counter “panadaptionism” or “ultra-Darwinism”. Though this is largely a straw man, the fact to which Gould is drawing our attention here is of much importance. The origin (and ultimate causation) of characteristics must be distinguished from their contemporary – or indeed any subsequent – application. In colloquial terms, many qualities started out small, that is, as byproducts. But they could endure only if they were linked necessarily and indivisibly with a base product (to take a popular example: the fact that bones are white is due to calcium, but has no adaptive value in itself) and / or if they themselves took on new long-term-functions and thus evolved into adaptations in their own right.19 (There are also largely adiaphoristic characteristics that are described as evolutionary noise, such as the shape of the nose, eye colour and so on.) The spandrel or by-product hypothesis does not really mitigate the thesis of utility, but by distinguishing between evolutionary context of origin and new context of application, it is capable of coping with a far greater degree of complexity – as evolutionary psychology has been doing for some time now. Steven Pinker has brought this out with a nice, simple example. He, too, is an exponent of the by-product hypothesis and believes that, from an evolutionary perspective, “art” is something like strawberry cheesecake. The fondness for this delicacy is not a product of evolution, but the fondness for fat and sugar, for certain colours and aromas, certainly is. Those who threw themselves upon the nourishing bits first had better chances of survival and reproduction, and the legacy of these individuals is that we are enticed by compositions of fat and sugar of which our forebears could never have dreamt (cf. Pinker 1997, pp. 524f.).20 As adjuncts to a chat over a cup of coffee, these cultural inventions may also promote group cohesion ...

18 For a retrospective see Gould 1997. Elsewhere I have discussed this topic in light of Steven Pinker’s similar by-product thesis (cf., e.g., Eibl 2004, p. 310). 19 These “preparations” in elder Darwinism used to be known as “pre-adaptations”. Gould replaces this quasi-teleological term with the neologism “exaptions” or “exadaptations”, though “predispositions” had long since taken hold. 20 An interesting discussion of contemporary trends in “literary Darwinism” appears in Pinker 2007.

18

Karl Eibl

III. Pleasure So – pleasure is the thing. The diagnosis of “pleasure” frequently appears in aesthetic discourse as explanation of last resort, whether as justification for a preoccupation with seemingly pointless things or as moralizing critique of “mere” pleasure. This is highly plausible intuitively: We all know roughly what is meant from our own experience. This cheating self-evidence can easily conceal the fact that “pleasure” itself requires explanation. What are the ancient selective pressures and benefits of pleasure and what new functions or effects might it have taken on? Animals, too, enjoy themselves.21 Karl Groos, a classical figure in the biological theory of play,22 whose work is still well worth studying, was one of the first to make a point of stressing the Einübungs- und Selbstausbildungswert (cf. Groos 1930, pp. 49ff.) of play (its value as “rehearsal” for later activities and as a means of ontogenetic accomplishment), a concept with which he replaced the old Surplus Energy Theory of play. “In contrast with later serious exercise (Ausübung), play enables a preparation (Vorübung) and practice (Einübung) for the special instincts” (Groos 1898, p. XX, parentheses by E. L. Baldwin). The notion of Einübung und Selbstausbildung appears in modern guise in the work of Leda Cosmides and John Tooby, two leading exponents of evolutionary psychology. But they also bring out points of contact with fictional literature and art as a whole, furnishing us with the first viable bridge from evolutionary biology to art / literature (cf. Tooby and Cosmides 2001).23 They distinguish between a functional mode and an organizational mode in which adaptations are carried out. The organizational mode in fact refers to the play mode that is deployed with a view to Einübung und Selbstausbildung, that is, the ontogenetic completion of the organism. So the dog battles “furiously” for the slipper, the bird soars through the air rejoicing meaninglessly and the lion cubs tussle over nothing. The organizational or play mode has a clearly identifiable use. This is especially evident in the case of young individuals that must develop their abilities and adapt them to the environment. It is less common for older animals to play. But they, too, must organize their cognitive apparatus, though in their case it is more a matter of servicing and maintenance than new developments. Hu-

21 For a rich but argumentatively rather unscrupulous account, see Balcombe 2006. 22 Cf. Groos 1899/1973; Groos 1898/1930. I was first alerted to Groos by Werner Strube. 23 Brian Boyd disregards the bridge. He ignores the essay in his book (2009), though he could have refined and enriched his arguments in light of it. Unfortunately, in his contribution to Gottschall and Wilson 2005 (pp. 168–170), he delivers some very substandard criticism. Joseph Carroll in the same volume sketches a “caricature” (p. 80) of Evolutionary Psychology. But what’s the use of it? “EP”, as a consistent research programme, may be laborious, but one cannot get its results without its strictness. See the review Eibl and Mellmann 2007; Mellmann 2011.

How Can Evolutionary Biology Enrich the Study of Literature?

19

man beings in particular, with their highly complex cognitive apparatus, continue to exhibit play behaviours into old age. But the benefit of the organizational or pleasure mode does not show itself as an outcome of the actions themselves. It is a benefit that exceeds the time horizon of the player. And this is where we see the key function of pleasure as an intrinsic motivation. It would simply be foolish to chase after a rubber ball or a ball of wool only to get nothing at all in return. Such behaviour may in fact be very useful in that it strengthens the muscles, lends elasticity to the joints, adjusts the sense of sight, calibrates the sense of balance, and so on. Yet no cat and very few people think about subsequent utility while engaging in such activities. It is not utility that motivates people to perform such actions, but pleasure. And indeed – we have arrived at last at the crucial insight – the pleasure system as an evolved adaptation. Individuals who were motivated by pleasure to engage in Einübung und Selbstausbildung were reproductively superior to those who preferred to doze the day away.24 What I have called pleasure, Tooby and Cosmides refer to as “aesthetics”. This is, of course, a provocatively broad conception of the aesthetic, but it does mark out the path towards art or the arts along which we can now travel. Which abilities, when exercised, are rewarded with pleasure by our motivational system? I shall disregard physical activities – sex, jogging, chopping wood etc. – that would certainly repay in-depth examination, and restrict myself to our cognitive apparatus for processing and producing the world. And what we can say straight off is that the entire cognitive apparatus is capable of art in this sense, that is, every part (module, tool) of it may be activated in a way that involves no immediate objective and gives pleasure.

IV. Constructing Meaning Through an Adaptive Toolbox A glimpse at the plastic arts may help us approach our topic sideways-on.25 The capacity for depiction is not, of course, the only disposition that makes them possible. Both the invention of abstract painting around 1900 and cen24 I suspect that this is reinforced by the stress-pleasure system: among the endocrinal consequences of constant stress is a marked reduction in reproductive ability. Accordingly, all activities that alleviate stress offer a reproductive advantage and are therefore reinforced by evolution. This is particularly effective in the case of human beings because of their exceptional potential for anxiety (see Eibl 2004; Eibl 2010b). I shall take the opportunity to mention a fairly typical misunderstanding at this point. My argument has been taken to mean that people who concern themselves with art have more sex than others. In fact I’m putting forward a causal explanation of why pleasurable preoccupation with useless things had any chance in evolutionary terms (ultimate causation). But once this pleasurable preoccupation with useless things has been genetically established, as “proximate causation” it may also encourage anything from meditation in monastic solitude to symphony concerts. 25 An outstanding work now is Eibl-Eibesfeldt and Sütterlin 2007.

20

Karl Eibl

turies of Islamic art demonstrate that visual art does not necessarily represent real-world objects. What we deploy here are elementary functions of our toolkit of geometric measurement.26 We may elucidate this by noting that nature lacks perfectly straight lines, circles and consistent symmetry. Evolution has equipped us with measuring instruments that we apply to reality. These measuring instruments, as well as the perception of colour, must be constantly recalibrated, in other words, checked to ensure a snug fit with reality. This happens quite unconsciously. But we feel pleasure whenever the calibration process confirms the functioning of the measuring norm by accordance or by difference. This is pleasure at the fact that our cognitive toolkit is working properly. This pleasure is probably also the experiential basis of those idealist forms of aesthetics that conceive of “beauty” as the harmonious perception of the order of the world as reflected in microcosm. What we have touched on here with respect to visual perception can be applied to all other feats of structuring performed by our cognitive apparatus, to everything that philosophers have thought of as a priori knowledge or a priori forms of perception or categories.27 Causality and teleology, for example, are tried-and-tested innate schematic templates or “gestalts”, as is the method of induction, which directs our attention to repetitions of all kinds and also allows us to produce them, from the regularities of everyday life to the construction of cyclical worldviews (cf. Eibl 2009a). But it is not just rather formal ordering categories such as these that we find among our evolved and innate resources. We are also equipped with specific ways of processing meaning. These are particularly evident in a number of avoidance responses, which are, so to speak, ready to spring into action at any time in the shape of fears, from fear of snakes through fear of the dark to vertigo. Innate world-structuring instruments of this kind are also at work when we create fictional worlds. And the associated appeals to emotion also play a role in the perception of fictional worlds. This is because the original, evolutionary goal consists in testing and cultivating the responsiveness of our psychological apparatus.28 Even ἔλεοϛ and φόβοϛ (“pity” and “fear” or “lament” and “shudder”), as identified by Aristotle as the effect of tragedy, can give pleasure because they allow us to enjoy our own capacity for pity and fear in a relaxed state. So I shall allow myself the half-serious joke of using old Aristotle’s mysterious catharsis to my own ends (as most “western” aestheticians have, of course, done): If the arousing of pity and fear in tragedy leads to the cleansing of these (and similar) emotions, does this not 26 On this sort of art and its “gestalt”-psychological requirements see Gombrich 1984. 27 See esp. the work of Gerhard Vollmer, e.g., Vollmer 2003. Unfortunately, evolutionary epistemology has been thwarted by futile squabbles over the existence of the world, which has obstructed its development as a genuine programme of scientific research. 28 On the emotions in this context, see Mellmann 2006b, which features a detailed discussion of fundamentals/theory, corroborated by proving it on a crucial period of German literature.

How Can Evolutionary Biology Enrich the Study of Literature?

21

mean that these emotions, having been liberated from a posteriori ties to goals and functions, are being switched into the organizational mode? Analytical philosophers have discovered a paradox of fiction and a paradox of suspense,29 which supposedly come about when we become emotionally engaged in fictional worlds: we become emotionally involved in made-up stories, even on the second reading / hearing in the case of exciting stories, despite knowing that they are made up or how they end. Yet paradoxy is a quality of formulations, not of reality (except for Hegelians, of course), and as scientists of the real we would do well to align our formulations with reality. Otherwise we might just as well refer to the paradox of idle running whenever someone revs up the engine of a stationary car. The mechanic will explain to the gaping philosopher that the engine has been decoupled from the wheels and that the revs are being increased to test it.30 In any case, this evolved capacity for decoupling mental programmes from their real purposes, and pleasure as the reward for such “purposeless” activities, constitute a key prerequisite for art behaviour. It is because of this decoupling that behavioural programmes can be enjoyed as abilities in a kind of quarantine room, unhindered by real dangers or needs. The problem of tension is rather more concrete than that of fiction, so we can make our analysis more concrete as well. Tension, in the sense of suspense or even mystery, arises from the unsettling expectation that an informational complex is being completed. A classic example of real tension may be the emotional state of the accused prior to the announcing of judgment. If he or she could relive this moment again and again, or wanted to do so, this would indeed be paradoxical (or perverse). Things are different with literature. Certainly, here too there are circumstances in which tension arises through incomplete information. Many jokes and riddles for example owe their effect to the fact that an incomprehensible state of affairs – or even a merely inappropriate one – has been recontextualized by a new piece of information. Again, this effect cannot be repeated, as you would first have to repeat the stage of inadequate knowledge as well. Much the same applies to low-brow literature, such as detective stories good for only one reading, in as much as they are sustained solely by the question of “whodunit?”. But even if there is no tension of this sort, this still leaves us with the 29 On the paradox of fiction, see Levinson 1997; and Part 1, “The Paradox of Fiction” (idem, pp. 37–92). Cf. the solution put forward by Mellmann 2006a; see also Mellmann 2002. On the dummy solution, see Schwender 2006. On the paradox of suspense, see Carroll 1996. See also Mellmann 2007; Irsigler et al. 2008. 30 The technical simile is been offered by Cosmides and Tooby 2000: “Like a clutch in an automobile, supposition and other scope operators allow the controlled engagement or disengagement of powerful sets of representations that can contain rich descriptions and acquired, domain-specific inference engines that can be applied when their preconditions are met. These operators provide vehicles whereby information that may or may not be counterfactual can be processed without the output being tagged as true and stored as such.” (p. 67).

22

Karl Eibl

function of expectation as a means of ensuring narrative cohesion, and this holds true even if the point of the story is revealed right at the start. One example is Homer’s Odyssey. We already know after the first few verses that Odysseus will return home to Ithaca. The story cannot finish until then. In this case, expectation has the function of delimiting the scope of the game. Even if a vast kaleidoscope of events occurs as the story unfolds, it is not limitless. Odysseus will return home; of this at least we can be certain. Expectations or the act of focussing our attention on certain elements in a literary text essentially adhere to the same schematizations of the world that we use to guide us in everyday life. But this also means that we operate with innate “shaping” schematizations of the world even in our reception of literary works. Referring to the example mentioned above, the Odyssey, and related texts, classicist Walter Burkert has come up with the term “fantastic quest”, a form deployed in literature in a huge range of ways (cf. Burkert 1998, pp. 75f.). I myself have attempted to extend this approach a little further by interpreting epic triads in general, featuring separation and reunion, as innate plots (cf. Eibl 2008). We could identify other sequential schemata, such as the principle of detection in the analytical drama and detective story, which sets in motion our innate “cheater detector”,31 or the expectations linked with the appearance of two individuals of different gender and of reproductive age. If, on the other hand, two individuals of the same gender and equal status appear, we won’t have long to wait before they face each other in a duel (at least if these individuals are male – a special problem). Justice is one of the most valued goods in human culture. But even justice is rooted in biology (cf. Voland 1997; Cosmides and Tooby 2006). Though authors have been laughing at poetic justice for more than two centuries, as a principle of reception it is nonetheless deeply rooted in our sense of expectation and almost entirely dominates low-brow fiction. As it does the secondary literature, which is engaged in a tireless quest to establish the “guilt” of unfortunate heroes and heroines! If our sequential expectations are fulfilled, this is always an occasion for pleasure, as it confirms the accuracy of our schematic tools. This is no different than when we perceive the symmetry of objects that confirm our measuring norm (cf. Eibl 2011). Gerd Gigerenzer and colleagues have coined the inspired term “adaptive toolbox” to refer to our mind’s basic cognitive equipment as generated by evolution (cf. Gigerenzer and Selten 2001). “Toolbox” is an analogy closely related to the analogy of the Swiss army knife by Cosmides and Tooby. This toolbox contains a collection of rules of thumb, heuristics and individual tools that have developed over the course of evolution and which we

31 This is a module for which there is plenty of empirical evidence, one that renders us particularly alert to possible deception. See, e.g., Cosmides and Tooby 2008.

How Can Evolutionary Biology Enrich the Study of Literature?

23

continue to deploy today. The analogy of the toolbox conveys better than the analogy of the army knife the potential of differentiating between context of origin and context of application, of the “misuse” of tools for a novel purpose, of using several tools to solve a problem, etc. These insights, compatible with the everyday experience of every do-it-yourselfer, allow us to dispense with lengthy theoretical discussions on all-purpose tools and domain specificity.

V. Outlooks It will surely come as no surprise that it is primarily in the cognitive sciences, as well as that field of endeavour which goes by the rather peculiar name of “cognitive literary studies”, that I seek the insights that biology can offer the sciences of humanity.32 Certain fields of research – and much speculation – within evolutionary psychology exhibit a near-manic preoccupation with the topic of gender difference and gender relations.33 As a result, we may easily forget that one indispensable prerequisite for reproduction is surviving long enough. As an aspect of survival, fitness confronted men and women with the same cognitive problems, which had to be coped with using the same cognitive means. The fact that the term “cognitive sciences” is a very vague one suits me down to the ground in this context. This is because I see it not so much as a set of findings than as a research programme or perhaps just an intention, namely the intention to make the humanities an empirical or objective science of the mind. Here, evolutionary psychology can function as an integrating perspective. In terms of biology, cognitivists search for the proximate causations of our behaviour; evolutionary psychology searches for the ancient ultimate causes of these proximately acting mechanisms. So evolutionary research does two highly significant things for us. The first is to serve as a monitoring device. Whatever we consider to be part of the human being’s universal basic mental equipment ought to be explicable in an evolutionary manner, either as an adaptation or a by-product of an adaptation.34 A classic example is the death-drive postulated by some psychoanalysts, which is impossible in evolutionary terms – at least in a literal sense – and so should not be considered part of our basic equipment. (Which does not rule out the possibility that a “Sickness unto Death” à la Kierkegaard might appear as a byproduct of an adaptation under certain individual or cultural circumstances.) 32 For a recent attempt to take stock of this field, see: Huber and Winko 2009, esp. Zymner, pp. 135–154. 33 See the contributions in the official organ of the relevant scientific society at http://www. ehbonline.org/issues (last visited 23 March 2010). 34 On the distinction between cultural universals and universal dispositions, see Eibl 2009b.

24

Karl Eibl

And if someone were to assert the existence of a genotypical cheesecakedrive we would have valid reasons to dispute this as well, even if experience has taught us that it may occasionally exist phenotypically under certain cultural conditions ... But the biological perspective also allows us to get beyond the quasi-Linnean approach of certain schools of cognitive science. Carl Linneaus was what we would now call an exponent of intelligent design. He produced a system for classifying the natural world in which the plants and animals were arranged according to their characteristics, and he considered this arrangement a likeness of the divine order. But he gave no particularly valid reasons for selecting these characteristics. His definition of the primates is an example. He lists their characteristics as four upper, parallel incisors, two mammary glands on the chest of the female and the pendulous penis of the male, putting us in the same biological order as bats and sloths. Biologists have been trying for some time to replace this “artificial” system with a “natural” one inspired by real phylogenetic trees. We are faced with similar tasks if we wish to investigate the basic cognitive equipment of the human being. Order is certainly desirable, but it is no guarantee of truth. Here, biology provides us with a level of the causes of things that adds a deeper understanding to superficial findings. We might also say: the biological perspective allows us to reconstruct how the tools were made and got into the toolbox. We work with these tools when we construct the world, and the recipients of a text also work with them when they (re-)construct the meaning (the “world”) of a text. Once this text has been identified as a literary text through appropriate signals and placed in quarantine, they can enjoy the play of cognitive adaptations free of pragmatic considerations. They can even enjoy offences against these adaptations, because it is just such offences that render the adaptations especially palpable. To make a connection with the example with which we began, the principle of poetic justice demands that those such as Faust who make pacts with the Devil are in fact carried off to hell in the end (unless they feel the deepest of regret in good time). In Goethe’s Faust, however, at the moment of his greatest triumph and greatest delusion, the unrepentant villain is “adroitly snatched” away (“pfiffig weggeschnappt”) from the waiting Devil as a result of the angels’ nasty trick and carried off to Heaven where the Mother of God awaits him. This was an irritation even for many contemporaries, both pious and full-bloodedly German ones, and is still seen as deserving of criticism today. But you can also enjoy it as providing a welcome defamiliarization of the old schema, provoking some new mental activity. But we don’t have to stop at enjoyment. Even if utility provides no adequate justification for assessing art and literature as biological adaptations, in no way does this mean that they are generally useless, mere “cheesecake”. But utility comes about only as a result of the cultural processing and com-

How Can Evolutionary Biology Enrich the Study of Literature?

25

bining of biological adaptations. Here, the pleasure principle of play may be deployed as bait and decoupling device in order to serve new functions. I call this the secondary severity (cf. Eibl 2009d, p. 170). Horace supplemented his much-quoted “Aut … aut” with a following synthesis: aut prodesse volunt aut delectare poetae aut simul et iucunda et idonea dicere vitae. A bard will wish to profit or to please, Or, as a tertium quid, do both of these. (transl. John Conington)

The instrumentalization of pleasure to sugar the sometimes bitter pill of the truth has been going on since time immemorial. From this point of view, it is indeed correct to state that literature serves the preservation and transmission of information – that it may do so. Torturous material to be learned by heart is endowed with an element of pleasure when turned into a rhyme, and tiresome abstract rules attain plausibility through stories. But speech unburdened of the need to produce solutions to immediate problems may also allow us to formulate, communicate and agree on states of mind, and this may promote group coherence. Finally, even unresolved contemporary problems may be formulated in this protected area with a radicalism that other agencies of problem-solving avoid if at all possible. The structural formula of tragedy – insoluble conflict plus half-innocent corpse – expresses the contradictions but places them in the quarantine of fiction in such a way that there is no immediate need to act. So we could compile a large catalogue of all the various useful effects that may be coaxed out of literature under varying cultural conditions, from the counting-out rhyme to myths relating the origins of the world. These are new, variable problem solving devices or tools which, depending on the problem at hand, are created on the basis of the old biological adaptations – and which we may continue to regard as worthy objects of literary history.

References Antweiler, Christoph, Was ist den Menschen gemeinsam? Über Kultur und Kulturen. Darmstadt: Wissenschaftliche Buchgesellschaft, 2007. Balcombe, Jonathan, Pleasurable Kingdom: Animals and the Nature of Feeling Good, Basingstoke: Palgrave Macmillan, 2006. Barash, D. P. / N. R. Barash, Madame Bovary’s Ovaries: A Darwinian Look at Literature, New York: Delacorte, 2005. Barkow, J. H. / L. Cosmides / J. Tooby (eds.), The Adapted Mind, New York, Oxford: Oxford UP, 1992. Boyd, Brian, On the Origin of Stories. Evolution, Cognition and Fiction, Cambridge, MA, London: Harvard UP, 2009.

26

Karl Eibl

Burkert, Walter, Kulte des Altertums. Biologische Grundlagen der Religion, Munich: C. H. Beck, 1998 (English transl.: Creation of the Sacred. Tracks of Biology in Early Religions, Cambridge, MA: Harvard UP, 1998). Buss, David M., “Evolutionary Psychology: A New Paradigm for Psychological Science,” in: Psychological Inquiry 6.1 (1995), pp. 1–30 (German transl.: “Evolutionspsychologie – ein neues Paradigma für die psychologische Wissenschaft?” in: Gene, Meme und Gehirne. Eine Debatte, ed. by A. Becker et al., Frankfurt/M.: Suhrkamp, 2003, pp. 137–226). Carroll, Noël, “The Paradox of Suspense,” in: Suspense. Conceptualizations, Theoretical Analyses, and Empirical Explorations, ed. by Peter Vorderer, Hans J. Wulff and Mike Friedrichsen, Mahwah, NJ: Erlbaum, 1996, pp. 71–92. Cooke, B. / F. Turner (eds.), Biopoetics. Evolutionary Explorations in the Arts, Lexington: ICUS, 1999. Cosmides, Leda / John Tooby, “Consider the Source: The Evolution of Adaptations for Decoupling and Metarepresentation,” in: Metarepresentations: A Multidisciplinary Perspective, ed. by Dan Sperber, New York: Oxford UP, 2000, pp. 53–115. –, “Evolutionary Psychology, Moral Heuristics, and the Law,” in: Heuristics and the Law, ed. by Gerd Gigerenzer and Christoph Engel, Cambridge, MA: MIT Press, 2006, pp. 175–206. –, “Can a General Deontic Logic Capture the Facts of Human Moral Reasoning? How the Mind Interprets Social Exchange Rules and Detects Cheaters,” in: Moral Psychology, ed. by W. Sinnott-Armstrong, Cambridge, MA: MIT Press, 2008, pp. 53–119. DeKay, W. T. / David M. Buss, “Human nature, individual differences, and the importance of context: Perspectives from evolutionary psychology,” in: Current Directions in Psychological Science 1 (1992), pp. 184–189. Dutton, Denis, The Art Instinct. Beauty, Pleasure, and Human Evolution, New York et al.: Bloomsbury, 2009. Eibl, Karl, “Strukturierte Nichtwelten. Zur Biologie der Poesie,” in: Internationales Archiv für Sozialgeschichte der deutschen Literatur 18.2 (1993), pp. 1–36. –, Die Entstehung der Poesie, Frankfurt/M.: Insel, 1994. –, Das monumentale Ich. Wege zu Goethes Faust, Frankfurt/M.: Insel, 2000. –, Animal poeta. Bausteine der biologischen Kultur- und Literaturtheorie, Paderborn: Mentis, 2004. –, “On the Redskins of Scientism and the Aesthetes in the Circled Wagons,” in: Journal of Literary Theory 1.2 (2007), 421–441 (German version: http://www.karleibl.de/Wagenburg.pdf, 23 March 2010). –, “Epische Triaden. Über eine stammesgeschichtlich verwurzelte Gestalt des Erzählens,” in: Journal of Literary Theory 2.2 (2008), pp. 197–208. –, “The Induction Instinct: Evolution and Poetic Application of a Cognitive Tool,” in: Studies in the Literary Imagination 42.2 (2009), pp. 43–60 (= 2009a). –, “Universelle Dispositionen und manifeste Fast-Universalien,” in: Erwägen Wissen Ethik 20.3 (2009), pp. 364–367 (= 2009b). –, “Vom Ursprung der Kultur im Spiel. Ein evolutionsbiologischer Zugang,” in: Literatur als Spiel. Evolutionsbiologische, ästhetische und pädagogische Aspekte. Beiträge zum Deutschen Germanistentag 2007, ed. by Thomas Anz and Heinrich Kaulen, Berlin, New York: de Gruyter, 2009, pp. 19–33 (= 2009c).

How Can Evolutionary Biology Enrich the Study of Literature?

27

–, Kultur als Zwischenwelt. Eine evolutionsbiologische Perspektive, Frankfurt/M.: Suhrkamp, 2009 (= 2009d). –, “Sprache macht Kultur,” in: Der Mensch – Evolution, Natur und Kultur, ed. by Jochen Oehler, Heidelberg: Springer, 2010, pp. 109–126 (= 2010a). –, “Survival of the happiest. Über den Nutzen des ästhetischen Vergnügens,” in: Evolution und Kultur des Menschen, ed. by Ernst Peter Fischer and Klaus Wiegand, Frankfurt/M.: Fischer, 2010, pp. 197–219 (= 2010b). –, “Poetische Gerechtigkeit als Sinngenerator,” in: Poetische Gerechtigkeit – Weltliteratur und Wertung, ed. by Sebastian Donat, Roger Lüdeke, Stephan Packard and Virginia Richter, Düsseldorf: UP, 2011. Eibl, Karl / Katja Mellmann, “Literatur als Repertorium der Soziobiologie,” in: KulturPoetik 7.2 (2007), pp. 277–283. Eibl-Eibesfeldt, I. / C. Sütterlin, Weltsprache Kunst. Zur Natur- und Kunstgeschichte bildlicher Kommunikation, Wien: Brandstätter, 2007. Fehr, E. / S. Gächter, “Altruistic punishment in humans,” in: Nature 415 (2002), pp. 137–140. Flesch, William, Comeuppance. Costly Signaling, Altruistic Punishment, and Other Biological Components of Fiction, Cambridge, MA: Harvard UP, 2007. Gaut, Berys, “‘Art’ as a Cluster Concept,” in: Theories of Art Today, ed. by Noël Carroll, Madison, WI: University of Wisconsin Press, 2000, pp. 25–44. Gigerenzer, Gerd / Reinhard Selten, Bounded Rationality: The Adaptive Toolbox, Cambridge, MA: MIT Press, 2001. Gombrich, Ernst H., The Sense of Order. A Study in the Psychology of Decorative Art, London/New York: Phaidon, 21984. Gottschall, Jonathan, The Rape of Troy: Evolution, Violence and the World of Homer, Cambridge: UP, 2008. Gottschall, J. / D. S. Wilson (eds.), The Literary Animal, Evanston, IL: Northwestern UP, 2005. Gould, Stephen J., “The Exaptive Excellence of Spandrels as a Term and Prototype,” in: Proceedings of the National Academy of Sciences USA 94 (1997), pp. 10750–10755. Gould, Stephen J. / Richard C. Lewontin, “The Spandrels of San Marco and the Panglossian Paradigm: A Critique of the Adaptationist Programme,” in: Proceedings of the Royal Society of London B 205 (1979), pp. 581–598. Groos, Karl, Die Spiele der Tiere, Jena: Fischer ,31930 (first published 1896; English transl.: The Play of Animals, New York: Appleton, 1898, rpt. by Kessinger Pub Co, 2007; http://www.brocku.ca/MeadProject/Groos/Groos_1898/Groos_1898_toc.html, 23 March 2010). –, Die Spiele der Menschen, Hildesheim, New York: Olms, 1973 (first published Stuttgart 1899; English transl.: The Play of Man, New York: Appleton, 1901, rpt. by Kessinger Pub Co, 2005; http://www.brocku.ca/MeadProject/Groos/Groos_1901/Groos_1901_toc.html, 23 March 2010). Hauser, Marc D., Wild Minds. What Animals Really Think, New York: Holt, 2003. Holz, Arno, “Selbstanzeige des ‘Phantasus’,” Arno Holz: Werke, ed. by Wilhelm Emrich and Anita Holz. vol. 5, Berlin: Luchterhand, 1962.

28

Karl Eibl

Huber, M. / S. Winko (eds.), Literatur und Kognition. Bestandsaufnahme und Perspektiven eines Arbeitsfeldes, Paderborn: Mentis, 2009. Irsigler, I. / D. Langer (eds.), Zwischen Text und Leser. Studien zu Begriff, Geschichte und Funktion literarischer Spannung, Munich: text+kritik, 2008. Johnson, J. A. / J. Carroll / J. Gottschall / D. Kruger, “Hierarchy in the Library: Egalitarian Dynamics in Victorian Novels,” in: Evolutionary Psychology 6.4 (2008), pp. 716– 738. Kruger, D. J. / M. Fisher / I. Jobling, “Proper Hero Dads and Dark Hero Cads. Alternate Mating Strategies Exemplified in British Romantic Literature,” in: The Literary Animal, ed. by Gottschall and Wilson, Evanston, IL: Northwestern UP, 2005, pp. 225–243. Levinson, Jerrold, “Emotion in Response to Art. A Survey of the Terrain,” in: Emotion and the Arts, ed. by Mette Hjort and Sue Laver, New York, Oxford: Oxford UP, 1997, pp. 20–34. Mellmann, Katja, “E-Motion – Being Moved by Fiction and Media? Notes on Fictional Worlds, Virtual Contacts, and the Reality of Emotions,” in: PsyArt. An Online Journal for the Psychological Study of the Arts 6 (2002), http://www.clas.ufl.edu/ipsa/journal/2002_mellmann01.shtml, 23 March 2010). –, “Literatur als emotionale Attrappe. Eine evolutionspsychologische Lösung des ‘paradox of fiction’,” in: Heuristiken der Literaturwissenschaft. Disziplinexterne Perspektiven auf Literatur, ed. by Uta Klein, Katja Mellmann and Steffanie Metzger, Paderborn: Mentis, 2006, pp. 145–166 (= 2006a). –, Emotionalisierung – Von der Nebenstundenpoesie zum Buch als Freund. Eine emotionspsychologische Analyse der Literatur der Aufklärungsepoche, Paderborn: Mentis, 2006 (= 2006b). –, “Vorschlag zu einer emotionspsychologischen Bestimmung von ‘Spannung’,” in: Im Rücken der Kulturen, ed. by Karl Eibl, Katja Mellmann and Rüdiger Zymner, Paderborn: Mentis, 2007, pp. 241–268. –, “Objects of ‘empathy’. Characters (and other such things) as psycho-poetic effects,” in: Characters in Fictional Worlds, ed. by Jens Eder, Fotis Jannidis and Ralf Schneider, Berlin, New York: de Gruyter 2010, pp. 416–441. –, “Evolutionary Psychology as a Heuristic in Literary Studies,” in: The Evolution of Literature. Legacies of Darwin in European Cultures, ed. by Simon J. James and Nicholas Saul, Amsterdam: Rodopi 2011, pp. 299–317. Menninghaus, Winfried, Das Versprechen der Schönheit, Frankfurt/M.: Suhrkamp, 2003. Pinker, Steven, How the Mind Works, New York: Norton, 1997. –, “Language as an Adaptation to the Cognitive Niche,” in: Language Evolution. States of the Art, ed. by Morten H. Christiansen and Simon Kirby, New York: Oxford, UP, 2003, pp. 16–37. –, “Toward a Consilient Study of Literature,” in: Philosophy and Literature 31.1 (2007), pp. 162–178. Rentschler, I. / B. Herzberger / D. Epstein (eds.), Beauty and the Brain. Biological Aspects of Aesthetics, Basel et al.: Birkhäuser, 1988. Scalise Sugiyama, Michelle, “Reverse-Engineering Narrative: Evidence of Special Design,” in: The Literary Animal, ed. by Gottschall and Wilson, Evanston, IL: Northwestern UP, 2005, pp. 177–196. –, “Information is the Stuff of Narrative,” in: Style 42.2 & 3 (2008), pp. 254–260.

How Can Evolutionary Biology Enrich the Study of Literature?

29

Schwender, Clemens, Medien und Emotionen. Evolutionspsychologische Bausteine zu einer Medientheorie, Wiesbaden: Deutscher Universitätsverlag, 22006. Symons, Donald, “On the Use and Misuse of Darwinism in the Study of Human Behavior,” in: The Adapted Mind, ed. by Jerome H. Barkow, Leda Cosmides and John Tooby, New York, Oxford: Oxford UP, 1992, pp. 137–162. Tomasello, Michael, Origins of Human Communications, Cambridge, MA: MIT Press, 2008 (German transl.: Die Ursprünge der menschlichen Kommunikation, Frankfurt/M.: Suhrkamp, 2009). Tooby, J. / L. Cosmides, “The Past Explains the Present: Emotional Adaptations and the Structure of Ancestral Environments,” in: Ethology and Sociobiology 11 (1990), pp. 375–424. –, „Evolutionary psychology: Conceptual foundations,” in: The Handbook of Evolutionary Psychology, ed. by David M. Buss, Hoboken: Wiley, 2005, pp. 5–67 (http://www.cbd.ucla.edu/downloads/concept-j16.pdf, 23 March 2010). –, “Does Beauty Build Adapted Minds? Toward an Evolutionary Theory of Aesthetics, Fiction and the Arts,” in: SubStance. A Review of Theory and Literary Criticism 30:1.2 (2001), issue 94/95, special issue: On the Origin of Fictions, pp. 6–27 (German transl.: “Schönheit und mentale Fitness. Auf dem Weg zu einer evolutionären Ästhetik,” in: Heuristiken der Literaturwissenschaft. Disziplinexterne Perspektiven auf Literatur, ed. by Uta Klein, Katja Mellmann and Steffanie Metzger, Paderborn: Mentis, 2006, pp. 217– 244). Tooby, J. / L. Cosmides / H. C. Barrett, “Resolving the Debate on Innate Ideas: Learnability Constraints and the Evolved Interpenetration of Motivational and Conceptual Functions,” in: The Innate Mind: Structure and Content, ed. by Peter Carruthers, Stephen Laurence and Stephen Stich, New York: Oxford UP, 2005, pp. 305–337. Tsiknaki, Eirini, Literatur und Persönlichkeitsentwicklung. Eine empirische Untersuchung zur Erfassung des Zusammenhangs zwischen literarischem Lesen und Emotionaler Intelligenz, Munich: Meidenbauer, 2005. Vogel, Christian, “‘Sie ist die erste nicht!’ Eine soziobiologische Version der GretchenTragödie,” in: Grenzübertritte. Drei Vorträge zur deutschen Literatur, ed. by Manfred Eigen, Christian Vogel and Lothar Perlitt, Göttingen: Vandenhoek, 1991, pp. 22–35. Voland, Eckart, “Von der Ordnung ohne Recht zum Recht durch Ordnung. Die Entstehung von Rechtsnormen aus evolutionsbiologischer Sicht,” in: Zur Entwicklung von Rechtsbewusstsein, ed. by Ernst Joachim Lampe, Frankfurt/M.: Suhrkamp, 1997, pp. 111–133. Voland, E. / K. Grammer (eds.), Evolutionary Aesthetics, Berlin et al.: Springer, 2003. Vollmer, Gerhard, Wieso können wir die Welt erkennen? Stuttgart: Hirzel, 2003. Williams, George C., Adaptation and Natural Selection. A Critique of Some Current Evolutionary Thought, Princeton: Princeton UP, 31970. Zunshine, Lisa, Why we Read Fiction. Theory of Mind and the Novel, Columbus: Ohio State UP, 2006. Zymner, Rüdiger, “Körper, Geist und Literatur. Perspektiven der ‘Kognitiven Literaturwissenschaft’ – eine kritische Bestandsaufnahme,” in: Literatur und Kognition. Bestandsaufnahme und Perspektiven eines Arbeitsfeldes, ed. by M. Huber and S. Winko, Paderborn: Mentis, 2009, pp. 135–154.

30

Is Storytelling a Biological Adaptation? Preliminary Thoughts on How to Pose That Question Katja Mellmann

Verbal storytelling – in a sense broad enough to include all forms from casual conversation across oral folklore to written literature – seems to be a universal human activity and has thus been considered an evolutionary adaptation several times in the past few years. The fact that a particular trait is a specieswide universal, however, does not automatically make it an adaptation; it could also be a contingent universal, that is, a cultural behavior which notably relies on biological substrates and therefore emerges in similar fashions in all human cultures, times, and milieus. Yet verbal storytelling is not only universal but also distinct to our species. The uniqueness of a trait can indeed be indicative of a biological adaptation1 in that we have reason to assume that this trait emerged newly in the given animal lineage and thus might owe its existence to the process of natural selection. However, since verbal storytelling completely depends on language, that is, another uniquely human faculty,2 the uniqueness of storytelling is hardly surprising and cannot serve as a conclusive argument for considering storytelling itself to be a specifically selected trait. Storytelling could simply be a particular use of language (though we shall see below that the relationship between language and narration is a little more complicated). A third possible indication of a biological adaptation, however, is the fact that storytelling seems to be a notably self-rewarding activity. It occurs on a much larger scale than would seem justified by rational choice or other reasons. As fitness-enhancing behaviors should, as a rule, be intrinsically motivated under certain conditions, the unusually high frequency of

1

2

Note that this is not to say that, conversely, a trait has to be distinct to a species in order to be an adaptation. There are many adaptations which we have in common with other species (socalled “homologues,” which derive from common ancestors, and “analogues,” which result from comparable selection pressures). Though much more of the capabilities involved in producing and understanding language than previously thought can also be found in other animals (cf. Hauser and Fitch 2003), there are strong reasons to assume that human language in its present form, i.e., as an incomparably sophisticated design for “grammar,” is a distinct adaptation of the human species (cf. Pinker 2003); see also Donald 1991, pp. 236–261.

Is Storytelling a Biological Adaptation?

31

storytelling might indeed be revealing of an innate preference for this behavior. The hypotheses put forward in this chapter will build mainly on that last-mentioned aspect. I shall ask: What are these conditions under which people “instinctively” – that is, spontaneously, effortlessly and pleasurably – begin to tell stories, and about what? To what suppositions about the original adaptive function of storytelling do these situational conditions and the pertinent stories’ properties guide us? Hence I do contemplate the possibility that storytelling is an evolutionary adaptation of the human mind, although I will not be able to conclude this chapter with a definite Yes or No response to the question stated in my title. I do not think this question is unanswerable, but I believe that a lot of empirical testing will have to be done before trying a sustainable answer. Yet before answering a question it is good to carefully think about how to pose it in the first place. Thus, even if the following considerations cannot be more than preliminaries to future research, I regard them as indispensable, because fruitful empirical tests prerequire a detailed theory from which we can derive risky hypotheses. Most of the existing proposals for viewing human storytelling as a biologically adaptive trait do not provide such a detailed, and thus testable, theory. The most frequent kind of statements in this vein consist in the observation that storytelling is a human universal plus the more or less straightforwardly connected search for its adaptive function. However, as I said above, the fact that a trait is universal does not guarantee that it also is an adaptation in the biological sense of the term, and asking immediately what function it has been selected for might be precipitate. Accordingly, propositions for the adaptive value of storytelling are numerous and sometimes resemble “just so” stories3 rather than adaptationist analyses. They often deal with very extensive notions of “narrative” and suggest, for example, that narrative fosters social cohesion, enables (collective and individual) identity, enhances emotional intelligence, facilitates creativity and thinking beyond the here-and-now, or absorbs and assimilates the complexity of the world. These may all be important effects of storytelling,4 but they are not 3 4

The title of Kipling’s deliberately fanciful etiological tales about the origins of animal characteristics is a commonly used expression in criticizing evolutionary explanations which do not meet the criteria of testable hypotheses. I emphasize “may,” because evidence that the engagement with stories really has such effects sometimes indeed seems hard to get. With respect to emotional intelligence (EI), for example, the (non-significant) negative (!) correlation of EI with studying literature (and, remarkably, a significant positive correlation of EI with an education in the natural sciences) found by Eirini Tsiknaki (2005) should at least make us cautious; all the more as the study clearly set out to affirm a positive correlation between reading and EI. The usual reference for positive evidence is Keith Oatley and colleagues (e.g., Mar et al. 2006; Mar et al. 2009), but their studies are, as far as I can tell, best interpreted as studies on the role of stories in ontogenetic development. It is not surprising that empathic skills develop better in a child if it is served with adequate

32

Katja Mellmann

suitable as evolutionary explanations on the ultimate level. First, because asking what something might be “good for” is not automatically identical with determining the crucial advantage in gene reproduction. Second, because the adaptive values of the mentioned kinds are not cogently related to any particular behavior of storytelling but could be ascribed to a multitude of cultural activities, if not to culture itself. As propositions of this kind mostly occur as casual, sometimes merely parenthetical, remarks and rarely in the form of detailed demonstrations – and as they are uncountable in number –, I will not discuss them individually here but confine myself to propositions substantial enough to require serious discussion. A second, more elaborate type of pro-adaptation statement postpones the question of the ultimate cause for a while and first focuses on the proximate mechanism. Those approaches ask if we have reasons to assume a “special design” behind the universal human activity of storytelling. One way to approach this question is to investigate narrative form, or “narrativity,” in order to decide whether those forms of speech called “narrative” are both consistent and specific enough to assume a “hard-wired” cognitive program that produces them. While I think that this is a very good idea in principle, this method has not yet lead to convincing results, as I shall outline in the first section of this chapter. If we take away from narrative structure everything that can be explained as a byproduct of other cognitive faculties, very little (if anything) remains that would require additional explanation. Another way of searching for a “special design” behind storytelling, though, would be to look not at the objectified product of the assumed mechanism but at the producing mechanism itself, that is, to investigate the specificity of the behavior of storytelling and its circumstances. This is why, in the second section, I will focus on narration as behavior rather than a particular form or structure. If I am right in assuming that there is something like an “instinctive” behavior of storytelling that reveals itself in an improbably high ratio of occurrence (and this, so far, is largely speculation),5 then we would indeed have something in need of explanation. However, even then, as we shall see, this behavior seems to comprise a plurality of specific cognitive mechanisms rather than being one distinct cogni-

5

stimuli during the appropriate sensitive period, and that a deprivation of such stimuli entails a poorer development. But the question in the above-mentioned line of argument is not whether stories are suitable stimuli for a specific developmental demand but whether the engagement with stories generally (that is, also and foremost in mature organisms) enhances our social and emotional intelligence (and if so, whether this is a selectionally relevant advantage). For a comprehensive and critical survey of research on the question of whether reading enhances empathic skills, and whether this entails a raised preparedness for prosocial behavior, see Keen 2007. For a survey of first research in this respect see Foster 2004, pp. 78–99; also Dunbar et al. 1997, esp. pp. 232f., and Barrett et al. 2001, pp. 334–336. Analyses of media content (like those by Schwender 2006) are also informative in this regard.

Is Storytelling a Biological Adaptation?

33

tive program per se. I shall conclude with the supposition that verbal storytelling is probably the convergent effect of an entire suite of adaptations to different selection pressures. In this perspective, Michelle Scalise Sugiyama’s proposition that narrative originally evolved as a means to store and transmit adaptive information6 will be assessed as a still valid but generalized formulation which requires differentiation into “hard-wired” biological adaptations on the one hand and early cultural uses of language and narration on the other. Drawing on Robin Dunbar’s theory of language evolution, I also try to sketch a chronology for the evolutionary emergence of the narration instincts hypothesized in this chapter, considering the exchange of social knowledge to be the first among them (and thus supporting the frequently expressed hunch that storytelling performs an eminently social function; cf. Carrithers 1991; Scalise Sugiyama 1996; Dautenhahn 2003; László 2003; Oatley and Mar 2005; Flesch 2007; Hoeg 2009).

I. Looking for the explanandum To assume a biological adaptation means to assume a functional physiological or psychological design. It can be described as a “hard-wired” combination of submechanisms that was selected over other variants and now reliably develops in every healthy member of a species. If storytelling is not merely the effect of several biological substrates that combine similarly in every storytelling act, but the reliable product of a special cognitive design, then all stories across times, places, and individuals, should look pretty much the same. On the one hand, this seems to be indeed the case if we look at the numerous “narrative universals” that have been suggested, for instance, through Vladimir Propp’s fairytale analyses and also some more recent studies on plot “archetypes” (cf. Booker 2004; Bischof 1998), emotional story prototypes (cf. Hogan 2003), or “epic triads” as innate plots (cf. Eibl 2008). Moreover, we all roughly know what we mean by “narrative” and have a commonsensical idea of what a narrative looks like. Even if a completely undisputed definition of “narrative” or “story” that would be affirmed by all literary scholars does not exist, there are plenty of good propositions for such a definition, or a list of minimal criteria, which at least find pragmatic acceptance in a given context. On the other hand, even if we avoid the more contentious issues raised by attempts to define stories (as, for instance, whether the represented events have to be past events in relation to the time of representation; or whether non-verbal modes of representation, like in films, can still be called “narrations”), this thing called “narrative” does not look as homogenous as 6

See Scalise Sugiyama 2001a; Scalise Sugiyama 2005, for the overarching hypothesis. The project as a whole comprises a series of studies on oral folklore, published since 2001.

34

Katja Mellmann

our gestalt notion of it suggests. Narratives may employ the first person as well as the third (or even the second), they may present events in the ordo naturalis or in an ordo artificialis, and the narrator may be part of the one and only storyworld or (as a “heterodiegetic narrator”) give rise to another (meta-)storyworld incongruent with the external world of the storyteller. Furthermore, even if the narrated events are located in a relative past, the narration may equally employ the present tense and thus shade into more dramatic “mimesis” (as opposed to diegesis). Similarly, there are uncountable gradations between “focalized” and “unfocalized” narrations (cf. Mellmann 2010a, p. 124), between “showing” and “telling” modes, scenic and reporting, or even reflexive, styles of narration. These manifold expressions of “narrative” should raise skepticism against a “hard-wired” cognitive program behind these phenomena. On the contrary, if narrative is taken to be the unstable cultural product of exploiting many diverse cognitive capacities, such a plurality of narrative forms is exactly what we would expect. On the other hand again, the fact that we still understand all of these formal and functional possibilities as encompassed by the notion of “narrative” could be used as evidence that there is in fact some common ground or basic substrate here. But there we are back at the initial problem: Is this perceived common ground a cultural conception that emerges similarly in all cultures simply because of the biological substrates involved in narration, or is it a symptom of “hard-wired” special design? My supposition is that the mere capacity for storytelling is sufficiently explained by preexisting cognitive abilities which have not specifically evolved for storytelling, but that our intuitive notion of “story” may indeed be revealing of a number of biological constraints operating on the first storytelling practices in an evolutionary past which have shaped the biological proto-type of narration that still influences our intuitive concept of “story.” As John Tooby and Leda Cosmides have convincingly argued, there is no immediate need to explain something about narrative structure, because we evolved not so long ago from organisms whose sole source of (non-innate) information was the individual’s own experience. Therefore, even now our richest systems for information extraction and learning are designed to operate on our own experience. It seems therefore inevitable, now that we can receive information through communication from others, that we should still process it more deeply when we receive it in a form that resembles individual experience, even though there is no extrinsic reason why communicated information needs to be formatted in such a way. That is, we extract more information from inputs structured in such a form. [...] People prefer to receive information in the form of stories. Textbooks, which are full of true information, but which typically lack a narrative structure, are almost never read for pleasure. We prefer accounts to have one or more persons from whose perspective we can vicariously experience the unfolding receipt of information, expressed in terms of temporally sequenced events (as experience actually comes to us), with an agent’s actions causing and caused by events (as we experience ourselves), in pursuit

Is Storytelling a Biological Adaptation?

35

of intelligible purposes. [...] stories are told in a way that mimics the format in which experienced events are mentally represented and stored in memory, in order to make them acceptable to the machinery the mind uses to extract meaning from experience. (Tooby and Cosmides 2001, p. 24)

From this perspective, the frequently described “narrativity” of our experience, memory, consciousness,7 and reasoning8 would sufficiently account for the narrative “format.” The way our brain (and that of other species capable of self-propelled movement) processes information simply shapes our mental representations and thus from the very outset also shapes every external representation system with which these mental representations are socially communicated. That is, the experiential format of our mental life already determined the very first manifestations of human language, thus shaping language and many of its properties itself. Thus, rather than speaking of “narrative thinking,” “narrative construction of experience,” a “narrative structure of empathy,” and the like, perhaps we should call narrative “mindlike speaking.” Conversely, language can be said to show kind of a natural tendency to issue into experiential (“narrative”) formats (cf. Donald 1991, p. 257), because it is based on the way we think, which in turn derives from the way selfpropelled organisms gather and process environmental information. So, is there something that remains, something we regard as crucial for our notion of storytelling but which is not already covered by this natural tendency to experiential formats in verbal representation? I have for some time been thinking about the third-person narration as something not immediately self-evident. The fact that we are able to recount not only our own experiences but also those of another person (real or fictitious) to me seems something worth noting at least. Indeed, the classical “story” in the sense of our (my?) gestalt notion of it would rather be “Once upon a time there was ...,” that is, a heterodiegetic third-person tale, than the homo- or even autodiegetic communication of someone’s own experience. But “third persons” are of course part and parcel of our regular ancestral environment, and if we can see others do something we should also be able to tell what we see. In other words, the grammatical option of “third person” is not less innately biased than, for instance, the option of a past tense resulting from our capacity to remember things. Yet still there is something remarkable about it: primates, and especially humans, are particularly attentive to others’ actions. The more complex the social structure in a species, the more important it is to observe and remember also other group members’ conduct and experiences (cf. Dautenhahn 2003) and to build complex mental representations of “society” (its hierarchical structure 7 8

Cf. the description of consciousness as a continuous “wordless storytelling” by Antonio R. Damasio (1999). Cf., for instance, Lloyd 1989, pp. 225–228, 233f.

36

Katja Mellmann

and causal dynamics, personal interrelations, distribution of knowledge and resources, etc.) in order to be able to act within these complex social settings (cf. Carrithers 1991; Barrett et al. 2001, p. 334; Hoeg 2009). Storytelling indeed seems to be quite essentially about third parties. Not only: “Let me tell you what happened to me yesterday,” but also: “Let me tell you what a third party and I did yesterday,” or even: “Let me tell you what I witnessed a third party doing;” now let’s drop the source tag “I witnessed,” and there we are with a classical third-person narrative. So even if the mere capability to think (and talk) using a “third person” concept is nothing that our storytelling species would have had to invent newly, it might be something at least of raised significance to our species, and thus hint at an important (perhaps even biologically anchored) motivation for telling stories. Others have pointed out that something unusual – some breach (cf. Bruner 1991/92, pp. 11–13; Herman 2002, pp. 91f.) or conflict (cf. Scalise Sugiyama 2005, pp. 185f.) – is what really makes a story a story. We call “story” not so much the meandering rendition of interchangeable happenings but rather the selective and incisive account of a “non-contingent” (Eibl 2004, p. 255) sequence of events worth our interest. However, the Aristotelian beginning-middle-ending structure, Yuri Lotman’s “sujet,” the archaic narrative models of quest, virtue’s triumph, and reunion of the lovers, Propp’s narrative “functions,”9 and so on, all rest on gestalt schemata which, as Karl Eibl has plausibly suggested, are not unique to storytelling but can be explained as preexisting mental schemata that evolved to guide the behavior of our ancestors (including nonhumans) in an adaptive manner (cf. Eibl 2008; Eibl 2004, pp. 267f.). So this is another characteristic of stories which seems sufficiently explained as a byproduct of other cognitive traits. But again I would say that our intuition of a story necessarily involving something unusual, or “bad gestalts” that require resolution, can inform us about important motives (or even innate triggers) for storytelling. Brian Boyd has proposed fiction as something that needs further explanation (cf. Boyd 2009, pp. 15, 186–208). The fact that we tell not only true but also (and perhaps even on a larger scale) purely invented stories is indeed something remarkable. And many other scholars have pointed out that it often is in the form of stories that humans think about the non-actual, design alternative worlds, make graspable the ungraspable, link actual experience with more general rules and principles, and so on. The problem is, however, that counter-factual (and hypothetical, etiological, parabolic, case-based, etc.10) thinking, too, is nothing unique to storytelling, but seems 9 Productively picked up recently by Kafalenos 2006. 10 Fiction can indeed be many different things. For the general problem of taking abstract concepts as a starting point for adaptationist analyses in Boyd’s study see my review (Mellmann 2010b).

Is Storytelling a Biological Adaptation?

37

to rise (as one among many other forms) from a more general capacity to think in “decoupled” modes (cf. Cosmides and Tooby 2000; Tooby and Cosmides 2001, pp. 19–22). But even if fiction is not, as Boyd proposed, a distinct adaptation, the observation that fictional storytelling is something of great relevance to our species might indicate that, if storytelling is in fact an adaptation, its biological function should not exclusively depend on historically true information. Scalise Sugiyama has particularly emphasized the stunningly high resolution of information rendered in a verbal mode in comparison to other modes of representation (cf. Scalise Sugiyama 2005, pp. 181–183; see also Pinker 2003). Surely this is true for any highly conventionalized (“arbitrary”) semiotic system, regardless of its particular medium (gestures, vocal sounds, pictograms), but in the case of humans it indeed was vocal language that in the long run established itself as the predominant and most efficient mode of communication.11 Thus, even if we already had non-verbal, directly “mimetic” ways of representing events in a storytelling-like manner before language, as H. Porter Abbott (2000) with reference to Donald (1991, pp. 162–200) has persuasively suggested, the acquisition of language might have been an important step in the emergence of human storytelling. As we have seen, narration might have merely been the linguistic expression of a great number of preexistent perceptive and cognitive mechanisms, some of them dating back far to our nonhuman ancestors. However, the idea that first there was a particular way of thinking, then we developed language (for whatever reason), and then we began to tell stories, would surely be inadequate. Language of course was not invented in one day but slowly elaborated in hundreds of thousands of minuscule steps of using vocal sounds for this or that particular purpose, that is, in countless steps of ritualization, grammaticalization,12 and developing an increasing level of arbitrariness which, by its “reifying” (cf. Eibl 2004, pp. 213–275) impact, in turn influenced the way we were thinking (cf. Eibl 2004; 2010).13 Also, to say that narration is only a particular use of language would be too easy, because by building on experience-related cognitive programs language probably showed kind of a “(proto-)narrative” quality from the very outset. Furthermore, like any other trait that has been genetically stabilized so that it now reliably develops in a species, our various cognitive and linguistic skills, too, when they develop in a human child, do so with the help of spe11 For a telling reconstruction of the emergence of human language (discussing also the hypothesis of sign language as a first and already very efficient form) see Eibl 2010. 12 For instance, the “syntax threshold” (cf. Pinker 2003, p. 32) hints at an external selection pressure (namely, an increased combinatorial structure of the environment) and thus also shows that thinking, language, and external needs to exchange particular kinds of information, are mutually dependent rather than evolving one after the other. 13 Cf. also Donald’s “third transition” (Donald 1991, pp. 269–360).

38

Katja Mellmann

cific developmental mechanisms (cf. Tooby and Cosmides 2001, pp. 14f.) – that is, with the help of “play.” I want to particularly stress that, because this is where the “art” of storytelling comes in. Verbal “art” (including “fiction”, but not only that) emerges continuously as a byproduct of specialized developmental mechanisms which drive us to execute our immature cognitive programs in a playful “organizational mode” (Tooby and Cosmides 2001, p. 16). Just like the little infant, exploring its organ of speech, produces a kind of “concrete poetry,” so the toddler, developing its capacity to represent others’ intentions and beliefs, tries out the boldest lies on its mates and caregivers; or, when developing a sense of probability, logical consistency etc., tries out the boldest inversions of these concepts; or, when developing specific innate mechanisms of fear (and other emotions), makes up the boldest stories of horror and catastrophes; and so on and so on.14 Adults not only interact with their children and thus often join in that playful nonsense, they also “play” for themselves or with other adults. Humans on a much larger scale than any other animal species capable of play keep on playing even after maturation. Executing our skills for linguistic representation in the organizational mode, feeding our emotional system, challenging our cognitive “scope syntax” (a mental tagging system for different sorts of applicability of information; cf. Cosmides and Tooby 2000; Tooby and Cosmides 2001, pp. 19–22), calibrating our perceptual apparatus with “super-normal” sounds, training and enhancing mental scripts, etc. – this all entails the continuous possibility of stories which are not plain reports of historically true events, but rather narratives exaggerated in some details; epic amplifications or abbreviations to the “gist” of it (e.g., stylized to convey a certain “moral of the story”); narratives embellished with puns, rhymes, structures of repetition; intensified by certain focalization strategies; of a higher or lower degree of causality than actual events normally show; and so on. So even in the most elaborated kinds of artful (“literary”) storytelling there is nothing that clearly exceeds the already present cognitive capacities (including their developmental mechanisms) and would thus require special explanation. Yet I have outlined a couple of features in storytelling that seem to be important somehow, and are perhaps informative for the question of special design. Our interest in others, our preference for the “unusual,” our unabated appetite even for inaccurate information, and the sophistication of event representation through language all point to pragmatic factors of storytelling – motivation, applicability, efficiency – which might be revealing of how we came to show such a peculiar behavior in the first 14 I think Boyd (Boyd 2009, pp. 177–187) makes too much of these qualities of children’s storytelling by taking them as a paradigm of specific “functions” of art and fiction (like rousing attention, or exploring the possible around the real).

Is Storytelling a Biological Adaptation?

39

place. If there is something like a narration “instinct,” these factors should play a functional role in it (and have thus produced the intuitive notion, or semantic proto-type, of “story” which I took as guidance here). So let us now turn to the question in what situations people most obviously show such a presumed narration instinct.

II. Narration Instinct(s)? The overwhelming extent to which people in Western societies talk about themselves, their lives, beliefs, hopes, and experiences could tempt us to assume a very general basic instinct of talking about oneself, constantly producing autobiographical narratives. However, as historians we know that the extensive souci de soi of individuals in modern Western societies is a very recent development and people in former times seem rather dull, in comparison, in this regard. Also, from the standpoint of evolutionary psychology we would rather expect a highly domain-specific than domain-general mechanism (or even several differently domain-specific mechanisms), that is, not a discretionary “talking of oneself ” but talking of specific events in specific kinds of situations. Volker Heeschen, for example, has described a strongly situationspecific kind of narration in Papuan societies: I heard an Eipo woman refer to her own exhaustion by alluding to smoke rising from a nearby mountain and speculating that it came from a fire kindled by a long-suffering woman from the Fa valley exhausted from her daily tasks. (Heeschen 2001a, p. 187)15

Heeschen sees at work here a general principle of speech in small societies which he calls indirection. Directly to address another person or revealing one’s own interests would seem offensive and indecent in those societies, and this is why many speech acts are transformed into songs and fairy tales in which the true circumstances are veiled as fictitious events and characters. I think this is a very deliberate use of narration which involves complex cognitive operations on a level way above instinctive behavior. Heeschen, too, emphasizes the cultural specificity and aesthetic sophistication of that manner of speaking and pins down as an obviously “instinctive” behavior only our urge to break silence (cf. Heeschen 2001a, pp. 180, 190f.)16 in an encounter. And this indeed is something we should keep in mind when searching for more 15 Full quotation of the woman’s utterance in Heeschen 2001b, pp. 145f. 16 This “phatic” function of language, in Roman Jacobson’s terms, corresponds nicely with Robin Dunbar’s idea about the beginning of language in using vocal sounds as an extension of grooming in primates (cf. Barrett et al. 2001, pp. 322–334), but Heeschen (2001a, pp. 185f.) emphasizes that the content of utterances is not completely irrelevant in this function. The instinct to break silence, according to Heeschen, is automatically a “narration instinct” in that it inclines us to “map the world” (pp. 181f.) and, by ritualization and play, also to tell stories and transpose reality into fiction (cf. Heeschen 2001b, pp. 161f.).

40

Katja Mellmann

fundamentally biological instances of narration. Is there something beneath such culturally learned ways of telling stories with quite conscious purposes? What is it that we more or less thoughtlessly talk about if we simply want to break silence with a conversational partner? Suppose that the silence is there for some reason and two people in a given situation do not have a lot to talk about; the cliché says that they will start talking about the weather. Clichés can sometimes be heuristically useful lenses into the evolutionary past. The weather conditions – and indeed not only the immediately present, but also bygone ones (which have had impact on our present condition and influence our future-directed cognition and behavior) – are a highly relevant kind of information in ancestral environments. To share the observations one has made, as well as one’s reflections on it, with another might be a good way of preparing collective actions17 (like building a shelter) which could not be accomplished by a single individual alone. Another heuristic lens on innate mechanisms is irrational behavior. Suppose you are on a holiday in a foreign country and meet a compatriot with whom you are talking for a while, and the moment you mention your hometown (a city of, say, 200,000 people) he asks if you “by any chance” know Mr So-and-so. And maybe it is not even of great relevance to him whether you know that person, but he “just simply thought that he would ask.” And suppose further, you do not know that Mr So-and-so but another person of the same name from a different city, and you tell your compatriot a funny story about this person and he listens to you quite readily. Things like that occur, and I think this could be indicative of an instinctive disposition to talk (proto-narrate) about social relations and what they entail. According to Dunbar and colleagues, around two thirds of our relaxed conversation time is indeed devoted to social topics and, of this time, one third to information about third parties (cf. Dunbar et al. 1997).18 Those numbers are of course very provisional as long as we do not have extensive cross-cultural19 studies and, moreover, situation-specific studies that determine the situational circumstances that cause us to gossip about certain topics and avoid others. More fine-grained categories of topics will then have to be developed in order to decide what specific selection pressures (e.g., the so-called free rider problem; cf. Dunbar 2004, pp. 106–108; Scalise Sugiyama 2008)20 might 17 Cf. Carrithers 1991, p. 313, on “making society.” 18 See also Mesoudi et al. 2006, showing that social gossip material (defined as intensely involving third-party information) is recalled to a larger extent and more accurately than non-social gossip materials. 19 Studies on conversation topics among Zinacantan Indians in southern Mexico show similar results (cf. Dunbar et al. 1997, pp. 241f.). 20 See also, explicitly from a nonadaptionist / byproduct standpoint, Flesch 2007. Interestingly, Dunbar found that “only about 3–4 % of conversation time centers around ‘malicious’ (or

Is Storytelling a Biological Adaptation?

41

have shaped these assumed “gossip instincts.” And, as to the literary question of storytelling, we also require more fine-grained categories of form in order to examine to what extent in gossip we really use more strictly narrative formats and to what extent maybe even more stylized, story-like forms of narration.21 And we would need to investigate the extent to which those stories perhaps exceed the circle of really existing social networks and migrate into more general or even explicitly fictional social settings. Another innately biased incentive for narration might be the finding of food resources (at least if they are rich enough to feed more than only the discoverers). We know analogue phenomena from the animal kingdom: chickens, for instance, emit characteristic “food calls” upon discovering an edible object in order to inform their conspecifics (cf. Evans and Evans 1999); monkeys show a quite elaborate, socially strategic food call behavior (cf. Chapman and Lefebvre 1990); and if the waggle dance in bees is what we take it to be (this seems to be controversial at the moment), then there even is an analogue of specifically “narrative” food calls. Interestingly, Walter Burkert explains the literary theme of quest / adventurous journey as basically the verbalization of a biological program for foraging activities in humans and other animals (cf. Burkert 1998, pp. 81–85; see also Scalise Sugiyama 2001b; Scalise Sugiyama and Sugiyama 2009). If we furthermore posit a special psychic mechanism that prompts us to communicate our foraging experience upon homecoming, that is, to produce narrations of a certain kind, then those kinds of narratives would be among the many protoforms of literature, and Burkert’s derivation would prove valid even above the “byproduct” level. The original instinct for food calls might be largely masked in industrialized societies, in which food is abundantly available. But think of “good bargain” stories people tell one another after their weekend shopping tours, and the like. Another type of experience which is almost inevitably told about might be dangerous situations. Suppose you have nearly had a car accident or there was an attempted break-in at your place. It is unlikely that you will not tell your friends and colleagues about it the next day, even if you are all right after all and nothing has happened to you or your belongings. Of course, this should be sufficiently explained by a certain shock and excitement negative) gossip in the colloquial sense” (Dunbar et al. 1997, p. 242; see also Barrett et al. 2001, pp. 336–338) and that negative gossip is not transmitted significantly more extensively or accurately than other social topics (cf. Mesoudi et al. 2006). Perhaps negative gossip is a matter rather of impersonalized (hypothetical, invented, etc.) stories – for example, of the “Well, this is how it goes ...” kind as found in many fairy tales – than of real accounts. And perhaps this is due to the need for indirection in certain circumstances which Heeschen (2001a; 2001b) has observed. 21 Further investigations in this regard might benefit from linguistic descriptive models of narrativity as developed by and since William Labov and Joshua Waletzky; cf. the stock-taking volume by Michael G. W. Bamberg (1997).

42

Katja Mellmann

which is reason enough to tell about the unsettling experience. In light of Scalise Sugiyama’s findings about the depiction of natural predators in oral folklore (cf. Scalise Sugiyama 2004; Scalise Sugiyama 2006), however, I believe that there is more to it than just stress-induced talkativeness. Take as an example the ritualized “How are you?” in the English-speaking world (and equivalents in many other languages), or the vast extent to which we exchange stories of illness, frequently about third parties which are not, or only remotely, known to the interlocutor. It might well be a fitness-enhancing strategy to make everybody around aware of possible dangers and their specific properties, even independently of the actual presence of these dangers. Moreover, if we take into account the fact that, in ancestral environments, it is of immediate significance to survival (and thus genetic reproduction) that already the little child quickly learns to recognize and efficiently avoid predators and other dangers, it seems likely that the instinct to tell stories about dangerous situations is originally rooted in our behavior towards children. Curiously, we enjoy telling “scary stories” to little children – much like we enjoy rough-and-tumble play with them, making them dizzy, or just saying “Bouh!” Similarly, ghost stories at the bonfire and a midnight hike are must-dos at every children’s summer camp. Why? Given that we normally do not mean to torture our children, there must be another – unconscious, but all the more effective – reason why we do such peculiar things. In view of prevailing motifs in oral folklore, we surely have to add another important topic to our list: namely, etiological explanations like those typically present in many mythological tales. I think etiological myths, too, could be the remote cultural product of a specifically evolved behavioral inclination to produce narratives. Suppose I notice my colleague having a surprised look at a new object on my desk. I will spontaneously start to recount to him the little story of how I found it yesterday and why I kept it and brought it here, etc. The explanation of the “unknown” might be a particularly productive incentive of storytelling – especially in the sense of fiction, because we can hardly tell “historically true” stories about what we do not know; and in the sense of stories about the “unusual,” because the “usual” is what we already know. To not only form one’s own silent stories about novel and strange facts (which would not exceed our general capacities for causal reasoning, “teleological” reflection on utility, and the like) but also to share one’s own theories with others enhances our general knowledge about the actual environment and thus prepares the ground for what Michael Tomasello (1999) has called the “ratchet effect” of human culture. My supposition is that we are continuously producing stocks of (presently perhaps fairly irrelevant) information by exchanging kinds of information that seem worth preserving only for the reason that they are not available other than by social communication (i.e., information about something basically “un-

Is Storytelling a Biological Adaptation?

43

known”) and would hence be lost once we stop exchanging it. This behavior indeed seems adaptive in that it provides kinds of information which are especially well-suited to cooperate with specifically human forms of intelligence and behavior (cf. Tooby and DeVore 1987). If we share, for example, our experiences with new sorts of fruit, natural materials, topological formations, the changing of the seasons, and so on, we accumulate practical knowledge about those things and thus enhance our behavioral flexibility in new situations. As Jerry Hoeg with reference to Roy Rappaport has pointed out, it is not necessary that those cultural narratives rest on “scientifically true” explanations, as long as they allow for a coexistence of the culture with its environment (cf. Hoeg 2009, pp. 3–7). In that way, the story that one of my ancestors has lost his weapon in the mountains and this is why the mountain provides me with especially appropriate stones for arrowheads22 is not worse than a scientific mineralogical analysis. And – seen from the “engineering” standpoint of evolution – what would be a better guarantee of such coexistence than forming our theories on the basis of stories about antecedent experiences, and on the basis of continuously socially comparing23 them? The resulting capacity for understanding the given in relation to a wider, or even “metaphysical” context is what is often emphatically understood as something uniquely human. I would not preclude, however, that many other animals, too, have their explanatory little mental stories. To socially share them in an extended and ritualized manner and, with language, even to build a quite persistent legacy of those stories (how the earth was made, how we came into it, why it is that we must give birth in pain, etc.) is what is indeed characteristic of humans, but I doubt whether we have reasons to call the whole thing a biological adaptation. Note that what I propose as a distinct adaptation of the human species here is merely the basic instinct to “break out into words (proto-narratives)” as soon as we believe to know more about something strange than a given interlocutor. And this is something I want to emphasize for all the “narration instincts” I have hypothesized here. They all obviously rest upon preexisting mental adaptations, some of which might anchor deeply in our non-human past (like surely in the case of food calls). The mere fact that these adaptations are still influencing the stories we tell today (or might have told when we were hunters and gatherers) proves nothing. This could be explained as simply a byproduct of those adaptations in combination with our language faculty. What I have tried to suggest instead is the existence of a middle 22 For a real example see, e.g., Heeschen 2001b, pp. 158–160, on a Papuan girl’s fairy tale about new objects brought by white people. 23 Cf. Bruner 1991/92 on “narrative discourse [...] as a viable instrument for cultural negotiation. You tell your version, I tell mine [...]” (p. 17) and on “narrative accrual” (pp. 18–20).

44

Katja Mellmann

layer of adaptations between those preexistent cognitive mechanisms and their verbal expressions: a layer of adaptations that specifically incline us to produce verbal communications on some specific kinds of information, the social sharing of which would have been adaptive for specific reasons. To assume special adaptations for verbal communication, naturally, is also to assume adaptations that depend on, or co-emerge with, language, and this leads me to my last hypothesis. If Dunbar’s statistics are right and the exchange of social information is in fact that predominant in our verbal behavior, then he might also be right in assuming that the exchange of social knowledge (“gossip”) was the first crucial motor in developing and elaborating human language to the complex semiotic system that we know today. And then the other narration instincts I have outlined here might be kind of epiphenomena in that process, which started as incidental uses of this newly emerging semiotic system but then were genetically stabilized as distinct adaptations because of the high efficiency with which language also served to reply to a number of other specific selection pressures (like coordinating collective preparations of shelter, finding new food resources, enhancing the survival fitness of the offspring, spreading new information). My list of one primary and four secondary narration instincts certainly is neither exhaustive nor infallible. Some of these instincts may be sorted out (or at least reformulated) by future research and different ones might be added. My aim in beginning such a list was not so much to provide another essay on the subject of “Storytelling as Adaptation” but rather to exemplify what we are really talking about if we want to consider storytelling to be a biological adaptation: we are talking about hard-wired instincts of the human animal! It seems important to me to carefully distinguish such biologically shaped features of the human mind from the manifold cultural uses of language and narration, if evolutionary explanations shall seriously contribute to literary theory.

III. Conclusion Since the narrative “format” is sufficiently explained by the basic working principles of the human brain and their combinations with various cognitive abilities (such as mental scripts and linguistic skills), I would not agree with the opinion “that narrative appears to meet the criteria of special design” (Scalise Sugiyama 2005, p. 191), if this is to assume a distinctly evolved cognitive program specifically designed to produce such forms of speech. However, I proposed that our commonsensical (albeit vague and shifting) gestalt notion of “story” could be the blended result of a number of adaptations that prompt us to talk (proto-narrate) about specific topics in specific situations. In that way, the proto-typicality of third-person narration may be due to the

Is Storytelling a Biological Adaptation?

45

importance of reporting social occurrences to those group members who have not witnessed them themselves but whose ability to act within their social world, too, depends on having as comprehensive and elaborate a mental model of this social world as possible. Second, the intuition that a “good story” should involve something unusual or problematic could derive from the selection pressures that shaped the presumed innate topics: weather conditions that demand collective efforts of shelter; potentially life-threatening dangers, like predators; short-term available food resources; social conflicts; novelty and strangeness. Third, the odd fact that “untrue” stories are at least as prototypical as “true” stories might arise from the functional equivalence of actual social occurrences with encrypted,24 generalized, hypothetical, parabolic, etc., renderings of social issues; from fashioning “super-normal” fear stimuli to accelerate the ontogenetic development of especially survival-enhancing mechanisms; as well as from the often speculative quality of explaining the unknown. However, since our intuitive notion of stories could also result from certain cultural uses of narration, the fact that we have such a notion is not sufficient evidence that storytelling is a biological adaptation. Therefore, I have suggested the examination of the proximate mechanism25 as a more appropriate method of proving (or refuting) this hypothesis. As a first approach, I have outlined several possible “narration instincts” which, by their “instinctive” nature, should be distinguishable from other, “merely cultural” narrative activities. Seen in this light, Scalise Sugiyama’s proposition “that narrative is an information storage and transmission system” (Scalise Sugiyama 2005, p. 190) which emerged with our occupation of the “cognitive niche”26 still holds valid but also seems a slightly over-generalized formula, because it does not explicitly differentiate between such instinctively biased narrations on the one hand and narration as a flexible cultural activity on the other. Our species’ adaptation to the “cognitive niche” is the beginning of an immensely increased flexibility of human cognition and behavior (including language27) and, at the same time, of an increasing dependence on “culture.” And culture (in the sense of a mental “interface” or “in-between world” that mediates between our evolved nervous system and the environment (cf. Eibl

24 Because of a need for “indirection” in small-scale societies, e.g.; cf. Heeschen 2001a and 2001b. 25 Cf. the five core components of any adaptationist analysis as listed by Tooby and Cosmides 1992, pp. 73f. 26 This useful metaphor for the particular “ecological niche” to which the human species is specifically adapted and which explains that species’ most significant traits was coined by Tooby and DeVore 1987. 27 Cf. Pinker 2003 on language as an adaptation to the “cognitive niche.”

46

Katja Mellmann

2009) surely is, to a large extent,28 organized by “narratives.” Thus, to say that narrative is an adaptation (note that Scalise Sugiyama remains cautious here) would not be more wrong or right than saying that culture is an adaptation, but it would also be as little informative as the latter unless we begin to specify particular behavioral programs. And finally, if the assumption that narrative is an adaptation shall be more than the assumption that language is an adaptation, then we should also be able to demonstrate how those behavioral programs have specifically shaped the proto-typical form of utterance called narrative. As things stand, I think that most of what we call narratives is classified best as cultural exploitations of preexistent traits of the human mind. Even stories on topics of obvious cross-cultural prevalence and evident biological significance (like, for instance, the topic of love and reproduction) should be seen as byproducts of a number of biological substrates as long as we cannot, first, indicate the fitness-enhancing value of socially communicating those kinds of information and, second, verify the cross-culturally reliable performance of the proximate mechanism. In this chapter, I have hypothesized a number of “narration instincts” for which I consider it possible to gain such evidence. The question whether I am right, however, cannot be answered theoretically but only empirically. To decide whether we really have such instincts as I have inferred from a rather intuitive observation of human behavior, needs well-directed testing for each of them individually. But I think my theoretical considerations can help to develop suitable experimental designs by specifying our questions. For instance: Do people really produce significantly more stories about how they bought a lawn mower for only half the price than about mowing the lawn the same afternoon? If not, the hypothesis of a “food call narration instinct” as stated here fails. Do people really include scary motifs on a larger scale than other motifs in stories they tell children? Or: Do people, more often than not, conversationally exchange newly acquired knowledge (like for instance newspaper science news) without particular relevance to their occupation or being personally interested in the topic? – Those questions may sound bizarre to literary scholars, but they are not at all absurd if taken in the sense of risky hypotheses to test our theory.

28 Notably, not all cultural narratives are prototypical “stories” in the sense introduced here. As Heeschen 2001b observes, for example, myths often tend to an “enumerative structure dispensing with the logics of event structure” (p. 154) and thus exploit the full potential of the “objectifying” (cf. Eibl 2004, pp. 213–275) quality of human language. Cf. also Mellmann 2010a on the large continuum between strongly experiential formats on the one hand and what could be called “textbook” versions of narration on the other.

Is Storytelling a Biological Adaptation?

47

References Abbott, H. Porter, “The Evolutionary Origins of the Storied Mind. Modeling the Prehistory of Narrative Consciousness and Its Discontents,” in: Narrative 8.3 (2000), pp. 247–256. Bamberg, Michael G. W. (ed.), Oral Versions of Personal Experience: Three Decades of Narrative Analysis, Hillsdale, NJ: Erlbaum, 1997 (= Journal of Narrative and Life History 7.1–4). Barrett, Louise / Robin Dunbar / John Lycett, Human Evolutionary Psychology, London: Palgrave Macmillan, 2001. Bischof, Norbert, Das Kraftfeld der Mythen: Signale aus der Zeit, in der wir die Welt erschaffen haben, Munich: Piper, 1998. Booker, Christopher, The Seven Basic Plots: Why We Tell Stories, London, New York: Continuum, 2004. Boyd, Brian, On the Origins of Stories: Evolution, Cognition, and Fiction, Cambridge, London: Belknap, 2009. Bruner, Jerome, “The Narrative Construction of Reality,” in: Critical Inquiry 18.1 (1991/ 92), pp. 1–21. Burkert, Walter, Kulte des Altertums: Biologische Grundlagen der Religion, Munich: C. H. Beck, 1998. Carrithers, Michael, “Narrativity. Mindreading and Making Societies,” in: Natural Theories of Mind: Evolution, Development and Simulation of Everyday Mindreading, ed. by Andrew Whiten, Oxford: Blackwell, 1991, pp. 305–317. Chapman, Colin A. / Louis Lefebvre, “Manipulating Foraging Group Size: Spider Monkey Food Calls at Fruiting Trees,” in: Animal Behaviour 39 (1990), pp. 891–896. Cosmides, Leda / John Tooby, “Consider the Source: The Evolution of Adaptations for Decoupling and Metarepresentation,” in: Metarepresentations: A Multidisciplinary Perspective, ed. by Dan Sperber, Oxford: Oxford UP, 2000, pp. 53–115. Damasio, Antonio R., The Feeling of What Happens: Body and Emotion in the Making of Consciousness, New York: Harcourt Brace, 1999. Dautenhahn, Kerstin, “Stories of Lemurs and Robots: The Social Origin of Story-Telling,” in: Narrative Intelligence, ed. by Michael Mateas and Phoebe Sengers, Amsterdam, Philadelphia: John Benjamins, 2003, pp. 63–90. Donald, Merlin, Origins of the Modern Mind: Three Stages in the Evolution of Culture and Cognition, Cambridge, MA, London: Harvard UP, 1991. Dunbar, Robin, “Gossip in Evolutionary Perspective,” Review of General Psychology 8.2 (2004), pp. 100–110. Dunbar, Robin / N. D. C. Duncan / Anna Marriott, “Human Conversational Behaviour,” in: Human Nature 8.3 (1997), pp. 231–246. Eibl, Karl, Animal poeta: Bausteine der biologischen Kultur- und Literaturtheorie, Paderborn: Mentis, 2004. –, “Epische Triaden,” in: Journal of Literary Theory 2.2 (2008), pp. 197–208. –, Kultur als Zwischenwelt: Eine evolutionsbiologische Perspektive, Frankfurt/M.: Suhrkamp, 2009. –, “Sprache macht Kultur,” in: Evolution und das heutige Bild vom Menschen, ed. by Jochen Oehler, Heidelberg: Springer, 2010, pp. 109–126.

48

Katja Mellmann

Evans, Christopher S. / Linda Evans, “Chicken Food Calls Are Functionally Referential,” in: Animal Behaviour 58 (1999), pp. 307–319. Flesch, William, Comeuppance: Costly Signaling, Altruistic Punishment, and Other Biological Components of Fiction, Cambridge, MA, London: Harvard UP, 2007. Foster, Eric K., “Research on Gossip: Taxonomy, Methods, and Future Directions,” in: Review of General Psychology 8.2 (2004), pp. 78–99. Hauser, Marc D. / W. Tecumseh Fitch, “What are the Uniquely Human Components of the Language Faculty?” in: Language Evolution: States of the Art, ed. by Morten H. Christiansen and Simon Kirby, New York: Oxford UP, 2003, pp. 158–181. Heeschen, Volker, “The Narration ‘Instinct’: Signalling Behaviour, Communication, and the Selective Value of Storytelling,” in: New Essays on the Origin of Language, ed. by Jürgen Trabant and Sean Ward, Berlin, New York: de Gruyter, 2001, pp. 179–196 (= 2001a). –, “The Narration ‘Instinct’: Everyday Talk and Aesthetic Forms of Communication (in Communities of the New Guinea Mountains),” in: Verbal Art Across Cultures: The Aesthetics and Proto-Aesthetics of Communication, ed. by Hubert Knoblauch and Helga Kotthoff, Tübingen: Narr, 2001, pp. 137–165 (= 2001b). Herman, David, Story Logic: Problems and Possibilities of Narrative, Lincoln, London: University of Nebraska Press, 2002. Hoeg, Jerry, “Why Did Narrative Evolve? (Human) Nature and Narrative,” in: Studies in the Literary Imagination 42.2 (2009), pp.1–13. Hogan, Patrick, The Mind and Its Stories: Narrative Universals and Human Evolution, Cambridge, New York: Cambridge UP, 2003. Kafalenos, Emma, Narrative Causalities, Columbus: Ohio State UP, 2006. Keen, Suzanne, Empathy and the Novel, Oxford: Oxford UP, 2007. László, János, “Epidemiology of Representations, Social Representations and Narratives,” in: Journal of Cultural and Evolutionary Psychology 1.3&4 (2003), pp. 191–204. Lloyd, Dan Edward, Simple Minds, Cambridge, MA: MIT Press, 1989. Mar, Raymond A. / Keith Oatley / Jacob Hirsh / Jennifer dela Paz / Jordan B. Peterson, “Bookworms versus Nerds: Exposure to Fiction versus Non-fiction, Divergent Associations with Social Ability, and the Simulation of Fictional Social Worlds,” in: Journal of Research in Personality 40.5 (2006), pp. 694–712. Mar, Raymond A. / Jennifer L. Tackett / Chris Moore, “Exposure to Media and Theory-of-mind Development in Preschoolers,” in: Cognitive Development 25.1 (2009), pp. 69–78. Mellmann, Katja, “Voice and Perception: An Evolutionary Approach to the Basic Functions of Narrative,” in: Toward a Cognitive Theory of Narrative Acts, ed. by Frederick Luis Aldama, Austin: University of Texas Press, 2010, pp. 119–140 (= 2010a). –, “The Multifunctionality of Idle Afternoons: Art and Fiction in Boyd’s Vision of Evolution,” in: JLTonline, 9 March 2010: http://www.jltonline.de/index.php/reviews/article/view/170/528 (= 2010b). Mesoudi, Alex / Andrew Whiten / Robin Dunbar, “A Bias for Social Information in Human Cultural Transmission,” in: British Journal of Psychology 97.3 (2006), pp. 405– 423.

Is Storytelling a Biological Adaptation?

49

Oatley, Keith / Raymond A. Mar, “Evolutionary Pre-adaptation and the Idea of Character in Fiction,” in: Journal of Cultural and Evolutionary Psychology 3.2 (2005), pp. 179– 194. Pinker, Steven, “Language as an Adaptation to the Cognitive Niche,” in: Language Evolution: States of the Art, ed. by Morten H. Christiansen and Simon Kirby, New York: Oxford UP, 2003, pp. 16–37. Scalise Sugiyama, Michelle, “On the Origins of Narrative: Storyteller Bias as a FitnessEnhancing Strategy,” in: Human Nature 7.4 (1996), pp. 403–425. –, “Narrative Theory and Function: Why Evolution Matters,” in: Philosophy and Literature 25.2 (2001), pp. 233–250 (= 2001a). –, “Food, Foragers, and Folklore: The Role of Narrative in Human Subsistence,” in: Evolution and Human Behavior 22.4 (2001), pp. 221–240 (= 2001b). –, “Predation, Narration, and Adaptation: Little Red Riding Hood Revisited,” in: Interdisciplinary Literary Studies 5.2 (2004), pp. 108–127. –, “Reverse-Engineering Narrative: Evidence of Special Design,” in: The Literary Animal: Evolution and the Nature of Narrative, ed. by Jonathan Gottschall and David Sloan Wilson, Evanston, IL: Northwestern UP, 2005, pp. 177–196. –, “Lions and Tigers and Bears: Predators as a Folklore Universal,” in: Heuristiken der Literaturwissenschaft: Disziplinexterne Perspektiven auf Literatur, ed. by Uta Klein, Katja Mellmann and Steffanie Metzger, Paderborn: Mentis, 2006, pp. 319–331. –, “Narrative as Social Mapping. Case Study: The Trickster Genre and the Free Rider Problem,” in: Ometeca 12 (2008), pp. 24–42. Scalise Sugiyama, Michelle / Lawrence Sugiyama, “A Frugal (Re)Past: Use of Oral Tradition to Buffer Foraging Risk,” in: Studies in the Literary Imagination 42.3 (2009), pp. 15–41. Schwender, Clemens, Medien und Emotionen: Evolutionspsychologische Bausteine einer Medientheorie, Wiesbaden: Deutscher Universitäts-Verlag, 22006. Tomasello, Michael, The Cultural Origins of Human Cognition, Cambridge, MA, London: Harvard UP, 1999. Tooby, John / Irven DeVore, “The Reconstruction of Hominid Behavioral Evolution through Strategic Modeling,” in: The Evolution of Human Behavior: Primate Models, ed. by Warren G. Kinzey, Albany: State University of New York Press, 1987, pp. 183– 237. Tooby, John / Leda Cosmides, “The Psychological Foundations of Culture,” in: The Adapted Mind. Evolutionary Psychology and the Generation of Culture, ed. by Jerome H. Barkow, L. Cosmides and J. Tooby, New York, Oxford: Oxford UP, 1992, pp. 19–136. –, “Does Beauty Build Adapted Minds? Toward an Evolutionary Theory of Aesthetics, Fiction and the Arts,” in: SubStance: A Review of Theory and Literary Criticism 30.1&2 (2001), pp. 6–27. Tsiknaki, Eirini, Literatur und Persönlichkeitsentwicklung: Eine empirische Untersuchung zur Erfassung des Zusammenhangs zwischen literarischem Lesen und Emotionaler Intelligenz, Munich: Meidenbauer, 2005.

50

The Adaptive Function of the Arts Alternative Evolutionary Hypotheses Joseph Carroll

I. Massive Modularity vs. Cognitive Flexibility Evolutionists insist that genes constrain and direct human behavior. Cultural constructivists counter that culture, embodied in the arts, shapes human experience. Both these claims are true, but some evolutionists and some cultural constructivists have mistakenly regarded them as mutually exclusive (cf. Wilson 2007, pp. 20–37). Some evolutionists have either ignored the arts or tried to explain them away as epiphenomenal to the basic processes of life. Many cultural constructivists, in contrast, have sought to collapse biology into culture, eliminating “human nature” and thus turning culture into a first cause or unmoved mover. In the past few years, evolutionists in both the sciences and the humanities have broken through this impasse, arguing that the imagination is a functional part of the adapted mind. These new ideas revise an earlier model of human cognitive evolution – a model most closely associated with the earliest phase of “evolutionary psychology” (EP) as a specific school within the evolutionary human sciences. Revising that model makes it possible for us now to fully integrate the evolutionary human sciences and the study of the arts. In the early phases of EP, theorists seeking to counter the concept of the mind as a “blank slate” committed themselves to the idea of “massive modularity,” the idea that the mind operates almost exclusively through dedicated bits of neural machinery adapted to solve specific practical problems in ancestral environments (I shall refer to this conception of the mind as “narrow-school EP”). Cognitive modules – the neural machinery dedicated to sight, for example – are characterized by automaticity and efficiency. To account for cognitive flexibility in this scheme, one could only “bundle larger numbers of specialized mechanisms together so that in aggregate, rather than individually, they address a larger range of problems.” (Tooby and Cosmides 1992, p. 113). The idea of massive modularity overgeneralizes from the most hard-wired components of the brain, and it has been effectively criticized from a broader evolutionary perspective (cf. Geary 2005; MacDonald 1990; Sterelny 2003). Its residual influence makes

The Adaptive Function of the Arts

51

itself felt, though, in the ongoing debate over the adaptive function of the arts (cf. Boyd 2005; Carroll 2008a, pp. 119–128; Carroll 2008b, pp. 349– 354; Dissanayake 2007). The massively modular model of the human mind is integrally connected to the idea of an ecologically stable, homogeneous environment. Modules emerge only against strong regularities persisting over time – regularities like those in the physics of light and three-dimensional space to which the human eye has adapted: The structure of the environment causes corresponding adaptive organization to accumulate in the design of the organism. … For example, the design of eyes reflects the properties of light, objects, and surfaces; the design of milk reflects the dietary requirements of infants (and what was dietarily available to mothers); the design of claws reflects things such as the properties of prey animals, the strength of predator limbs, and the task of capture and dismemberment. This functional organization in the organism – its set of adaptations – is designed to exploit the enduring properties of the environment in which it evolved (termed its environment of evolutionary adaptedness, or EEA) and to solve the recurring problems posed by that environment. (Tooby and Cosmides 1992, p. 69)

By committing itself to massive modularity, narrow-school EP thus also, necessarily, committed itself to the view that modern humans still possess a stone-age mind. “In relating the design of mechanisms of the mind to the task demands posed by the world, ‘the world’ means the Pleistocene world of hunter-gatherers.” (Cosmides et al. 1992, p. 5). The Pleistocene was a period of exceptionally severe ecological instability (cf. Potts 1996; Wade 2006). In the narrow-school EP conception of human cognitive evolution, that instability was not itself an adaptively relevant feature of the Pleistocene environment. “It is only those conditions that recur, statistically, accumulating across many generations that lead to the construction of complex adaptations.” (Tooby and Cosmides 1992, p. 69). There is no allowance for an evolutionary trajectory in which the human mind acquires cognitive adaptations specifically designed for responding with flexible inventiveness to ecological instability (cf. Potts 1996; Sterelny 2003, pp. 177–210). From the theoretical perspective adopted in “The Psychological Foundations of Culture,” cognitive flexibility can emerge only from the accumulation of automatic neural processes or “modules,” and each of those modules can arise only as the product of environmental features so constant that they can be relied on as absolutely as the rising and setting of the sun – the basis for the evolution of the eye. In How the Mind Works, Steven Pinker locates the arts within a narrowschool EP conception of human cognitive evolution (cf. Pinker 1997, pp. 524–543). As he sees it, natural selection shaped human motives to maximize inclusive fitness within a hunter-gatherer ecology. Sociality and language were part of the human adaptive repertory. Imaginative culture was not. Creative imagination, whenever it appeared in human evolution,

52

Joseph Carroll

was just added on as a by-product of the cognitive / behavioral mechanisms that solved practical problems. To illustrate the by-product idea, Pinker draws parallels between art and pornography, psychoactive drugs, and rich foods like cheesecake. He acknowledges that fictional narratives might have informational content of some utility in providing game-plans for practical problems that could arise. All the other features of the arts, he suggests, reflect only the human capacity to exploit evolved mechanisms for producing pleasure. This sort of pleasure, detached from all practical value with respect to survival and reproduction, would be equivalent to the pleasure derived from masturbation. Edward O. Wilson offers a vision of human cognitive evolution very different from that exemplified in Pinker’s view of the arts. In Consilience: The Unity of Knowledge, Wilson poses the same question posed by Pinker: If the arts are steered by inborn rules of mental development, they are end products not just of conventional history but also of genetic evolution. The question remains: Were the genetic guides mere byproducts – epiphenomena – of that evolution, or were they adaptations that directly improved survival and reproduction? And if adaptations, what exactly were the advantages conferred? (Wilson 1998, p. 224)

Wilson’s answer to this question draws a decisive line between the mental powers of humans and other animals. Other animals are “instinct-driven.” Humans are not. “The most distinctive qualities of the human species are extremely high intelligence, language, culture, and reliance on long-term contracts.” The adaptive value of high intelligence is that it provides the means for behavioral flexibility – for generating plans based on mental representations of complex relationships, engaging in collective enterprises requiring shared mental representations, and thus producing novel solutions to adaptive problems. Behavioral flexibility has made of the human species the most successful alpha predator of all time, but achieving dominance in this way has come with a cost. Wilson speaks of the “psychological exile” of the species. To the modern human mind, alone among all minds in the animal kingdom, the world does not present itself as a series of rigidly defined stimuli releasing a narrow repertory of stereotyped behaviors. It presents itself as a vast and potentially perplexing array of percepts, inferences, causal relations, contingent possibilities, analogies, contrasts, and hierarchical conceptual structures. The human mind is free to organize the elements of cognition in an infinitely diverse array of combinatorial possibilities. And most of those potential forms of organization, like most major mutations, would be fatal. Freedom is the key to human success, and it is also an invitation to disaster. This is the insight that governs Wilson’s explanation for the adaptive function of the arts. “There was not enough time for human heredity to cope with the vastness of new contingent possibilities revealed by high intelligence. … The arts filled the gap.” (Wilson 1998, pp. 224f.). If instincts are defined as stereotyped programs of behavior released automatically by environmental stimuli, we can

The Adaptive Function of the Arts

53

say that in humans the arts partially take the place of instinct. Along with religion, ideology, and other emotionally charged belief systems, the arts form an imaginative interface between complex mental structures, genetically transmitted behavioral dispositions, and behavior. The arts provide images of the world and of human behavior that are not merely conceptual but affectively valenced. Humans do not operate automatically, but neither do they operate on the basis of purely rational deliberations about means and ends. They are motivated by emotions (cf. Damasio 1994), but they also regulate their behavior in accordance with beliefs and values that are made vividly present to them in the depictions of art, including fictional narratives. People inhabit worlds created in their imagination. The images of art feed into the imagination and thus help people to direct their behavior. High human intelligence is part of a larger, systemic structure of species-typical adaptations that can be analyzed under the rubric of “human life-history theory,” that is, the analysis of the distribution of effort across the human life cycle (cf. Flinn et al. 2005, pp. 10–46; Kaplan et al. 2000, pp. 156–185). Human life history includes altricial birth, extended childhood, male-female bonding coupled with male coalitions, dual parenting, post-menopausal survival, longevity, the development of skills for the extraction of high-quality resources, an enlarged neocortex that enhances powers for suppressing impulses and engaging in long-term planning, symbolic capacities enabling identification with extended social groups (“tribal instincts”), egalitarian dispositions operating in tension with conserved dispositions for individual dominance, and the power to subordinate, in some degree, impulses of survival and reproduction to the formal dictates of imagined virtual worlds (cf. Baumeister 2005; Boehm 1999; Geary 2005; Hawkins and Blakeslee 2004; Richerson and Boyd 2005; Wilson 2007). The narrow-school EP conception of the mind supposes a sequence in which automatic cognitive processes evolved to solve adaptive problems specific to Pleistocene ecology, with the arts tacked on as side effects. The alternative vision formulated by Wilson supposes that human cognitive capacities evolved specifically for the purposes of generating adaptive flexibility.1 In that alternative evolutionary scenario, dispositions to produce and consume works of imagination co-evolved in functional interdependence with high intelligence. The affective neuroscientists Jules and Jaak Panksepp

1

Also see Joseph Carroll, “The Human Revolution and the Adaptive Function of Literature,” in: Philosophy and Literature 30 (2006), pp. 33–49; Robert Foley, “The Adaptive Legacy of Human Evolution: A Search for the Environment of Evolutionary Adaptedness,” in: Evolutionary Anthropology 4 (2005), pp. 194–203; William Irons, “Adaptively Relevant Environments versus the Environment of Evolutionary Adaptedness,” in: Evolutionary Anthropology 6 (1998), pp. 194–204; Steven Mithen, The Prehistory of the Mind: The Cognitive Origins of Art, Religion, and Science, London: Thames and Hudson, 1996; cf. also Potts 1996; Sterelny 2003; Wade 2006.

54

Joseph Carroll

vividly evoke this vision of an integrated, systemic evolution of human cognitive powers: What those vast cerebral expansions that emerged during the Pleistocene probably provided was a vast symbolic capacity that enabled foresight, hindsight, and the brain-power to peer into other minds and to entertain alternate courses of action, thereby allowing humans to create the cultures that dominate our modern world … What makes humans unique, perhaps more than anything else, is that we are a linguistically adept story-telling species. That is why so many different forms of mythology have captivated our cultural imaginations since the dawn of recorded history. (Panksepp and Panksepp 2000, pp. 126f.)

We are a linguistically adept story-telling species because telling stories is one of the chief ways we give shape to our experience and thus ultimately direct our behavior. As Terrence Deacon puts it, “We tell stories about our real experiences and invent stories about imagined ones, and we even make use of these stories to organize our lives. In a real sense, we live our lives in this shared virtual world.” (Deacon 1997, p. 22).

II. Gene-Culture Co-Evolution Dispositions for creating and enjoying art form part of the larger evolutionary process known as “gene-culture co-evolution.” “Culture” includes technology and social organization as well as art, religion, and philosophy. Conceiving culture in this broader sense, evolutionary anthropologists often cite lactose tolerance as an instance of gene-culture co-evolution (cf. Cochran and Harpending 2009; Richerson and Boyd 2005; Wade 2006). Through natural selection, herding peoples have evolved enzymes that enable adults to digest milk. The cultural practice of keeping cattle serves as a selective force that alters the gene pool in a given population, and in turn the altered gene pool encourages the expansion of a pastoral economy. Language offers another clear instance of this kind of selective pressure. At some point in the ancestral past, humans had no power of speech. Mutations enabling rudimentary forms of “proto-language” would have given some selective advantage to those who possessed them (cf. Bickerton 1992; Bickerton 2000; Bickerton 2002; Mellars 1996). That advantage would have increased the representation of those genes in the population at large, and the increase in those genes would have enhanced the linguistic character of the cultural environment, intensifying the selective advantage conferred by genes promoting the use of language. A similar logic applies to imaginative culture. Developing the power of creating imaginative virtual worlds must have had adaptive value for our ancestors. Otherwise, capacities for imaginative culture would not now be human universals; artistic behavior would not spontaneously appear in all normally developing children; and humans would not display cognitive

The Adaptive Function of the Arts

55

aptitudes specifically geared toward the production and reception of art – dispositions, for instance, for organizing pitched sounds in rhythmically and emotionally expressive sequences, for constructing visual designs that produce distinct moods and states of contemplative attention, and for constructing fictional narratives that generate excited, empathic responses in audiences. (cf. Boyd 2009; Brown 1991; Dissanayake 2000; Dutton 2009; Scalise-Sugiyama 2005; Tooby and Cosmides 2001; Salmon and Symons 2004). These three factors – universality, reliable spontaneous development, and dedicated cognitive aptitudes – all suggest that dispositions for the arts were adaptive. If that is in fact the case, dispositions for producing and consuming the arts would have served as a selective force on the population, altering the gene pool, favoring those genes that facilitate producing and consuming works of art. Somewhere between 100,000 and 40,000 years ago, there was a transformation in human culture that anthropologists designate “the Human Revolution” (cf. Carroll 2006; Cochran and Harpending 2009; Klein and Elgar 2002; Mithen 1996; Mithen 2001; Wade 2006; Mellars 1996; Mellars et al. 2007; Mellars and Stringer 1989). Archeologically preserved forms of imaginative culture – art, decoration, ceremonial burial – appeared for the first time, and along with them, complex multi-part tools, sewn clothing, and extended forms of trade, implying more complex forms of social organization. In The Prehistory of the Mind (1996), Steven Mithen forcibly drew attention to the magnitude of this transformation and used it as evidence against the narrow-school EP conception of the massively modular mind. Countering the theory that cognitive flexibility arises from the multiplication of modules, all working automatically in response to regularities in the ancestral environment, he argued that the Human Revolution was generated by a genetically based cognitive transformation, a mutation involving language, that gave humans a vastly expanded flexibility in symbolic representation. His concept of “cognitive fluidity” is essentially a concept of metaphor: the power of linking images and ideas across diverse domains. To that power he attributes the sudden efflorescence of technological innovation and artistic production that characterizes the Human Revolution. Other theorists have argued for a more gradual evolution of human cognitive capacities (cf. Deacon 1997; Henshilwood and Marean 2003; McBrearty and Brooks 2000; Smail 2008; Sterelny 2003). I think the advocates of the Human Revolution will ultimately have the better part in this argument. In any case, at whatever pace it came about, there can be little doubt that modern symbolic culture – the culture of the past 100,000 years – differs in radical ways from the culture of the early and middle phases of hominid evolution. The very existence of modern symbolic culture runs counter to the narrow-school EP conception of human cognitive evolution – to massive modularity and the massively homogeneous character of the ancestral environ-

56

Joseph Carroll

ment. Hence the virtual necessity, for acolytes of narrow-school EP, to explain away modern symbolic culture, treating it as merely a side-effect to the adaptive structures that solved challenges supposed constant throughout the whole of the Pleistocene. “Human nature” means that humans share species-typical dispositions: basic motives tied closely to the needs of survival, mating, parenting, and social interaction (cf. Carroll 2008a, pp. 111ff.; Flinn et al. 2005; Kaplan et al. 2000). Cognitive and behavioral flexibility are part of human nature, but they have not eliminated the underlying regularities in basic motives. In different ecologies and different forms of social organization, the elements of human nature combine in distinctive ways, but “culture” cannot build structures out of nothing. It must work with the genetically transmitted dispositions of an evolved and adapted human nature. The arts give imaginative shape to the experiences possible within any given culture, reflecting its tensions, conflicts, and satisfactions. One chief aim for evolutionary studies in the humanities is to analyze the way any given culture organizes the elements of human nature, evaluate the aesthetic, emotional, and moral qualities inherent in that organization, and probe the way it influences – by conformist pressure or antagonistic stimulus – specific works of literature.

III. A Modified EP Model for the Arts In “The Psychological Foundations of Culture” (1992), Tooby and Cosmides formulate ideas on human cognitive evolution essentially concordant with Steven Pinker’s, and indeed, Pinker acknowledges that Tooby and Cosmides are the primary theoretical inspirations for his views on how the mind works. In “Does Beauty Build Adapted Minds?” (2001), Tooby and Cosmides formulate a theory of art that accords poorly with the vision of human cognitive evolution in “The Psychological Foundations of Culture.” Like E. O. Wilson, they speak of an “exploding universe of contingent information” that “created a vastly expanded risk of possible misapplications.” (Tooby and Cosmides 2001, p. 19). They take Hamlet as an exemplar for “the struggle for coherence and sanity amidst radical uncertainty.” Though hardly concordant with their earlier formulations on massive modularity, this vision of human cognitive experience displays serious limitations deriving from those earlier and still active formulations. The differences between the two visions are never fully reconciled, or even recognized. Despite these problems, the theory of the arts in “Does Beauty Build Adapted Minds?” makes substantial contributions to the gradually emerging consensus on the adaptive function of the arts. Tooby and Cosmides explain that they had once regarded the arts as an evolutionary by-product but have become dissatisfied with that explanation.

The Adaptive Function of the Arts

57

They give several reasons for their dissatisfaction: (a) involvement in fictional, imagined worlds is a human universal; (b) the arts are intrinsically rewarding; (c) fictional worlds engage emotions while detaching the actions that are usually prompted by emotions; and (d) humans have evolved specialized cognitive machinery for participating in imagined worlds (cf. Tooby and Cosmides 2001, pp. 7ff.). They conclude, “We think that the human mind is permeated by an additional layer of adaptations that were selected to involve humans in aesthetic experiences and imagined worlds”. This additional layer serves to organize other adaptations. Narrative representations, they argue, “have a powerfully organizing effect on our neurocognitive adaptations.” (Tooby and Cosmides 2001, pp. 11, 21; Dutton 2009, p. 106). This theory of art is hard to reconcile with the idea of the massively modular mind, itself necessarily linked with the idea of a massively stable EEA – that part of the environment relevant to the evolution of cognitive modules, and thus, from the EP perspective, an environment necessarily consisting in statistical regularities transcending radical fluctuations in climate and ecology. The theory of art formulated by Tooby and Cosmides is broader than their general conception of human cognitive evolution, but their theory of art has two limitations that can be linked with that more general conception: focusing art too narrowly on matters of practical concern, and leaving symbolic activity out of the list of basic human motives. Tooby and Cosmides take account of fictionality or “representations that are not literally true.” (Tooby and Cosmides 2001, p. 21). Their sense of “neurocognitive adaptations” is nonetheless closer to Pinker’s vision of the mind than to Wilson’s. In their view, mechanisms for “decoupling” a representation from an actual referent in the immediate environment have adaptive utility because “activities that organize an adaptation can be liberated from the constraints of having to encounter and practice the actual task.” The focus on “the actual task” runs parallel with Pinker’s idea that we use fiction for practicing game-plan scenarios to solve practical problems we might face in the real world. Fiction no doubt has some utility in this respect, but that utility does not get to the heart of the matter. The heart of the matter is that art fulfills an adaptive function by helping organize our total world view; it does not just give a final polish to “neurocognitive adaptations” geared toward fulfilling specific tasks that regularly recurred in a Pleistocene environment. Wilson’s theory of the adaptive function of the arts takes in the larger sense of what it means to “organize” our minds. The theory formulated by Tooby and Cosmides, like that formulated by Pinker, seems to remain fixed on the smaller, more narrow sense of “neurocognitive adaptations.” Tooby and Cosmides envision art as focusing the mind on adaptively relevant problems – mating, acquiring food or status, parenting, and other

58

Joseph Carroll

basic human motives (cf. Tooby and Cosmides 2001, p. 7). Art enables us “to feel our way more foresightfully to adaptively better choices.” (p. 23). I concur in this emphasis on basic human motives. I think basic motives are basic subjects for art. Still, one can concentrate on the basic motives humans share with their primate cousins and still not take adequate account of the way capacities for modern symbolic culture have fundamentally altered the economy of basic motives in human nature (cf. Boehm 1999; Boyd 2009; Dissanayake 2000; Klein and Elgar 2002; Mithen 1996; Wade 2006). If it is true that the arts are adaptively functional, they would be motivated as emotionally driven needs. The need to produce and consume imaginative artifacts would be as real and distinct a need as hunger, sexual desire, maternal and filial bonding, or the desire for social contact. Like all such needs, it would bear within itself, as its motivating mechanism, the pleasure and satisfaction that attend upon the fulfilling of desire. That kind of fulfillment would not be a parasitic by-product of some other form of pleasure, nor merely a means for fulfilling some other kind of need – sexual, social, or practical. Like all forms of fulfillment, the need for art could be integrated with other needs in any number of ways. It could be used for sexual display or the gratifications of sexual hunger or social vanity, and it could be used as a medium for social bonding. Nonetheless, in itself it would be a primary and irreducible human need. Failing to register that imaginative impulses have themselves become basic motives in human nature would almost necessarily mean overlooking self-reflexivity in art. An EP conception of the adaptive function of the arts cannot give an adequate account of art that takes as its subject matter the peculiar fascinations of the imagination itself – for instance, A Midsummer Night’s Dream and The Tempest; creative essays such as Dryden’s Of Dramatic Poesy, Pope’s “An Essay on Criticism,” and Wordsworth’s preface to the Lyrical Ballads; much of the poetry of Keats, Yeats, and Stevens; and in fiction those characters who personify features of imagination – for instance, Becky Sharp in Vanity Fair; the major characters in The Picture of Dorian Gray; Elizabeth-Jane in The Mayor of Casterbridge, and in Middlemarch Dorothea, Lydgate, Mary Garth, and Will Ladislaw. A theory of art that does not take account of the imagination as a subject of representation would find it difficult to register the symbolic import of the many scenes in canonical British novels in which abused or neglected children take refuge in the imaginary worlds created by books. In retreating into books, David Copperfield, Esther Summerson (in Bleak House), and Jane Eyre, for instance, are not just preparing themselves to respond more adaptively to future challenges such as finding food and selecting mates; they are organizing their minds and developing their personalities relative to a world of healthy human possibility. They are using their imaginations to create a world that is richer, more gen-

The Adaptive Function of the Arts

59

erous, and more complete than the psychologically impoverished environments in which they happen to live. Despite these important limitations in the theory of art formulated by Tooby and Cosmides, their concept of “organizing adaptations” gives access to a criterion for making evaluative distinctions among literary representations. Weighing the alternative explanations presented by Pinker and by Tooby and Cosmides, Catherine Salmon and Donald Symons give credence to both and suggest a way that these alternative causal hypotheses can be used in judgments of literary quality: Written fiction probably contains elements of both engagement of organizing adaptations and of pleasure circuit lock-picking, and different kinds of fiction may contain different proportions. Perhaps ‘great’ works of fiction are those that most fully engage organizing adaptations, which is why they have survived the tests of time and translation, while ‘lesser’ fiction, including genre romance novels, may primarily pick the locks of the brain’s pleasure circuits. (Salmon and Symons 2004, p. 95)

Salmon and Symons argue convincingly that Romance novels appeal to female mating fantasies and that pornography appeals to male mating fantasies. Pinker’s concept of the arts as evolutionary by-products accords most closely with genres like romance and pornography that simply activate pleasurable fantasies. It accords least closely with genres like tragedy that engage painful emotions but leave us feeling that we have a deeper and more adequate understanding of the forces that drive human experience.

IV. Making Sense of the Arts To formulate plausible and testable hypotheses about the adaptive function of the arts, we have to satisfy three criteria: (a) define the arts in a way that identifies what is peculiar and essential to them – thus isolating the behavioral disposition in question; (b) identify the adaptive problem this behavioral disposition would have solved in ancestral environments; and (c) identify design features that would efficiently have mediated this solution (cf. Pinker 2007). We can define art as the disposition for creating artifacts that are emotionally charged and aesthetically shaped in such a way that they evoke or depict subjective, qualitative sensations, images, or ideas. Literature, specifically, produces subjectively modulated images of the world and of our experience in the world. The disposition for creating such images would have solved an adaptive problem that, like art itself, is unique for the human species: organizing motivational systems disconnected from the immediate promptings of instinct. The design features that mediate this adaptive function are the capacities for producing artistic constructs such as narrative and verse and emotionally modulated musical and visual patterns. Consider the reality of our experience. We live in the imagination. For us, humans, no action or event is ever just itself. It is always a component in

60

Joseph Carroll

mental representations of the natural and social order, extending over time. All our actions take place within imaginative structures that include our vision of the world and our place in the world – our internal conflicts and concerns, our relations to other people, our relations to nature, and our relations to whatever spiritual forces we imagine might exist. We live in communities that consist not just of the people with whom we come directly into contact but with memories of the dead, traditions of our ancestors, our sense of connection with generations yet unborn, and with every person, living or dead, who joins with us in imaginative structures – social, ideological, religious, or philosophical – that subordinate our individual selves to some collective body. Our sense of our selves derives from our myths and artistic traditions, from the stories we tell, the songs we sing, and the visual images that surround us. We have all had moments in which some song, story, or play, some film, piece of music, or painting, has transfigured our vision of the world, broadened our minds, deepened our emotional understanding, or given us new insight into human experience. Working out from this common observation to a hypothesis about the adaptive function of literature requires no great speculative leap. Literature and the other arts help us live our lives. That is why the arts are human universals (cf. Brown 1991). In all known cultures, the arts enter profoundly into normal childhood development, connect individuals to their culture, and help people get oriented to the world, emotionally, morally, and conceptually (cf. Boyd 2009; Carroll 2004, pp. 65ff.; Johnson et al. 2008; Dissanayake 2000; Dutton 2009; Tooby and Cosmides 2001).

References Baumeister, Roy F., The Cultural Animal: Human Nature, Meaning, and Social Life, Oxford: Oxford UP, 2005. Bickerton, Derek, Language and Species, Chicago: University of Chicago Press, 1992. –, “Foraging versus Social Intelligence in the Evolution of Protolanguage,” in: The Transition to Language, ed. by Alison Wray, Oxford: Oxford UP, 2000, pp. 207–225. –, “From Protolanguage to Language,” in: The Speciation of Modern Homo Sapiens, ed. by T. J. Crow, Oxford: Oxford UP, 2002, pp. 103–120. Boehm, Christopher, Hierarchy in the Forest: The Evolution of Egalitarian Behavior, Cambridge: Harvard UP, 1999. Boyd, Brian, “Evolutionary Theories of Art,” in: The Literary Animal: Evolution and the Nature of Narrative, ed. by Jonathan Gottschall and David Sloan Wilson, Evanston, IL: Northwestern UP, 2005, pp. 147–176. –, On the Origin of Stories: Evolution, Cognition, and Fiction, Cambridge: Harvard UP, 2009. Brown, Donald E., Human Universals, Philadelphia: Temple UP, 1991. Carroll, Joseph, Literary Darwinism: Evolution, Human Nature, and Literature, New York: Routledge, 2004.

The Adaptive Function of the Arts

61

–, “The Human Revolution and the Adaptive Function of Literature,” in: Philosophy and Literature 30 (2006), pp. 33–49. –, “An Evolutionary Paradigm for Literary Study,” in: Style 42 (2008), pp. 103–135 (= 2008a). –, “2008. Rejoinder,” in: Style 42 (2008), pp. 309–412 (= 2008b). Cochran, G. / H. Harpending, The 10,000 Year Explosion: How Civilization Accelerated Human Evolution, New York: Basic Books, 2009. Cosmides, Leda / John Tooby / Jerome Barkow, “Introduction: Evolutionary Psychology and Conceptual Integration,” in: The Adapted Mind: Evolutionary Psychology and the Generation of Culture, ed. by J. Barkow, L. Cosmides, and J. Tooby, New York: Oxford UP, 1992, pp. 3–15. Damasio, Antonio, Descartes’ Error: Emotion, Reason, and the Human Brain, New York: G. P. Putnam, 1994. Deacon, Terrence W., The Symbolic Species: The Co-evolution of Language and the Brain, New York: Norton, 1997. Dissanayake, Ellen, Art and Intimacy: How the Arts Began, Seattle: University of Washington Press, 2000. –, “What Art Is and Does: An Overview of Contemporary Evolutionary Hypotheses,” in: Evolutionary and Neurocognitive Approaches to Aesthetics, Creativity, and the Arts, ed. by Colin Martindale, Paul Locher, and Vladimir M. Petrov. Amityville, NY: Baywood, 2007, pp. 1–14. Dutton, Denis, The Art Instinct, Oxford: Oxford UP, 2009. Flinn, M. V. / D. Geary / C. V. Ward, “Ecological Dominance, Social Competition, and Coalitionary Arms Races: Why Humans Evolved Extraordinary Intelligence,” in: Evolution and Human Behavior 26 (2005), pp. 10–46. Foley, Robert, “The Adaptive Legacy of Human Evolution: A Search for the Environment of Evolutionary Adaptedness,” in: Evolutionary Anthropology 4 (2005), pp. 194– 203. Geary, David C., The Origin of Mind: Evolution of Brain, Cognition, and General Intelligence, Washington, D. C.: APA, 2005. Hawkins, J. / S. Blakeslee, On Intelligence, New York: Henry Holt, 2004. Henshilwood, C. S. / C. W. Marean, “The Origin of Modern Human Behavior: Critique of the Models and Their Test Implications,” in: Current Anthropology 44 (2003), pp. 627–651. Irons, William, “Adaptively Relevant Environments versus the Environment of Evolutionary Adaptedness,” in: Evolutionary Anthropology 6 (1998), pp. 194–204. Johnson, J. A. / J. Carroll / J. Gottschall / D. J. Kruger, “Hierarchy in the Library: Egalitarian Dynamics in Victorian Novels,” in: Evolutionary Psychology 6 (2008), pp. 715– 738. Kaplan, H. / K. Hill / J. B. Lancaster / A. M. Hurtado, “A Theory of Human Life History Evolution: Diet, Intelligence, and Longevity,” in: Evolutionary Anthropology 9 (2000), pp. 156–185. Klein, R. G. / B. Elgar, The Dawn of Human Culture, New York: Wiley, 2002. MacDonald, Kevin B., “A Perspective on Darwinian Psychology: The Importance of Domain-general Mechanisms, Plasticity, and Individual Differences,” in: Ethology and Sociobiology 12 (1990), pp. 449–480.

62

Joseph Carroll

McBrearty, S. / A. S. Brooks, “The Revolution That Wasn’t: A New Interpretation of the Origin of Modern Human Behavior,” in: Journal of Human Evolution 39 (2000), pp. 453–563. Mellars, Paul, “Symbolism, Language, and the Neanderthal Mind,” in: Modelling the Early Human Mind, ed. by Paul Mellars and Kathleen Gibson, Cambridge: The MacDonald Institute for Archaeological Research, 1996, pp. 15–32. Mellars, P. / K. Boyle / O. Bar-Yosef / C. Stringer (eds.), Rethinking the Human Revolution: New Behavioural and Biological Perspectives on the Origin and Dispersal of Modern Humans, Exeter, UK: MacDonald Institute, 2007. Mellars, P. / C. Stringer (eds.), The Human Revolution: Behavioural and Biological Perspectives on the Origins of Modern Humans, Princeton: Princeton UP, 1989. Mithen, Steven, The Prehistory of the Mind: The Cognitive Origins of Art, Religion, and Science, London: Thames and Hudson, 1996. –, “The Evolution of Imagination: An Archaeological Perspective,” in: SubStance 30 (2001), pp. 28–54. Panksepp, J. / J. B. Panksepp, “The Seven Sins of Evolutionary Psychology,” in: Evolution and Cognition 6 (2000), pp. 108–131. Pinker, Steven, How the Mind Works, New York: W. W. Norton, 1997. –, “Toward a Consilient Study of Literature,” in: Philosophy and Literature 31 (2007), pp. 162–178. Potts, Rick, Humanity’s Descent: The Consequences of Ecological Instability, New York: William Morrow, 1996. Richerson, P. J. / R. Boyd, Not by Genes Alone: How Culture Transformed Human Evolution, Chicago: University of Chicago Press, 2005. Salmon, C. / D. Symons, “Slash Fiction and Human Mating Psychology,” in: Journal of Sex Research 41 (2004), pp. 94–100. Scalise-Sugiyama, Michelle, “Reverse-engineering Narrative: Evidence of Special Design,” in: The Literary Animal: Evolution and the Nature of Narrative, ed. by Jonathan Gottschall and David Sloan Wilson, Evanston: Northwestern UP, 2005, pp. 177– 196. Smail, Daniel Lord, On Deep History and the Brain, Berkeley: University of California Press, 2008. Sterelny, Kim, Thought in a Hostile World: The Evolution of Human Cognition, Oxford: Oxford UP, 2003. Tooby, J. / L. Cosmides, “The Psychological Foundations of Culture,” in: The Adapted Mind: Evolutionary Psychology and the Generation of Culture, ed. by Jerome H. Barkow, L. Cosmides, and J. Tooby, New York: Oxford UP, 1992, pp. 19–136. –, “Does Beauty Build Adapted Minds? Toward an Evolutionary Theory of Aesthetics, Fiction, and the Arts,” in: SubStance 30 (2001), pp. 6–27. Wade, Nicholas, Before the Dawn: Recovering the Lost History of Our Ancestors, New York: Penguin, 2006. Wilson, David Sloan, “Evolutionary Social Constructivism,” in: The Literary Animal: Evolution and the Nature of Narrative, ed. by Jonathan Gottschall and D. S. Wilson, Evanston: Northwestern UP, 2005, pp. 20–37.

The Adaptive Function of the Arts

63

–, Evolution for Everyone: How Darwin’s Theory Can Change the Way We Think about Our Lives, New York: Delacorte, 2007. Wilson, Edward O., Consilience: The unity of Knowledge, New York: Alfred A. Knopf, 1998.

64

Evolution and Literary Response Brian Boyd

Literary theory should aim to explain literature from first principles and from the ground up. From Aristotle on, brilliant minds have engaged in literary theory, but their pictures have inevitably remained somewhat flat, however detailed and evocative, because they do not incorporate the deep time – that extra dimension – of evolution. I want to propose some starting points for a naturalistic model of literary response, interpretation, and criticism. I aim especially to account for both the substantial convergence and the substantial divergence of both spontaneous and critical response, and for the naturalness of literary criticism. Apart from the theory of evolution, I start with two minimal assumptions: life involves problems and solutions at multiple levels; and information falls into patterns which often reflect regularities in the world and whose detection therefore makes better prediction possible. Deconstructionist criticism argued that meaning is undecidable and indeterminate, and constructivist criticism in the Foucauldian vein and after has argued that meanings depend on the episteme of a particular epoch or culture or the interests of particular groups. If deconstructionism were right, authors would not be able to foresee how audiences would respond and would thus have no basis on which to shape a story in order to produce the response they wished to solicit. This seems, to put it mildly, improbable. So, too, does the strong constructionist claim, which cannot explain why Shakespeare earns esteem now as well as in 1960 or 1600, or in Germany, Hungary, or Japan – never under British rule or eager audiences for British cultural propaganda – as well as in Australia or Canada. Joseph Carroll has long combated the indeterminacy of meaning in literary theory inspired by capital-T Theory (cf. Carroll 1995; Carroll 2004). In their forthcoming Graphing Jane Austen, he and his co-authors report the results of their large-scale Internet survey of readers’ responses to characters in nineteenth-century British novels (cf. Carroll et al., 2012). They interpret the substantial convergence of judgments on characters as proof that there is determinate meaning, or, to look in the other direction, convergent response. Nevertheless, as audiences and critics we know that there can also be much divergence of response, within and between audiences or from critic

Evolution and Literary Response

65

to critic. In an almost inevitable practice, Carroll himself sums up the diversity of response to Wuthering Heights in a recent article before offering his own analysis of the novel – which adds to the diversity and does not end the debate (cf. Carroll 2008, pp. 241–257). Responses convergent and predictable enough to warrant authors shaping their work to desired ends and divergent and unpredictable enough to ensure ongoing critical debate seem to be empirical facts over millennia of literature. How can we account for both the convergence and divergence of response without distorting the evidence or reaching extreme solutions?

I. Convergence Experience and evolution suggest we should expect a convergence of responses. Let us see why in terms of problems and patterns. Problems emerged with life, and we can see life as a nested hierarchy of problems and solutions – or adaptations – at multiple levels: gene, cell, organ, organism, and group. A major task even for the simplest organisms is to extract the best information they can from the environment, in order to reduce risks and increase opportunities; all the more so for individuals in a species like ours whose success depends so much on mastering information. The world is understandable because it has regularities at many levels. Information forms patterns because of these regularities in the world. Even in organisms without minds, like plants responding to lengthening or shortening days, nature has evolved ways of tracking patterns of information that happen to be relevant to particular species. For animals, nature has evolved species-specific repertoires of sensory, cognitive, and emotional processing systems that allow individual organisms to understand, predict, and act within the world as it matters to their species. Uniformities in species design, in morphology, behavior, and expression enabled evolution to ensure also, within each social species, a species-wide capacity to understand the actions of conspecifics in similar ways. In highly social species, especially ours, that includes understanding conspecifics’ actions in terms of the patterns in their behavior and expressions. Recent experiments on emotional contagion show that our faces can react to expressions – in other words, to particular patterns of activation of human facial muscles – that have been flashed on a screen too fast for our conscious recognition (cf. Goleman 2006). Evolution has tuned us to be astonishingly efficiently and precisely attuned to others, and especially to recurrent patterns in others. More than that, evolution has attuned social species to understand others also in terms of intentions, in terms of the problems they are trying to

66

Brian Boyd

deal with and the solutions they are trying to achieve. We interpret events and actions not just in terms of patterns of action, but especially in terms of patterns of intention (cf. Tomasello et al. 2005). Mirror neurons fire more intensely at an intention than at an apparently undirected action, or to think of this in another way, we can intuit in a flash the problems which we think others’ behavior is trying to solve. Experiments show that even infants interpret actions in terms of goals, in terms of the problem that an action solves (cf. Premack and Premack 2003). We have evolved to understand events, especially the most complicated and volatile kinds of events we are faced with, social events, in similar ways (cf. Boyd 2009, part 3). We should expect convergent responses in our understanding of events. But a naturalistic theory of meaning in narrative needs to combine the evolved capacity to understand events (especially the intentions and actions of conspecifics and other agents) with another: the special case of the capacity to understand the communicative intent of other conspecifics when they signal us, in our case, usually – but not only – through language. Communication evolves through the ritualization of behavior, when one creature acts in ways clearly enough defined that it can be confident another will take them as signals. These signals can be conventions, they can even be arbitrary conventions, but they build slowly on an extensive foundation of intraspecific understanding, of evolved capacities to read others, and on the slow establishment of agreed understandings that can become more and more precise and efficient, and can help make thought more precise and efficient, as language builds (cf. Hurford 2007). Both in terms of understanding events and in understanding communicative actions, like oral, acted, printed, or filmed stories, we should expect considerable convergence in understanding and, therefore, emotional response.

II. Divergence There are also many reasons to expect a diversity of responses to narrative. Firstly, there will be divergence in terms of comprehension. Although events can be understood in similar ways even across species, let alone within a species, they do not come pre-labeled. They can have an open-ended range of implications, at different levels of generality: “a very large number of inferences can be drawn from any observed event” (Hurford 2007, p. 73).1 1

For similar observations as applied to literature, especially to “thematic” abstractions from complex plots, see Richard Levin, New Readings vs. Old Plays: Recent Trends in the Reinterpretation of English Renaissance Drama, Chicago: University of Chicago Press, 1979, chapter 2.

Evolution and Literary Response

67

Animals can understand and infer present situations via similarities to past ones; the more their memories can access similar past situations, the better they can comprehend current situations and imagine future ones.2 Recent evidence suggests that memory stores events by compression, by gist, not only to maximize storage, but also to facilitate retrieval by partial matching and imaginative manipulation (cf. Schacter et al. 2008). What associations a sequence of events inside or outside narrative will trigger will depend not only on variable individual experience, but also on the variable capacities for activating and reshaping associations in different memories. The more we can generalize from situations now, the more relevant information we can also bring to bear on decisions in the future. There have therefore been strong evolutionary pressures to understand not only specific situations and individuals, but also to grasp a wide and open-ended range of implications. In the human case, I may understand an action as the cause of a certain effect; or as an indication of a certain typical personality trait in the actor, and therefore a measure of that person’s desirability as an associate; or as an indication of an atypical mood in the actor, and therefore a prompt to find out the cause of that mood; or as an indication of the likely reaction of anyone to that kind of situation (whether narrowly or broadly defined); or as likely to lead to a certain reaction (under conditions more or less narrowly specified), and therefore perhaps as offering lessons about such situations or such reactions; or as an example of a certain moral quality and its consequences, and so on. We should expect that the capacity to infer multiple implications from events would correspond with general intelligence and with social intelligence. General intelligence appears to be highly polygenic, and the same is likely to be true of social intelligence. When traits are polygenic – like height or skin color, rather than, say, sex, or lobed versus lobeless ears –, they yield not either-or options but combinations spread across a normal distribution. The range of capacities for inferring multiple general implications will therefore be likely to follow a bell curve: there will likely be a considerable spread in abilities. Thus, the particular memories activated by present events, and the capacities for understanding present situations by analogy with memories of past situations, will vary. The capacity for inferring implications, and the range of inferences explored, will also vary according to capacity and opportunity. The same will be true for responses to narrative, to indirect rather than direct representations of events – even if in the case of narrative, story2

This presumably depends on the kind of pattern matching typical in relating a present instance to past instances: it need involve not episodic memory but only something like a pre-verbal “semantic” memory. See the work of Lawrence Barsalou on grounded cognition, summarized in Lawrence Barsalou, “Grounded cognition,” in: Annual Review of Psychology 59 (2008), pp. 617–645, and Hurford on the origins of meaning (2007).

68

Brian Boyd

tellers shape their stories to produce certain effects, where ordinary but non-social events are never shaped for their effects on bystanders. Since efficient communication has been shown not to be evolvable unless to the benefit of the senders (cf. van Hooff and Preuschoft 2003, p. 265; Knight 1998, p. 75), we would not have evolved to communicate unless our audiences could understand us within an acceptable range of interpretations. The possibility of reasonably accurate interpretation is a precondition and incentive for the evolution of communication. But evolution, including the evolution of communication, does not achieve perfection or exactitude. Communication is not exact decoding but a trigger to inference by the receiver, and in ordinary face-to-face or at least moment-by-moment back-and-forth communication, a sense of relevance directs the inferential search (cf. Sperber and Wilson 1996). But in fiction, as opposed to gossip or casual social conversation, stories tend to be designed to stand alone, and therefore to be unrelated to specific current situations or individuals. While the spell of the story lasts, the story engages us with its own sense of internal relevance. But a story’s attempt to stand free of its origins means relevance cannot readily constrain the range of possible inferences as in less self-contained communication. And because fiction is decoupled from the ongoing present, an audience may have more time, more detachment and more incentive to explore a wide range of inferences. The richness of inferences at multiple levels of generality compensates for the lack of immediate relevance: and the most ambitious storytellers aim for a wide resonance, a series of spreading waves of implication. We can respond to narratives not only as sequences of events, but also as the products of authors, as sequences of storytelling intentions. We need not do this always, as when we recite or hear a nursery rhyme, or when a child or a naïve adult watches a Hollywood movie or a soap opera. But we can do it when we choose, bringing to bear on a story not only our comprehension of events in general, and language, and stories, and particular story modes, but also our highly specialized systems for inferring intentions from human actions or their products (what philosopher Daniel Dennett calls the “design stance”, cf. Dennett 1993; Dennett 1996): our systems for understanding others’ actions in terms of their intentions, of the problems they try to solve. We can respond to the story as a sequence of events, shaped by the teller for a certain range of response, but we can also ask: how does the teller wish us to respond? That can lead to a richer and perhaps more accurate response, because it invites a search for more evidence for the teller’s probable intentions, for elements of the story that we may not have fully understood or have overlooked or underweighed. Understanding the intentions of others offers an especially fine-tuned way of understanding the actions, or the products of actions, of others. Because our evolved systems of social comprehension are so fine-tuned, and

Evolution and Literary Response

69

because we have become so cooperative, we have very high expectations of the precision we would like from understanding others. But we also know that we can misconstrue the intentions even of those we love, even when face to face, even when talking back and forth. We can only infer intentions, and we have evolved to infer intentions especially from those we engage with eye to eye. Inferring intentions from artefacts of past eras, like stories, when the artificers have long since died, will be highly uncertain, especially in inferring from a self-contained story, and especially when our capacity for interpreting actions and intentions is already so engaged, as we follow the story, by the characters and their world.

III. Appropriation The film theorist David Bordwell offers a lucid and straightforward threepart model for response that does not derive from evolutionary theory, but can be strengthened by it (cf. Bordwell 2008, pp. 44–51). First, perception: our evolved perceptual apparatus means that we all see or hear much the same, and process it similarly. At this stage, our responses will tend to be highly convergent: we see the same actors on the stage or screen and the same marks on the page. (Even here, audiences sitting on different sides of a theater or tracking a different actor may focus on different faces or gestures.) Second, comprehension: our evolved systems of understanding events, especially the fine grain of social actions, means we will understand similarly, provided we know the language and customs of an interaction or a narrative. But as we have seen, comprehension is an inferential system that goes beyond the explicit evidence, and people can have different capacities, motivation and opportunity to infer more or less. There is far more room here for divergence. Third, appropriation: we will tend to react to a story in ways that maximize its value for us. We inevitably have different individual interests, as selfish gene theory has explained in depth, and we have different interests from ourselves at other times, at different times of life, as life history theory helps explain, and even in different circumstances, as foraging theory helps explain. We will have different interests individually, but different groups may also have different interests, as multilevel selection theory explains. Divergence at this level of response is entirely to be expected. Let us take an economical example from Dr. Seuss’s Horton Hears a Who! (cf. Boyd 2009, pp. 368–379).3 The elephant Horton, alone of the jungle animals, can hear the microscopic Whos, and wishes to protect them: “A person’s a person, no matter how small.” The other animals protest that there cannot be a whole Whoville on a speck of dust on a clover, and threat3

Horton Hears a Who! (1954; rpt. New York: Collins, 1998).

70

Brian Boyd

en to boil the clover flower in oil as a response to Horton’s absurd claim. Only if the Whos can make themselves heard by the other animals will they be saved. All their clamor does not avail them until one last little boy adds his voice to the hubbub, the other animals hear them, and vow to protect the Whos as Horton has done. Dr. Seuss intended this story in part as encouragement for the revival of democracy in post-war Japan: everyone should vote, because every voice counts, even little Jo-jo’s. Abortionists turned “A person’s a person, no matter how small” into a bumper-sticker slogan until Dr. Seuss threatened a lawsuit. A parent can read the story to excite or distract a child. A parent wanting a child to pitch in to help can point to little Jo-jo’s voice that helps save the Whos. A parent wanting a child to resist the worst goings-on in the playground can point to Horton’s courage in supporting the Whos despite the unanimous animosity of the other animals. A child can see “A person’s a person, no matter how small” as suggesting how she counts or how perhaps she should allow her little brother to count. As a teacher, I can and do select the story as an easy and engaging way to introduce principles of narrative. Or I can appropriate it here to explain the concept of appropriation. We can appropriate a story to help solve a particular problem we face. Selfish gene theory and multilevel selection theory help explain why, as individuals or members of groups, we should seek to respond to a story in ways that benefit us, that are relevant to our situation and interests (cf. Dawkins 1989; Wilson and Wilson 2007). Readers therefore will have a natural tendency to look for positive evidence, for implications they would like to find in a story or for explanations they think they have found there. We should expect and accept this individual or group or cultural appropriation as a natural part of attending to a story. Even earlier in the process, readers will also continue to read a story if they think the benefits of doing so outweigh the costs: if it seems more interesting, and perhaps more relevant to me, than another available use of my time, for instance, or if the demands of a complex story seem not too taxing for my skills or my mood. The estimated benefits may vary from one reading situation to another. Foraging theory offers well-developed explanations of searching for what matters for individuals in particular problem contexts (cf. Stephens et al. 2007). In line with foraging theory, and common sense, we should expect that audiences would respond differently according to different problem situations: sitting in an audience alone, with close friends, or with important acquaintances, say, or writing for a newspaper, online review, or blog, or an undergraduate or graduate essay or an academic article. Different search tasks will yield different search patterns: someone seeking a toilet and someone seeking a pastry will look at the streets of a new city in different ways. As academic critics we pose ourselves and students

Evolution and Literary Response

71

particular problems: we appropriate texts, perhaps according to some political agenda, perhaps to demonstrate a critical method or a theoretical problem, or to introduce a part of the cultural heritage; perhaps we interpret, in search of the original intentions, for the clearest understanding of the problems the author poses and solves, or perhaps we search for the richest possible value of a story. Searching for original intentions or for maximum value may mean searching for or attending to new features from new angles, and not searching only for confirming evidence: it could even offer a healthy challenge to a too-early too-easy appropriation. We need to accept that we will appropriate, not to insist that the meanings are wholly within the text, and then to discuss the kinds of appropriations on their own terms.

IV. Pattern I want next to consider literary response in terms of pattern. Art, I have suggested in On the Origin of Stories (2009), is a kind of open-ended, non-zero-sum play with pattern. All rich works of art are overloaded with pattern. Because human attention is strictly limited, to something like seven bits of information or even fewer, we cannot attend to multiple patterns at once. Why do I refer to “pattern,” and not to more conventional terms like “character,” “plot,” “imagery”? Partly because I want to step outside what we take for granted, and to go back to first principles. Pattern reflects regularity in the world, or in the satellite worlds of works of art, and it allows minds to process information efficiently. As I argue in On the Origin of Stories, our intense human motivation to understand the world leads to the cognitive play with pattern that is the common feature of all the arts (cf. Boyd 2009, pp. 80–98). Pattern includes all the significant information in all the arts, as opposed to the distinct kinds of pattern unique to a single art, like characters in story, colors in painting, chords in music. We interpret our world in terms of patterns. Individuals speak or write by hand, for instance, in different and even unique ways – different even from themselves in other states. We understand not by the variable quirks of particular spoken sounds or written signs, but by their pattern in relation to other patterns, including the top-down patterns of partly-glimpsed sense that allow us to fill in the gaps in messy handwriting or in indistinct speech sounds (cf. Deheane 2009). We can read almost at normal speed a printed text in which the first and last letters of each word remain the same but the rest are scrambled, because of the salience of onsets and endings, and because top-down patterns allow us to intuit the word and the sentence. We identify faces, which we continually see in different lights, from different angles, and with different expressions and skin tones, through pattern recogni-

72

Brian Boyd

tion, and that pattern can sometimes suffice for us to recognize even a face that has aged for thirty years since we last saw it. Patterns meet at convergence zones within the mind and then at superconvergence zones, as our brains try to interpret at the highest level they can (cf. Damasio 1996; Hurford 2007). Feedback inhibits apparently wrong interpretations (signals that activate few or no other neural signals) and amplifies apparently right ones (signals that lead to a cascading connection with others) in both directions, top-down and bottom-up. Some patterns leap to attention: the patterns of differential illumination that our visual systems immediately detect as edges, for instance, or the distinction between the phonemes l and r for speakers of English but not of Japanese. Just as we are emphatically visual creatures, with a complex network of fifty different brain areas involved in visual processing, so we are emphatically social creatures. Just as edges or colors pop out to visual attention, so individuals and actions in narrative announce themselves loudly to our brain systems for social cognition. And, just as edges and colors combine at convergence zones into shapes and inferred objects, so individuals and actions combine at social-cognitive convergence zones into characters and plots, into causes and consequences, into goals, obstacles and outcomes. We have evolved to interpret many kinds of patterns more or less automatically – so swiftly that we do not even think of them in terms of pattern or interpretation. For good evolutionary and sometimes cultural reasons, patterns differ markedly in their salience. We have evolved to pay particular attention to key social information, so that in fiction patterns of character and action will commandeer almost all our attention at first, and often generate an almost automatic emotional charge. Stories command our attention because they contain such charged concentrations and such rapid successions of patterned social information. Because of the salience of social patterns, we tend to respond in similar ways to the broad outlines of narrative. But attention is limited, and we cannot attend to and process all patterns at once. On repeat encounters we may start to notice or at least pay more attention to other patterns – patterns of imagery or structure, for instance. Perceiving these patterns may then exert a top-down shift in our response. The recognition of pattern produces a measure of satisfaction in itself: it gives us a sense of increased control over the information bombarding us, and it bespeaks an authorial control and a human mastery that we naturally welcome. But with the most salient patterns of social information, of character and event, still commanding attention, the particular patterns one re-reader will now attend to may differ from what even other re-readers see. Let us look at two examples from a familiar source, Shakespeare’s comedies. Much Ado About Nothing introduces the love of Claudio and Hero

Evolution and Literary Response

73

from the start, and contrasts it with the antagonism between Beatrice and Benedick. No one capable of following the story at all fails to notice either the pattern of these relationships or the pattern of contrasts between them. Beatrice and Benedick ridicule and provoke each other incessantly, and that leads their friends to tricking them into falling in love with one another, despite their professed hostility to love and to each other. But very few will notice that until the wedding of Claudio and Hero, which Claudio breaks off with accusations of Hero’s infidelity, Claudio and Hero do not once speak audibly to each other on stage, while Beatrice and Benedick have never kept silent in each other’s presence. If we recognize this pattern, we not only experience additional admiration for Shakespeare’s stagecraft, but we see even more sharply the contrast between the shallowness of Claudio and Hero’s knowledge of each other and the depth and complexity of Beatrice’s and Benedick’s knowledge. In the first speech in Twelfth Night, Orsino declares his ongoing and undying love for Olivia. He sends messengers to renew his suit, including Viola disguised as Cesario. Olivia, who has always rebuffed Orsino and his messengers, falls in love with the witty and passionate Cesario-Viola, already herself in love with Orsino. The impasse is overcome only when Viola’s twin brother and Cesario’s exact lookalike, Sebastian, arrives in Illyria and Olivia swiftly marches him to the altar. Orsino confronts Olivia in the final scene, Cesario’s real identity as Viola is disclosed, and her love for Orsino finds its return. Psychologically, the swiftness of Orsino’s transition from professing unmatchable love for Olivia to loving Viola may seem absurd. But a producer who recognizes, or a reader who notices, the pattern of Shakespeare’s stagecraft will see that Orsino and Olivia are never present on stage until Olivia is already married to another, and that after Viola decides to adopt the disguise of Cesario in scene two, Orsino is never on stage without Cesario, usually in an intense and heartfelt discussion of feelings. From the first time we see Orsino with Cesario-Viola, he already relies on her intense empathetic attunement and has no real need of the imagined love-requital of an Olivia who never cared for him. Shakespeare uses bold stagecraft to provide colorful contrast and psychological and thematic depth, not so much by realism as by pattern. If we see the patterns as we re-read, or if a director sees them, they can modify our response to the whole play; but if we see only immediate social patterns, we may understand Shakespeare’s characters and characterization and control differently, and perhaps insufficiently. Shakespeare builds on the kind of plot contrasts that were a standard dramaturgical device in his time; but he also avoids the structural schematism of his immediate precursor, John Lyly, whose patterns obtrude so much that we see them as at the expense of felt life, as contrary to the partial unpredictability of life’s complexly interacting patterns. Shakespeare influences us mightily by patterns that we can perceive

74

Brian Boyd

and enjoy at once (Claudio and Hero as lovers, Beatrice and Benedick as professed haters; Olivia as long indifferent to Orsino and immediately impassioned by Cesario), but he also shapes our response by patterns that we will almost certainly not consciously recognize at first exposure (Claudio and Hero not talking to one another, Beatrice and Benedick unable not to engage one another; or Orsino and Olivia as always apart, Orsino and Viola as always together) – but if and when we do consciously perceive the structural pattern, it adds to our pleasure, and our appreciation of Shakespeare’s artistic control, and enriches the psychology. The conscious recognition of a structural pattern almost inevitably alters our response, in a top-down way – but the recognition may be rare. The responses of those who do and those who do not consciously perceive these patterns will inevitably diverge, and writers who include patterns that they have good reason to expect some in their audience will not consciously perceive will anticipate – and be resigned to, or delighted at? – a range of responses.

V. The Naturalness of Literary Criticism Literary criticism has often felt guiltily indulgent: parasitic on what’s already a superfluous pleasure, or even worse, on elitist art, and only justifiable to some recent critics as a form of ongoing revolution by other means. But I want to suggest that critical discussion is a perfectly natural part of our response to stories. Why do we interpret, discuss, and offer competing explanations of literary works? We interpret literary works because we cannot help doing so, even at the naïve level, merely as represented events. We interpret literary works as works of art because we have very powerful and almost automatic systems of inferring the intentions of others, characters and storytellers. And we trade responses because, as a species, we are uniquely predisposed to shared attention, which has crucial consequences for us individually and as a species (cf. Tomasello et al. 2005); and because, as a species, we are particularly prone to social learning. Social learning solves the problem of finding good information at reduced search cost: hence warning calls in many species, or food calls in primates, and restaurant reviews in newspapers, or customer book or video reviews on Amazon and other online rating systems and blogs. We can learn not only what others think are the best stories, especially what those with the best reputations for judging the best stories think, but what are the richest ways for us to understand these stories. We can reduce search time and increase search value. We share explanations because we have an interest both in understanding stories and their wide range of possible implications for us, because they

Evolution and Literary Response

75

help us understand and discuss and reason about experience, and because we know there will be a range of responses (otherwise there would be no point in discussing) and a similarity in response (otherwise there would also be no point in discussing). We assess the performance of storytellers, both because this helps us understand the comparative capacities of individuals, which, as a social species, we are intensely inclined to do, and because this cuts down search time for future stories. Our disagreements about evaluation are not endpoints but the basis for further elaboration and discussion (cf. Ellis 1993), including, perhaps, the discussion of principles of evaluation. In a world not only of social learning but also of specialization, we can earn status for seeing new patterns, new problems, or new implications in stories. We compete in offering responses to stories because others can and want to learn from them and because we can earn status by doing so. Convergent responses to stories are natural, and so are divergent responses, and so are ongoing critical discussions of stories, and ongoing disagreements, from which we can all learn.

References Barsalou, Lawrence, “Grounded cognition,” in: Annual Review of Psychology 59 (2008), pp. 617–645. Bordwell, David, Poetics of Cinema, New York: Routledge, 2008. Boyd, Brian, On the Origin of Stories: Evolution, Cognition, and Fiction, Cambridge, MA: Belknap Press of Harvard UP, 2009. Carroll, Joseph, Evolution and Literary Theory, Columbia, MO: University of Missouri Press, 1995. –, Literary Darwinism: Evolution, Human Nature, and Literature, New York: Routledge, 2004. –, “The Cuckoo’s History: Human Nature in Wuthering Heights,” in: Philosophy and Literature 32 (2008), pp. 241–257. Carroll, J. / J. Gottschall / J. Johnson / D. Kruger, Graphing Jane Austen: Paleolithic Politics in British Novels of the Nineteenth Century, Baltimore, MD: Johns Hopkins UP, 2012. Damasio, Antonio, Descartes’ Error: Emotion, Reason and the Human Brain, London: Papermac, 1996. Dawkins, Richard, The Selfish Gene (1976), New York: Oxford UP, 1989. Deheane, Stanislas, Reading in the Brain: The Science and Evolution of a Human Invention, New York: Viking, 2009. Dennett, Daniel C., Consciousness Explained, Harmondsworth: Penguin, 1993. –, Kinds of Minds: Towards an Understanding of Consciousness, London: Weidenfeld and Nicolson, 1996. Ellis, John, Language, Thought and Logic, Evanston, IL: Northwestern UP, 1993. Goleman, Daniel, Social Intelligence: The New Science of Human Relationships, New York: Bantam, 2006.

76

Brian Boyd

Hurford, James R., The Origins of Meaning: Language in the Light of Evolution, Oxford: Oxford UP, 2007. Knight, Chris, “Ritual/speech coevolution: a solution to the problem of deception,” in: Approaches to the Evolution of Language, ed. by James R. Hurford, Michael StuddertKennedy, and Chris Knight, Cambridge: Cambridge UP, 1998, pp. 68–91. Levin, Richard, New Readings vs. Old Plays: Recent Trends in the Reinterpretation of English Renaissance Drama, Chicago: University of Chicago Press, 1979. Premack, D. / A. J. Premack, Original Intelligence: Unlocking the Mystery of Who We Are, New York: McGraw-Hill, 2003. Schacter, D. L. / D. R. Addis / R. L. Buckner, “Episodic simulation of future events: Concepts, data, and applications,” in: Annals of the New York Academy of Sciences 1124 (2008), pp. 39–60. Sperber, D. / D. Wilson, Relevance: Communication and Cognition, Oxford: Blackwell, 1988 (21996). Stephens, D. W. / J. S. Brown / R. C. Ydenberg, Foraging: Behavior and Ecology, Chicago: University of Chicago Press, 2007. Seuss Geisel, Theodor, Horton Hears a Who! New York: Collins, 1998. Tomasello, M. / M. Carpenter / J. Call / T. Behne / H. Moll, “Understanding and Sharing Intentions: The Origins of Cultural Cognition,” in: Behavioral and Brain Sciences 28 (2005), pp. 675–735. van Hooff, Jan A.R.A.M. / Signe Preuschoft, “Laughter and Smiling: The Intertwining of Nature and Culture,” in: Animal Social Complexity: Intelligence, Culture, and Individualized Societies, ed. by Frans B.M. de Waal and Peter L. Tyack, Cambridge, MA: Harvard UP, 2003, pp. 260–287. Wilson, D. S. / E. O. Wilson, “Rethinking the Theoretical Foundation of Sociobiology,” in: Quarterly Review of Biology 82 (2007), pp. 327–348.

Storytelling from the Perspective of Evolutionary Theory

77

Storytelling from the Perspective of Evolutionary Theory* Carsten Gansel

In Heinrich Heine’s travel account “The North Sea” (1826/27), a lady asks: “Doktor, was halten Sie von Goethe?” [Doctor, what do you think of Goethe?]. The heterodiegetic narrator comments on this as follows: Die Dame hatte, ohne es zu wissen, die allerschlauste Frage getan. Man kann ja einen Mann nicht geradezu fragen: was denkst du von Himmel und Erde? Was sind deine Ansichten über Menschen und Menschenleben? Bist du ein vernünftiges Geschöpf oder ein dummer Teufel? Diese delikaten Fragen liegen alle in den unverfänglichen Worten: Was halten Sie von Goethe? (Heine 1976, p. 220) [Without knowing it, the lady had asked the cleverest question. One cannot ask someone directly: What do you think of heaven and earth? What is your opinion on human beings and human life? Are you a sensible creature or an idiot? Such delicate questions are subtly implied in the innocuous words: What do you think of Goethe? (transl. C. H.)]

It was Karl Eibl who pointed out to me this passage in Heine and who, in a contribution on aspects of canonisation, argued that questions starting in “What do you think of ...?” open up opportunities for mutual recognition. They allow, when referred, for instance, to celebrities, artists, poets, politicians or specific topics, insight into someone’s personal taste, concept of literature or political standpoint, etc. (cf. Eibl 1998, p. 64). Any answer to such a question has symbolic value, enabling a quick characterisation of the dialogue partner as well as his or her social background, affinity to certain groups or parties and personal values. If, within literary studies, we asked “What do you think of evolutionary psychology?”, we would probably, even today, be confronted with a whole range of different answers. When Eibl, in his 1991 Munich inaugural lecture, sketched the concept of a “biological theory of literature and culture”, a “young colleague, normally known to be smart” distanced herself from this idea by stating “He must be making fun of us” (cf. Eibl 2004, p. 401, transl. C. H.). Such loud criticism of using approaches in the humanities that are based on the concepts and findings of evolutionary *

Translation by Christine Henschel. Where no published English translation was available, quotations in German have been translated into English. Quotations from narrative texts used as objects of discussion are presented both in German and in English translation (marked with “transl. C. H.”).

78

Carsten Gansel

biology can still be found in the 21st century (cf. Scheunpflug 2001; Sommer 1992; 2000; Treml 2002; Voland 2000). In his review of Eibl’s Animal Poeta of 2004, Oliver Jahraus (2005) stated, quite rightly, that “the situation for such an endeavour does not seem to have become any easier” (transl. C. H.).1 In the meantime, however, a certain change can be felt, possibly a new “turn”. The Congress on German Studies (Germanistentag) in Marburg in 2007 was dedicated to “Nature – Culture”, Freie Universität Berlin has launched a research cluster on “Languages of Emotion” and there are, today, more and more transdisciplinary research projects taking up the findings of the human sciences. At the same time, “cognitive literary studies” has established itself as a new branch of research. Like evolutionary biology, evolutionary aesthetics and biopoetics, it has its roots mainly in US American research. Let us not ignore the interests of research policy which also considerably promote this new trend. Peter Stockwell sees the attractiveness of cognitive poetics in its potential: [...] to make the discipline and the institution of literature more accessible and more connected with the world outside university and college life. It is all about reading literature, and it represents nothing less than the democratisation of literary study, and a new science of literature and reading. (Stockwell 2002, p. 11; cf. Zymner 2007)

And indeed, a discipline like literary studies can only benefit from its readiness to open up for new approaches, reflect findings from other disciplines, potentially using them for its own research, and, finally, establish a closer contact with groups normally considered the “average readers”. As early as 1991, at the Congress on German Studies in Augsburg, Siegfried J. Schmidt underlined the importance and relevance of public interests as well as shrinking resources, financial matters and “fights over distribution” (“Verteilungskämpfe”). “Our society of today”, he said, “will only pay for something that is, in fact, needed”, and “many providers contest for a scarce good” (cf. Schmidt 1993, p. 16, transl. C. H.). We all know what problems and conflicts of interest there are within today’s scientific community, even if most of these fights do not take place on the public stage. However, it should by now be undisputed that literary scholars were right to pick up theories and approaches suggested by Eibl (1991; 1995; 2004; 2009a), Winfried Menninghaus (2003) or Peter M. Hejl (2001). In the following, I would like to briefly reconsider some important approaches, given that we are still faced with differing views on the relation between nature and culture in general as well as, more specifically, the role of storytelling within human evolution. Subsequently, I would like to present my own approach. I will try to show to what 1

Parts of this present essay stem from a project funded by the state of Hessen, “Literatur und Evolution” (Center for Media and Interactivity, Giessen University, 2003–2005). Some of the results were presented at the 6th MVE conference in Osnabrück (2005).

Storytelling from the Perspective of Evolutionary Theory

79

extent biological evolution is linked with the social evolution of communication and analyse this mutual relation by looking at storytelling as one aspect of human evolution.

I. Evolution and Literary Studies In the 1970s, the establishment of the then so-called “socio-biology”, through E. O. Wilson’s Sociobiology (1975) and Richard Dawkins’ The Selfish Gene (1976), brought about a paradigmatic shift. Scholars turned their backs on the idea of “Artwohl” (welfare of species), advocated by Konrad Lorenz, and adopted the concept of genetic fitness. Nowadays, there are numerous disciplines that take on approaches of evolutionary psychology in order to improve and sharpen their own analytical and methodical tools. It was the differentiation of socio-biology into evolutionary psychology from the early 1990s (cf. Cosmides and Tooby 1992; Barkow 2001), in particular, that made findings available and useful for a number of disciplines in the German academic landscape. Among these disciplines are philosophy and epistemology (cf. Voland and Voland 1999; Voland 2001; Vollmer 1995; 2001), ethics (cf. Bayertz 1993), linguistics (cf. Dunbar 1996; 2000; Pinker 1998; 2003; Bierwisch 2000) and educational sciences (Scheunpflug 2001; Treml 2002). Today, a growing interest in questions related to evolutionary psychology makes itself felt in literary studies as well, reflected in the number of recent monographs (e.g., Menninghaus 2003; Eibl 2004) and collected volumes (Zymner and Engel 2004; Klein et al. 2006; Huber and Winko 2009) dealing with such topics.2 Scholars seem to increasingly accept the idea that it is important to take into account both the biological and the cultural roots (“bio-kulturelle Zweistämmigkeit”) of the human being, making it necessary to look at the “biological disposition” as well as the “cultural definition” (cf. Zymner 2004, p. 14). Within the framework of cultural studies, Martin Huber and Gerhard Lauer have pointed out that, when aiming to shape the relation between text and context, we should approach the problem in ways that “take into account the cultural and biological roots of man” (cf. Huber and Lauer 2000, p. 6, transl. C. H.). As I will argue here, making use of theories stemming from evolutionary psychology does not mean that we speak of “biological determinism” or that we question the importance of interaction for social behaviour. What we aim for is a transdisciplinary approach that will avoid any form of “split of the two cultures (sciences and humanities)” (cf. Weigel 2002, p. 89, transl. C. H.). In this respect, we are inclined to assume that there are universal mechanisms behind the variables of human behaviour: “All human beings are alike, and all human beings are different” (cf. Willems 2001, p. 195, 2

The inspiring volume by Huber and Winko 2009 could not be taken into consideration in this essay. Zymner 2009 was consulted in the digital version.

80

Carsten Gansel

transl. C. H.). In the perspective of evolutionary psychology, every human being is born with a specific “set of features” which determine his behaviour. It is of special interest to find out which mechanisms are originally manifest and universal and which ones are the result of social interaction and individual development.3 When faced with characteristics or features that can universally be found across the species, we have to wonder whether such features are biologically evolved or if they represent no more than a random biological by-product with no specific function. We will have to assume that features are biologically evolved whenever they constitute a direct or indirect fitness advantage. The question of whether we are dealing with a result of adaptation or rather with a non-functional by-product concerns literature and the other arts, as well. Joseph Carroll has described the three main “front lines” as follows: a) positions that assume that the arts have developed together with cognitive capicities in general and have no adaptive function; b) theories that consider the arts as indirectly adaptive and the production and reception of art as side-effects of an adaptive process; c) concepts according to which the arts used to have an adaptive function (cf. Carroll 2007, p. 640). There are, however, a number of theories which alternate between the three positions described by Carroll. Brian Boyd, for instance, distinguishes between natural and sexual adaptation and describes, on the basis of this scheme, three different approaches: a) art as adaptation, b) art as a by-product of adaptation, c) art as a product of sexual selection (cf. Boyd 2005; 2009). Furthermore, we have to mention the hypothesis that art is a signal in terms of the handicap principle.4 This theory considers art production an activity which helps to maximise fitness insofar as it represents, in a biological sense, a waste of resources (time, energy). Whoever can allow himself to waste resources in this way, thereby illustrates the quality of his genes, draws attention to himself, increases his prestige and achieves better reproductive opportunities for himself.5

3

4 5

P. M. Hejl (cf. 2001, p. 50) distinguishes three types of universals: a) universals of individualisation / on the individual level: repertoire of manipulating behaviour through deceit, lies, the formation of coalitions, etc. The deception and manipulation of group members is intended to produce advantages for the deceiver / manipulator which often compensate differences in status and power; b) universals for solving recurrent social problems in situations of direct interaction (microsocial level): all verbal and non-verbal communicative universals; c) sociofunctional universals (macrosocial level). For the handicap principle, see section IX of this essay. See Miller 1999 and Mithen 2003. Without a doubt, specific forms of art can lead to a privileging of the artist and provide him / her fitness advantages (this seems to be the case with rockstars who are hysterically admired by young girls and women). The handicap principle completely abstracts from the contents of arts. Historically, it refers to a situation which is already in line with modern developments of art.

Storytelling from the Perspective of Evolutionary Theory

81

Generally speaking, there are two concepts in particular which have been discussed extensively: a) art as adaptation, b) art as a by-product of adaptation. In the context of these two positions, it makes sense to look for poetogenic structures and analyse questions concerning the “biological and cultural evolution” (cf. Zymner 2004) of literature. According to Rüdiger Zymner, the following approaches can be of interest to literary studies: From the perspective of evolutionary theory, we firstly have to ask what the specific characteristics of storytelling are in literature and art. In the end, we are faced with the question of how, why and for what storytelling is a part of human nature (cf. p. 17). Such attempts belong to the field of anthropological narratology (ibid.). In the framework of biological and cultural evolution, secondly, scholars analyse the genesis of genres, i.e., the development of prose, poetry and drama. Among other things, scholars have discussed the role of games and playing in evolutionary perspective (cf. Eibl 2009b; Lauer 2009; Mellmann 2009). Based on such analyses, scholars thirdly discuss to what extent games – no matter if hide-and-seek, football or stage plays (drama) – cause pleasure. Eibl has come up with a name for this organisational mode, stressing the “independent motivation”: “pleasure mode”. This pleasure mode has, on the one hand, the adaptive function of learning through play, and serves, on the other, as a means of stress reduction (cf. Eibl 2004, p. 40). All the above-mentioned research approaches are essentially characterised by their common focus on action, on the activity of producing art and its reception. Art is described, in a broader sense, as a “human universal”, and “art production” is considered an adaptive feature of human nature. In an ethological perspective (cf. Carroll 1995; 2007; Dissanayake 2000; 2001), art or “art production” are thus conceptualised as a type of behaviour that is always aimed at “making something special”. At all times and in all places, art will have turned “ordinary experiences” with mundane materials, objects, movements, sounds or words into something extraordinary (cf. Dissanayake 2001, p. 217). In that respect, art defamiliarises or transcends the ordinary, mundane or common. Human dance takes up “normal” and ordinary movements of the body, repeating them in an exaggerated manner and shaping certain “patterns of movement”. Literature aims to formalise “normal” speech, put it into rhymes and make it seem special and elaborate, for instance by means of assonances or alliterations. The ethological perspective leads to concepts that understand art as a “human problem-solving activity” and define the poetic texts as a “hypercoherent text”. Such texts are not only particularly useful for a fairly invariant transmission of knowledge and ideologies, their specific form also serves to capture the audiences’ attention (cf. Eibl 1991, p. 363). In order to produce such a “highlighted text” which differs from the ordinary by means of its “hypercoherence”, (aesthetic) actions of emphasising, repeating, exag-

82

Carsten Gansel

gerating, pattern-shaping and formalising, elaboration and surprise will be necessary. Looking at this method of “turning-something-into-somethingspecial”, Dissanayake sees an adaptive strategy at play which can be considered a “universal feature” of human nature. It is adaptive, because the early human reacted to insecurities by means of stereotypical, repetitive, schematised and exaggerated actions, thus reinforcing collective acts of execution and gaining “survival advantages” over those groups who acted in an isolated manner. We may assume that, initially in evolution, special attention would not have been paid to ordinary phenomena, conditions and ways of behaving, but to those that were considered particularly important and unpredictable. Similarly to religious rituals, art production could thus be understood as a “cultural behaviour” that served as a means of reacting to situations of insecurity, threat and fear.6 According to the adaptationist view, cultural practices were mainly concerned with biologically important things, e.g., how to grow up properly, how to make a living, how to raise one’s children, how to stabilise social contacts (cf. Dissanayake 2001, p. 222).7 It is, however, problematic, to interpret as “art production” all forms in which the early human dealt with and appropriated reality, and to characterise all results thereof as “art”. In my opinion, for instance, it is incorrect to regard cave paintings or myths as products of human artistry. As Niklas Luhmann rightly pointed out, objects that we consider to be art and exhibit in museums today will probably have been produced for very different purposes in ancient societies. This seems to have been the case with forms of religious symbolisations, for instance (cf. Luhmann 1995b, p. 226). I suggest that for the early human, myths as well as mythical and archaic thinking altogether constituted a possibility to understand himself and the world surrounding him. We are here concerned with a form of appropriation of reality which is mainly aimed at recognising objects and at gaining insight. Archaic thinking is characterised by a high level of emotional sensibility and responsiveness as well as the important role of vivid images. The early human tried to interpret repeatable events, but also anything new, unexpected and overwhelming, by drawing analogies to things he already knew. The “pressure of making decisions” and the insecurities this entails made it necessary to work out cognitive strategies which helped to release fears, take influence and “predict future events which are not yet discernable” (cf. Klix 1985, p. 153, transl. C. H.) on the basis of observable characteristics. In this way, homo sapiens learned to systematically observe spatio-temporal correlations and their mutual causalities. He developed the ability to draw analogies 6 7

See the recent essay by Voland (2007), who argues that religiosity is an adaptive feature of human nature. For the same reason, images of adolescence, for example, have played a central role from the early days of the arts. For the connection between biological and social factors, see Gansel 2011.

Storytelling from the Perspective of Evolutionary Theory

83

on the basis of similarities, and – as seems particularly important in our context – tested whether future events can be enforced or prevented by symbolically anticipating them. This strategy of thought is of particular importance for myths, because here we see convictions being formed on the basis of beliefs, which put into perspective fears and insecurities. These might have been the beginnings of magical rituals and enchantments: “The power of magic stems from the belief in the power of thoughts and words, in the causal potential of ideas” (p. 170, transl. C. H.). Even the early human realised that, in order to be communicated, thoughts have to be made perceptible by the senses. In this context, cultic actions, rituals and paintings emerged as signs. These signs (depictions) represented objects, e.g., the mammoth or bison. They are symbols which, as signs, create reality and can thus, in the broadest sense, be understood as a precursor of art. The sign becomes a “representative of reality and a materialised thought. In the beginning, these two are the same” (p. 172, transl. C. H.). At this stage, however, differently from artists, the producers of signs are not yet aware of the difference between sign and object. Myths were not, as it might seem today, merely narrated stories that contained numerous “fantastic” elements, but were, in fact, “lived reality”.

II. Innate or Acquired? When we try to adopt findings from other academic disciplines and use them in the context of literary studies, we run the risk of merely adding things, since, most of the time, literary scholars will not be able to thoroughly assess and evaluate findings from the human sciences.8 In this specific case, our first task is to take note of selected findings of cognitive and neuroscience. We shall then discuss how fruitful they can prove for literary studies, e.g., enabling a more differentiated view of literature, its characteristics and evolution. For this purpose, I would like to briefly outline the basic ideas of Darwin’s evolutionary theory. Species are alterable, according to Darwin, and there are variations (random genetic mutations) within the individual species. These variations / modifications can be passed on genetically to the offspring. Natural and sexual selection determines which modifications will persist and which ones occur only temporarily. As individuals are in a constant competitive struggle for resources, only those organisms that are adapted to their habitat in the best possible way will survive. In the framework of evolution, adaptation means that a specific characteristic / trait is of selective advantage and can appear in all individuals of the species. The individuals carrying this trait are in a better position to survive and produce offspring. To put it anoth8

Zymner 2007 likewise draws attention to this problem.

84

Carsten Gansel

er way, only those that are adapted in the best possible way to their living conditions will survive the struggle for survival (“survival of the fittest”). They succeed in passing on their genetic characteristics to their offspring. Such changes happen gradually and slowly, i.e., only after numerous generations will changes become apparent. Eventually they can lead to the emergence of (new) species.9 The question that arises from this, what is “innate” and what is acquired, is essentially concerned with the relation between nature and culture. Evolutionary biologists hold the opinion that the tendency to play off genes against environment is inaccurate or at least hasty. Nonetheless, evolutionary biology aims for a “genetic theory of behaviour” (Voland 2000, p. 13, transl. C. H.). This does not mean that, as some claim, violence is genetically determined and hereditary or that it is caused by socialisation only. What we are dealing with is instead the interplay of both elements. Thus, evolutionary biology speaks of a predefined genetic set and a specific environmental context in which the development of an individual takes place: “Genetically identical individuals can develop very differently in different environments, while at the same time genetically very different individuals can develop similarly in the same environment” (ibid., transl. C. H.). William F. Allman has described the specific characteristics of the development of homo sapiens sapiens, tracing how the human being as a perceptive, rational, planning and emotional species diverged from primates and other animals in the course of evolution. The human being is the epitome of the “socially acting primate”, capable of complex forms of interaction (cf. Allman 1999, pp. 15, 65, transl. C. H.). Dealing with the questions of how and why the human being thinks and acts in a special way, the human sciences have, in recent years, gained new insight into the performance of the brain. A new theory says that it was neither upright walking nor the production and use of tools that brought about the “cerebral explosion”. Their “complex social life” (Dunbar 2000, p. 81) is considered the most important aspect in the lives of primates (cf. Byrne and Whiten 1988). Within their social groups, individuals are concerned with alliances, feuds, partner selection, hierarchical structures, competition, deceit and cooperation. In other words, the difficulties of building complex social relationships issued great challenges to our ancestors’ brains, which could only be met by means of communication. And this was facilitated by evolution. We may assume that early communication was mainly concerned with recurring actions and events. Over time, evolutionary processes of selection have thus “programmed” the human mind to solve specific recurring problems, fundamental for survival. 9

See the concise description in Schwender 2001 (pp. 8f.). See also Buss 2004; Dawkins 2004; Voland 2000; Mayr 2001; Wuketis 1997.

Storytelling from the Perspective of Evolutionary Theory

85

III. Evolution and Co-Evolution of Consciousness and Communication I believe that when talking about the role that communication played in the evolution of a complex social life, the biological concept of evolution can only be of very limited use. This is one of the reasons why Luhmann (1998), oriented to the biological theory of evolution, tailored his theory to the evolution of society. In the development process of social communities, it is not competition that played the central role, but the co-evolution of consciousness and communication. In this context, Luhmann discusses the question of how consciousness and communication, two separate autopoietic systems, are linked with each other. Convinced that consciousness and communication only exist because of structural coupling, he assumes that there must have been some sort of coordination which led to more complex structures both in the contents of consciousness and social communication, because it referred to different forms of autopoiesis (cf. Luhmann 2004, p. 122). According to Luhmann, language is one such “coupling mechanism” in the co-evolution of consciousness and communication (pp. 123ff.). Language enables the joint development of consciousness and communication. Language provides effective structures for communication which turn into conventions. In this sense, language is important in Luhmann’s systems theory as a medium of structural coupling (cf. Gansel 2008b, p. 11). It is by means of language that we establish relations with others, reflect our beliefs and generate sense. Structual coupling by means of language is initially based on the development of simple patterns. These can consist in constructions for things we perceive that attract attention, i.e., in the context of hunting: “hey you” or “there mammoth” or “hunt mammoth”. When these patterns are used over and over again, variations will occur and more complex and effective linguistic structures will evolve. These highly complex combinations will, in return, affect processes of consciousness and communication (cf. Luhmann 2004, p. 123), and this illustrates the co-evolution of the cognitive and communicative functions of language (cf. pp. 122ff.). Simply speaking, we could say that consciousness and communication developed in an evolutionary process, together with language. We may assume that homo sapiens was subjected to linguistic sound structures he was unable to ignore. He perceived the utterances of his conspecifics and reacted to them. In this sense, communication is an incessant process. Consciousness as an autopoietic system as well as social communicative systems (group, family, couple) are constantly stimulated through structural coupling and “bombarded” with disturbances which have to be processed within the system (i.e., in the brain) and lead to the establishment of new structural selections. At this point, literary scholars who wish to apply methods and theories from the cognitive sciences will be faced with sev-

86

Carsten Gansel

eral unanswered questions. In what follows, I would like to discuss some of them in the context of storytelling.

IV. Storytelling and the Co-Evolution of Consciousness and Communication On the following pages, we will look at the co-evolution of consciousness and communication in the context of storytelling. In order to do so, we must firstly ask whether the traditional transport model of communication (author – text – reader), which is also employed in literary studies, will be of any use here. In my opinion, the co-evolution of consciousness and communication cannot be represented by the concept of a sender transmitting a message to a receiver, with the aid of a code. After all, the “sender” and “receiver” we want to look at, as well as the early linguistic code and messages from a faraway past, are no longer available as objects of observation. All we can try to deduce, on the basis of interdisciplinary research carried out by the human sciences, is the evolutionary mechanism. For this reason, I consider it useful to draw on Luhmann’s concept of communication. Luhmann states that communication is always a selective process, because sense makes us choose. Communication always focuses on some facts while neglecting others. In that sense, Luhmann defined communication as the processing of selection (cf. Luhmann 1987, p. 196). This embraces a threefold processing of selection. Communication as an “emergent event” (ibid.) comprises the synthesis of a threefold selection of information (what is to be said?), message (how shall something be said by A, in which linguistic form?) and understanding (including potential misunderstanding by B). The understanding or misunderstanding forms the basis of subsequent behaviour or subsequent communication, i.e., once again, the processing of the threefold selection of information, message and understanding. Communication, in this sense, is “only possible as a self-referential process” (p. 198, transl. C. H.). Luhmann states that a message has to duplicate the information by sending it to the outside world on the one hand and using it for communication, giving it an adequate linguistic form on the other. From a sociological perspective, it is important to note that this leads to a differentiation of communicative processes. Encoded and unencoded events have to be distinguished. In the communicative process, encoded events appear as information, while unencoded events are perceived as disturbances (noise) (cf. p. 197). Such encoding as operative standardisation has to be handled in the same way by A and B (ibid.). In relation to storytelling we can deduce the following from Luhmann’s theory: Storytelling makes sense only when the communicator (A) and the receiver (B) share some kind of standardised encoding of events, so that the one who is told something can get an idea of what has happened. Something as

Storytelling from the Perspective of Evolutionary Theory

87

simple as the phrase “A hunted the mammoth” requires, on the side of the listener / receiver, the ability to visualise a mammoth and imagine the specific situation of the hunter. Talking about the co-evolution of consciousness and communication, we should not immediately concern ourselves with language and communication, but first look at the cognitive structures which developed in the course of this co-evolution. Cognitive linguistic research on semantics and text understanding describes cognitive structures with different concepts. The so-called type concepts, which embrace object concepts, event concepts and series-of-events concepts, are relevant for storytelling. These concepts can be described as follows, according to their level of complexity (cf. Klix 1994; Barsalou 1992): (a) Object concepts refer to a classification of objects on the basis of distinct characteristics. They are also referred to as “primary notions” (e.g., tree, bird, house, fur) (cf. van der Meer 1993, p. 377). (b) Event concepts classify events. Categories of situations, relationships between the subject of an event and objects in space and time that are affected by this event, are grouped together (e.g., eat, kill, collect, court a partner). One could say that the events described here configure by answering the following questions: Who? What? When? Where? How? (c) Series-of-events concepts or logical sequences of events (e.g., hunt, wedding, building a dwelling) refer to targeted activities which form a chain of events. They can be understood as the combination of event concepts of similar degrees of abstraction by means of different types of relation (causality, finality, time, etc.) (cf. van der Meer 1993, p. 378).

Such recurrent concepts (frames) are incorporated in basic plots or plot structures of narrating, they are verbalised and constitute the basis for the “strategy of textualisation” that we call “storytelling”. Storytelling means narration, which in linguistics is regarded a basic form of text (cf. Eroms 2008, p. 80), motivated by “basic constellations of perceptual psychology” (ibid., transl. C. H.). While narrating, the communicator, A, wants to describe his perceptions in chronological order. The strategy of textualisation directs the selection of linguistic forms “on a high level of abstraction” (p. 107, transl. C. H.).10 When looking at the communicative situation of early man, we must assume that communication was initially geared towards basic needs of human existence. In a longer historical process, storytelling evolved as a preferred strategy of textualisation. Werner Eroms describes the archetypical character of narrating, intended to “communicate facts from the past” 10 When trying to determine the characteristics of storytelling, numerous studies in narratology and evolutionary psychology refer to hypotheses brought forward by William Labov and Joshua Waletzky. They argued that the simplest and most fundamental narrative structures can be found in oral versions of personal experience rather than in the elaborate products of trained storytellers (cf. Labov and Waletzky 1973, p. 78).

88

Carsten Gansel

(Eroms 2008, p. 82, transl. C. H.). In narration, “events from the past” are “transferred into a present discursive situation”. Eroms considers “the event” as the basic unit of strorytelling. The “event from the past” “can be real or fictitious, though the verisimilitude has to be verifiable by the narrative chaining of events” (p. 86, transl. C. H.). Heiko Hausendorf, similarly, regards a narration “a verbal reconstruction (in the shape of a discursive unit) of a series of real or fictitious actions or events, which at the time of narrating lie in the past or are at least described as lying in the past” (Hausendorf 2000, p. 373, transl. C. H.). Without exception, the “event” is characterised everywhere as the central category for storytelling. The events are reconstructed in the order in which they occurred, which is why they are generally put in perspective and presented in chronological order (cf. Eroms 2008, p. 88). Wherever storytelling is described and defined, the aspect of reconstruction is underlined as much as the fact that storytelling is about communicating experiences and shaping memories (cf. Eibl 2004, p. 259).11 From the perspective of evolutionary psychology, Eckart Voland has associated storytelling with a special feature of the human mind, the “cognitive imperative”. The “cognitive imperative” forces man to shape a “plausible, coherent replica of the events in his world, without any explanatory gaps or irrational flaws. It seems that man does not cope well with inconsistencies, irrationality and causal incertitude, because what he does not understand worries him” (Voland 2007, p. 296, transl. C. H.). For this reason, the brain is a “permanently active story generator”. Stories provide “plausible explanations for all those things which would not be understood without them” (ibid., transl. C. H.). Thus, coherence is established as an intrinsic feature of storytelling. When speaking of a “permanently active story generator”, we must be able to detect, beneath universal plots, basic structures of (fictional) stories. Scholars agree that event and action have to be regarded as those basic constituents of stories. Actions are labelled with verbs (core of the action). Active characters assume the role of agents. Finally, the action modifies an object (object of action) or creates something new (result of an action). Actions take place under specific circumstances, they can be shaped by time, place, mode and specific reasons. The smallest unit of action is, as we have already said, the event. The phrase “Andrej Andrejewitsch Mjasow bought [...] a wick.” represents such an event. An event is composed of the core of the action (predicate) and the agent (subject). Several events form a series of events (“Andrej Andrejewitsch Mjasow bought [...] a wick and took it 11 This is where narratology, sociolinguistics, neurophysiology, evolutionary psychology, cognitive literary studies and collective memory research meet. Generally speaking, memories cannot produce realistic images of the past. They can re-construct the past only partially, incompletely, sometimes in a deformed manner. Our view of the past is always determined by the current situation from which we look at and remember it.

Storytelling from the Perspective of Evolutionary Theory

89

home”). The action alone (i.e., several events strung together) does form a series of events, but not yet a story. Only when the different events are put in relation to each other is a story shaped. In narratology, scholars often refer to the example suggested by E. M. Forster (1927), discussing two versions: Version 1: The King died. And then the Queen died. Version 2: The King died. And then the Queen died from grief. While version 1 only presents a sequence of events, but no story, version 2 does constitute a story, because both events are put in a causal relationship.12 Every story has a starting point (“beginning of text”) and an endpoint (“end of text”). The events between these two poles take place in a certain “time” (or “times”) and in a certain “place” (or several “places”). One speaks of “plot” only if the background of the events and the relationships between the individual characters are clearly outlined and elaborated.

V. Narratology and Categories of Storytelling Storytelling is at the centre of the “science of narration”, narratology. Narratology deals with all those forms of communication and cultural manifestation that can be regarded as “stories” or that contain such “stories” (cf. Schönert 2006, p. 1). Thus, it is of particular interest to all those disciplines that are concerned with narratively organised texts. These are, above all, the philologies, but also religious studies, history, cognitive sciences and certain sub-disciplines of law. We have underlined before that, due to recent findings of neurophysiology, there is today a closer connection between the humanities and human sciences. Narratology picks up the very same constituents that we have discussed in the context of type concepts, i.e., action, agent (character), event, space. These elements are gathered, on a primary level, within the category of “histoire” or “story”. One could ask: “What is being told?”13 The second level refers to the narrative communication, the “discours”, and the pertaining question would be “How is it told?”. This concerns a) the temporal organisation (order, duration, frequence of narrating), b) perspective (degree of narrative mediation, point of view / focalisation) and, finally, c) the voice (e.g., narrator’s attitude towards the events, level of narration). Taking a closer look at the two central elements on the story level, i.e., character and space, we see that the narrator / writer of fictional stories makes 12 A third, more elaborate, version could look like this: The King died. When the Queen saw that even the doctor’s miracle cures had not helped, she felt desperate and would no longer eat a thing (cf. Gansel et al. 2004, p. 265). 13 This basic inventory of narrative analysis is described in several introductions to narratology, e.g., Chatman 1978, Genette 1998, Martínez and Scheffel 1999, Wenzel 2004.

90

Carsten Gansel

use of the human ability of visualising a person or a place, empathising with someone, making use of one’s own experiences, imitating something. Thinking in somebody’s shoes and having empathy enables the listeners and readers to feel connected to the characters and their actions and identify themselves with or distance themselves from them. No matter how scarce and rough the description, the characters’ outward appearance enables the listener or reader to draw conclusions about their social rank, character and environment, and serves as a basis for identification, as the following examples illustrate:14 Example 1: Man nannte ihn Cornel, und das heißt Colonel, also Oberst. Dieser Mann war lang und hager; sein glattrasiertes, scharf gezeichnetes Gesicht wurde von einem borstigen roten Kehlbart umrahmt; fuchsrot waren auch die kurzgeschorenen Kopfhaare, wie man sehen konnte, da er den alten, abgerissenen Filzhut weit in den Nacken geschoben hatte. Sein Anzug bestand aus schweren, nägelbeschlagenen Lederschuhen, Nankingbeinkleidern und einem kurzen Jacket von demselben Stoff. Eine Weste trug er nicht; an ihrer Stelle war ein ungeplättetes, schmutziges Hemd zu sehen, dessen breiter Kragen, ohne von einem Halstuch gehalten zu werden weit offenstand und die nackte, sonnenverbrannte Brust sehen ließ. Um die Hüften hatte er sich ein rotes Fransentuch geschlungen, aus dem die Griffe des Messers und zweier Pistolen blickten (May 1930, p. 5) [He was called Cornel, that is colonel. This man was tall and lean; his clean-shaven, chiselled face was framed by a bristly ginger goatee beard. One could see that his cropped hair was ginger, too, as he was wearing his old, scruffy bowler hat on the back of his head. He wore heavy, hobnailed leather shoes, nankeen trousers and a short jacket made of the same cloth. He did not wear a waistcoat but an unironed, dirty shirt instead, with a wide open collar, but no scarf, showing his naked, sunburnt chest. Around the waist, he wore a red, fringy cloth, from which were jutting out the butt of his knife and two pistols. (transl. C. H.)]

The introduction by a heterodiegetic narrator of the main protagonist in Karl May’s novel Der Schatz im Silbersee [Treasure of the Silver Lake] (1890/91) concentrates on his appearance and clothes, after highlighting his prominent social position by mentioning his military rank “Cornel, Colonel, Oberst”. The description of his outward appearance provides important information about the personal circumstances of this man as well as a possible character profile: tough life; no luxuries (food, habitation, clothes); practical, hardwearing, scruffy clothes (“ungeplättet”, “schmutzig”, i.e., unironed, dirty); much time spent outdoors; bellicose attitude (“Messer”, “zwei Pistolen”, i.e., knife, two pistols). As long as he has the necessary cultural knowledge, the reader will probably situate the colonel in the context of an adventure novel. Details of the given information like the “unironed, dirty shirt” might cause aversion 14 In the following, I will use two examples which were tried out in narratology classes in different countries and cultures (Germany, Poland, Russia, Canada, Cuba) and then incorporated in a school textbook, in a chapter for year 9 (cf. Gansel et al. 2004). See also Jannidis 2004.

Storytelling from the Perspective of Evolutionary Theory

91

to this character, should the reader draw on his own experience and aesthetic and moral expectations. By contrast, those features might also contribute to a positive assessment of the character, given that in combination with other traits like “nackte, sonnenverbrannte Brust” (i.e., naked, sunburnt chest), they might evoke an association with freedom, coolness and masculinity. In Margaret Mitchell’s Gone with the Wind (1936), the description of Scarlett O’Hara combines information on her outward appearance with references to her genealogical background: Example 2: Scarlett O’Hara was not beautiful, but men seldom realized it when caught by her charm as the Tarleton twins were. In her face were too sharply blended the delicate features of her mother, a Coast aristocrat of French descent, and the heavy ones of her florid Irish father. But it was an arresting face, pointed of chin, square of jaw. (Mitchell 1993, p. 5)

Here, similarly, a heterodiegetic narrator provides information about the character’s outward appearance, social rank and ancestry. Additionally, the reader is informed about her effect on other characters (“men [...] caught by her charm”). The reader’s empathy is, however, addressed on a higher social level, because aspects like partner selection and potential competition are brought into play, and thus culturally acquired practices of evaluation and behaviour (“delicate features of her mother, a Coast aristocrat of French descent, and the heavy ones of her florid Irish father”). From the point of view of evolutionary psychology, the character of Scarlett O’Hara has a higher “reproduction value” (age and exclusivity of reproduction). Such a chain of associations, however, requires of the reader a specific empirical knowledge, interpersonal experience and, possibly, his or her own personal strategies of partner selection. In literature courses, the ability to feel empathy and sympathy can be further developed by working with narrative texts. In particular, writing exercises that make the students work on the characters and re-interpret them, require a successful mental reflection of the characters. By means of individually-shaped type concepts (comprising object, event and series-of-events concepts), this enables mirror imaging and the conceptualisation of an alternative character. A) How have the authors / narrators characterised their characters? What kind of impression do these characters make on the reader? B) Change the traits of the characters, making use of specific attributes, adverbs, nouns, comparisons, etc., and creating a character that makes the reader a) identify with, b) hate or c) feel compassion for him/her. (cf. Gansel et al. 2004)

A character description successfully evoking c) compassion could look like this: Example 1 (evoking compassion): Man nannte ihn Cornel, und das heißt Colonel, also Oberst. Er war lang und un-

92

Carsten Gansel

glaublich hager; unter einer gelblichen Haut standen seine Knochen hervor. Sein ausgemergeltes Gesicht war von Entbehrungen und Krankheit gezeichnet. Er hielt sich nur mit Mühe aufrecht. [He was called Cornel, that is colonel. He was tall and incredibly lean; his bones were showing under his yellowish looking skin. His gaunt face was lined with deprivation and illness. He had great difficulty keeping himself upright. (transl. C. H.)]

The reader gets himself into an “as-if situation”, an experimental stage is designed for him, and he joins the play. We may assume that in such cases, human beings generally develop emotions and take up a perspective and standpoint, because we comprehend and assess events that we witness, on the basis of our own (emotional) experience, no matter if such events happen in real life or are conveyed to us in a literary text. Patrick Colm Hogan describes this as follows: This brings us, finally, to the source of emotion. In egocentric and interested cases, there is no source for the emotion outside the current situation. However, in empathic cases, the source of the emotion is external. The source itself is still egocentric or interested, even though the current situation does not have direct or indirect egocentric significance. (Hogan 2003, p. 70)

Hogan’s position is confirmed by neurological exams which indicate that the same cerebral areas are activated, no matter if a stimulus really exists or is only transmitted in fictional form. This is why Clemens Schwender and Katja Mellmann are right in calling the media “dummies of the mind” (cf. Schwender 2001) and literature “an emotional dummy” (cf. Mellmann 2006). Such functioning of the cerebral areas would imply that we reach a certain physiological condition (even tears) when watching or reading the tragic end of a film or text, independently of specific culturally transmitted values. To put it another way, trivial texts or films can potentially generate much stronger emotions than pieces of art that are supposedly of high aesthetic quality and part of the canon.

VI. Ontogenesis and Narrative Acquisition It is very likely that there are basic patterns for the structure of narratives and that narrations are acquired gradually. We can find examples of this in early cultures, the “simple forms” (André Jolles) or in children’s literature, specifically in so-called “texts for beginners”. The ontogenesis of narrative acquisition in children provides empirical insight into the different steps of the development from simpler to more complex forms of narration, as well as the co-evolution of consciousness and communication. In the German-speaking area, the empirical study carried out by Bouke et al. (1995) worked out fundamental parameters of narrative acquisition. The team from Bielefeld encouraged children from preschool age to year 4 (approximately ten years old) to orally narrate picture stories. Based on their observations, the scholars identi-

Storytelling from the Perspective of Evolutionary Theory

93

fied four levels of narrative acquisition. In their more recent study, Augst et al. (2007, 2010) have further specified these four levels, showing how and in which steps exactly children expand their abilities to develop a narrative (i.e., write a story) between school years 2 and 4 (ages 7 to 10) and year 5 to year 9 (ages 11 to 15). The children were shown a picture of a dwarf standing in front of the bricked-up entrance (to a cave), holding a burning candle in his hand. The task was: “On the basis of this picture, make up an interesting story and write it into your storybook.” Level 1 of narrative acquisition is characterised as follows: 1. Stufe: (Un)zusammenhängendes assoziatives erzählerisches Einzelnes; oft geschichtenübliches Repertoire; formelhafte sprachliche ‚geschichtenübliche‘ Wendungen; sehr oft Ich-Erzählungen als (außergewöhnliche) Alltagsgeschichten ohne sprachlichen Planbruch und ohne Pointe. (Augst et al. 2010, p. 65) [Level 1: Single (in)coherent, associative, narrative elements; often narrative standard repertoire; stereotyped linguistic expressions (following narrative standards); first-person narrations very common, as (extraordinary) everyday stories without linguistic disruption of plan or punchline. (transl. C. H.)]

The following narrative written by Dominic (about 10 years old, year 3) represents an example of Level 1: Das Bergwerk // Es war einmal / ein Bergwerk / es wurde vor / 80 Jahren / nicht mehr ben / utzt es lebte / ein Kobold in / der Höhle. // sie leben ohne Essen und Trinken. / auf einmal kam ein Monster / und auf einmal kam ein Kobold / raus, und das Monster sagte: „Ich besch / ütze eure Höhle“ (Augst et al. 2010, p. 66).15 [The mine // Once upon a time there was / a mine / it was / 80 years ago / no longer in u/se there was / a goblin living in the cave. // they are living without food and drink. / all of a sudden came a monster / and all of a sudden a goblin came / out, and the monster said: “I prot/ect your cave“ (transl. C. H.)]

Levels 2, 3 and 4 demonstrate that there is a gradual development of narrative competence. At Level 4, children have acquired the ability to make up a fictional story with a basic plot structure, containing the following elements: a) introduction, b) disruption of plan (i.e., extraordinary event), c) suspense, d) punchline, e) ending. We can observe a gradual transition from the more basic first-person event narrative to the third-person narrative (Levels 3 and 4), which requires of the children the ability to look beyond their own situation, join the play and transfer their own experience into a fictional setting. This is also reflected in the increasing use of the past tense. In some cases, the narrative was even given an “emotional qualification”, enabling the readers to identify with or distance themselves from the characters. According to Augst, the basis for such an “emotional involvement” lies in the creation of a so-called 15 Word spelling has been corrected; / = line break, // = paragraph.

94

Carsten Gansel

“Erzählton” (narrative tone). This “narrative tone” seems to be gradually acquired in the course of narrative ontogenesis. Differently from narratologists, linguistics does not use the category of “narrator”, and with his notion of “Erzählton”, Augst uses a term which mainly denotes elements on the discourse level, concerning the mode of narration (in this case, focalisation and voice). Let us quote an example of a successfully worked out “narrative tone”, in the following text written by Elena (about 12 years old, year 5):16 „Ich komme gleich“, ruft Kai, der gerade seinen Rucksack packt. Er geht heute mit seinen Freunden spielen und packt das Nötigste in seinen Rucksack. Er rennt die quietschende Treppe herunter. Im Flur riecht es nach Spagetti von heute Mittag. Seine Freunde, Tom und Jan, sind schon da. Sie gehen durch die Tür und blicken auf den riesigen Hof. Schnell rennen sie am Hundehäuschen vorbei raus auf die Straße. Jetzt müssen sie nur noch zweimal links abbiegen, dann kommen sie auf den Spielplatz und von dort können sie dann in den Wald. Bei einem umgefallenen Baum halten sie an. Tom will verstecken spielen. Die anderen sind einverstanden. Kai muss suchen; er zählt bis 50 und fängt an zu suchen. Die Zweige brechen unter seinen Füßen. Nach fünf Minuten ruft er laut: „Wo seid ihr?“ Er sucht immer weiter, aber niemand antwortet. Jetzt fängt es auch noch an zu regnen. Kai ist verzweifelt. Wo sind bloß seine Freunde? Plötzlich sieht er einen Felsen. „Vielleicht ist einer der beiden dahinter“, denkt er. Er geht einmal um den Felsen herum, aber niemand ist dort. Das Einzige, was er sieht, ist ein Loch. Es führt in einen Tunnel. „Vielleicht haben sie sich dort drinnen vor dem Regen versteckt“, spricht er vor sich hin. Er greift in seinen Rucksack und zieht mit einem Mal die Kerze und das Feuerzeug heraus, was er eingepackt hat, falls es dunkel wird. Er geht hinein. „Tom, Jan, seid ihr hier irgendwo?“ ruft er. Es riecht ziemlich muffig. Nach einer Weile kommt ein runder Raum. Eine Truhe steht darin. „Es ist wahrscheinlich ein Keller eines alten Hauses“, denkt er. Auf dem Weg durch den Gang hat Kai am Rand immer wieder kleinere Räume gesehen. Aber hier der Raum war der einzige, wo etwas darin steht: eine Truhe. Sie ist rot mit goldenen Verzierungen. Langsam geht er zur Truhe. Sie ist nicht verschlossen. Der Deckel ist schwer, aber Kai kann ihn hochheben. Es sind alte Kleider drin. Nichts besonderes, aber interessant. Er nimmt sich einen Hut mit, der sehr schön aussieht. Seine Kerze ist fast abgebrannt, er muss jetzt schnell hieraus. Er rennt den Tunnel entlang und geht raus. Kai geht nach Hause, seine Freunde hat er schon völlig vergessen. Als er zu Hause ist, sitzen die zwei mit Decken auf dem Sofa und trinken Kakao. „Wir sind zurückgekommen, als es angefangen hat zu regnen“, erklärt Jan; Kai setzt sich dazu und erzählt, was er erlebt hat. [“I’m coming in a second”, shouts Kai, who is currently packing his backpack. He is going to play with his friends today and is putting the most important things into his backpack. He runs down the squeaking stairs. The corridor still smells of the spaghetti they had for lunch today. His friends, Tom and Jan, are already there. They walk through the door and look out into the vast courtyard. They quickly run past 16 These examples stem from the essay Augst 2010. Here, the underlining marks those parts of the text which meet all requirements for a narrative, even if the narrator is not emotionally involved.

Storytelling from the Perspective of Evolutionary Theory

95

the dog house and onto the street. From here, they only need to turn left twice and they get to the playground, from where they can directly reach the forest. They stop by a fallen tree. Tom wants to play hide-and-seek. The others agree. Kai must seek, he counts up to 50 and begins to seek. Branches break under his feet. After five minutes, he shouts out loudly: “Where are you?” He keeps looking, but there is no answer. And now it even starts to rain. Kai is desperate. Where on earth are his friends? Suddenly, he spots a rock. “Maybe one of them is hiding behind that”, he thinks. He walks around the rock, but there is no-one there. The only thing he can see is a hole leading into a tunnel. “Maybe they have hidden in there from the rain”, he says to himself. He reaches into his backpack and takes out at once the candle and lighter that he has brought in case it gets dark. He walks into the tunnel. “Tom, Jan, are you here somewhere?” he shouts. It smells quite mouldy. After a while, he reaches a circular room. There is a trunk in there. “This is probably the cellar of an old house”, he thinks. On his way along the tunnel Kai has seen several smaller rooms, but this is the only one containing something: a trunk. It is red with golden ornaments. He slowsly walks up to the trunk. It is unlocked. The lid is heavy, but Kai manages to lift it. There are old clothes in there. Nothing special, but still interesting. He takes a hat for himself that looks very nice. His candle is almost completely burnt down, and he quickly has to get out of here. He runs along the tunnel and walks out. Kai returns home, he has totally forgotten about his friends. When he gets home, the two of them are sitting on the sofa with blankets, having a hot chocolate. “ We came back when it started to rain”, says Jan. Kai joins them and tells them what he has found. (transl. C. H.)]

Elena not only manages to put together all structural elements of a successful narrative, but also makes use of a narrative strategy that truly exalts the reader’s imagination. In order to do so, she starts her story abruptly, in medias res, with the introduction of her protagonist. She then sketches an (atmospheric) setting in which her characters (agents) act. There is a third-person narrator who knows the characters’ thoughts and feelings and comments on them. Elena also makes use of direct speech and inner monologues, which brings about changes in the narrative perspective. These elements, in fact, form the basis for an (emotional) involvement of the reader in the narrated world presented to him / her. We have looked at the ontogenesis of narrative acquisition between Levels 1 and 4, and they reveal striking parallels to the different levels of elaboration of the so-called “simple forms”. Let us take a look, for example, at the Children’s and Household Tales by the Brothers Grimm, opening with the fairy tale “The Frog Prince, or Iron Henry”. When comparing the beginnings of the original version (1810) and the definitive version (1837) of this tale, we notice great differences. Thanks to the extensive use of adjectives, comparisons, personifications, etc., the later version is much more vivid. This is how the Brothers Grimm managed to move their narrative, so to

96

Carsten Gansel

say, from Level 1 to Level 4, and create a “narrative tone”. The modifications mainly concern the narrative mode (focalisation and narrative voice).17

VII. Fictional Stories – Mirror Neurons – Theory of Mind Fictional stories and the steps that manifest themselves in the development of children’s narrative competence, underline that storytelling is basically about communicating experiences from the past. On this basis, a new experiment with corresponding parameters is opened up. This, however, is only possible because children in school year 2 (about 7 years of age) already have the ability to refresh and newly combine their own past actions or actions of others in a specific situation. Scholars assume that the so-called “mirror neurons” represent the decisive neuronal preconditions for this human ability. The discovery of these mirror neurons by a team of physiologists led by Giacomo Rizzolatti (1996; 2008) was a milestone not only in neurobiological research. Rizzolatti and his team found out that in the premotor cortex of monkeys, there are neurons which always respond to stimuli in the same way, no matter if the monkey itself performs an action or only watches another one perform it. What is special is that the motoric neurons that we refer to as “mirror neurons” do not perform any kind of “motoric reaction”. While monkey A watches monkey B take “its” nut and eat it, it “imitates” this situation deep inside, thus “mirroring” the motoric behaviour of his conspecific and showing the ability to “reproduce” it (cf. Remus, s.a.). For neurologist Vilayanur Ramachandran, mirror neurons make it possible to simulate the actions and intentions of others in a kind of “virtual reality”. This is exactly what happens when children receive an impulse for a fictional story which they then develop further themselves. Ramachandran states that the existence of mirror neurons would also explain why human beings are the only primates capable of developing a “theory of the minds of others” and predicting their behaviour, an ability that is indispensable for complex social interaction (cf. Ramachandran 2006, p. 52; cf. Lauer 2009). Mirror neurons are, finally, responsible for that which we call theory of mind. It comprises the ability of

17 The 1810 version merely has: “The King’s youngest daughter went out into the forest and sat down by a cool well. She then took a golden ball and played with it” (transl. C. H.). This is no more than an introduction of character, action and setting. The version of 1837 forms a proper “imaginative mindscape”: “Once upon a time, when wishing still helped, there lived a King whose daughters were all beautiful. But the youngest one was so beautiful that even the sun, despite having seen much, was surprised whenever it shone on her face. Close to the King’s palace, there was a great, dark forest, and in this forest, beneath an old limetree, there was a well. Whenever the day was very hot, the King’s child would go out into the forest and sit by the cool well, and when she was bored, she would take a golden ball, throw it up in the air and catch it, and this was her favourite toy” (transl. C. H.).

Storytelling from the Perspective of Evolutionary Theory

97

humans to empathise with other individuals and their state of mind, including potential actions, emotional conditions and personal convictions. Simon Baron-Cohen, who studied the connection between theory of mind and autism, stated that: “By theory of mind we mean being able to infer the full range of mental states (beliefs, desires, intentions, imaginations, emotions, etc.)” (Baron-Cohen 2000, p. 3). It is a “theory” because it is impossible to read the thoughts and emotions of others.18 If we imagine what would happen if human beings were unable to feel empathy, we fully understand the important role that a theory of mind plays for human culture. Autism is a medical condition that suppresses the normal development of this ability. Signs of autism can manifest themselves at a very young age. BaronCohen describes autism as follows: Autism is widely regarded to be the most severe of the childhood psychiatric conditions [...]. It is diagnosed on the basis of abnormal social development, abnormal communicative development, and the presence of narrow, restricted interests, and repetitive activity, along with limited imaginative ability [...]. Such children fail to become social, instead remaining on the periphery of any social group, and becoming absorbed in repetitive interests and activities, such as collecting unusual objects or facts. It is a tragedy for their families who work tirelessly to attempt to engage with and socialize their child, mostly with very limited results. (Baron-Cohen 1999, p. 3)

Children suffering from autism (less serious forms are referred to as “Asperger syndrome”) show little flexibility and are only able to imagine “as-if situations” to a very limited extent. Role plays which children normally undertake from the age of two, cannot usually be observed with autistic children. They will not “bake” cakes of sand either, imitate horse-riding with a stick in their hands or warn Punch, during a Punch-and-Judy-Show, that robbers are approaching him from behind. People with an autistic condition do not have much of an ability, if at all, to imitate, take someone else’s perspective and feel empathy, which makes them lack a central category for storytelling (cf. Lauer 2009). Such a mental deficit can open attractive possibilities in the context of a literary portrayal, because it enables a naive, alienating approach to reality, as Mark Haddon’s novel The Curious Incident of the Dog in the Night-Time (2003) has demonstrated. Haddon’s protagonist, the 15-year-old first-person narrator Christopher John Francis Boone, has, in fact, a condition within the autism spectrum. He lives with his father in the English town of Swindon and has some difficulties finding his bearings in the world. His mind cannot deal with things that do not actually exist. That is why he does not like novels: “In proper novels people say things like ‘I am veined with iron, with silver and with streaks of common mud. I cannot contract into the firm fist which those clench who do not depend on stimulus.’ What does this mean? I do not 18 This is the reason why, in science fiction novels, this ability is often mentioned and justified in numerous different ways.

98

Carsten Gansel

know.” (Haddon 2004, p. 5). Christopher is unable to tell a sad face from a happy face and thus cannot draw conclusions about feelings of others. He finds people confusing and this for two main reasons. The first is that people do a lot of talking without using any words. His friend Siobhan told him “that if you raise one eyebrow it can mean a lot of different things” (p. 19). The second main reason is that people often talk using metaphors. These are examples of metaphors: I laughed my socks off. He was the apple of her eye. They had a skeleton in the cupboard. We had a real pig of a day. The dog was stone dead. (ibid.)

Haddon’s protagonist corroborates the assumption that storytelling is an adaptive feature of biological and social evolution, developing, by means of a “third-level” theory of mind, the vision of how someone who does not really exist would react in a given situation (cf. Dunbar 2000, p. 132). These abilities are necessary for stories that require that author and reader understand the following matter in the same way [1]: figure A thinks [2] that figure B wants [3] that figure A believes a specific thing. Since author and reader are part of the chain of intentionalities, they have to go beyond what the figures of the novels really do (cf. p. 133).

VIII. Storytelling – Evolution – Basis Plots Having looked at the basic components of storytelling, their ontogenesis and the innate ability to use a theory of mind, we will now be able to discuss, on a higher level, the question of whether there are something like “innate epic patterns” (cf. Eibl 2004, p. 265, transl. C. H.) which help us structure our world. Eibl points out that “good stories” are very easy to retell (cf. Burkert 1998): “It looks like this basic structure represents something that is inherent to our mind or brain as a pattern, script or shape, waiting to be confirmed” (cf. Eibl 2004, p. 265, transl. C. H.). Those who are critical of representation theory might object to the explicit use of the term “represent”. In the context of the findings on mirror neurons, however, this does seem to make sense. From the evolutionary perspective, those patterns will have prevailed which proved to be particularly useful for dealing with numerous, culturally divergent situations (cf. p. 267). The openness of behavioural programmes made it possible that in the evolution of literature, a treasure, a grail, a princess became the goal and that, ultimately, it is all about the recurring pattern of finding solutions to a difficult task. If we wanted to list the basic plots here, some other ones have to be mentioned: Two individuals of the opposite sex want to get together, are hindered from doing so by various circumstances, but are, finally, happily united. This aspect is linked to the fight between two male ri-

Storytelling from the Perspective of Evolutionary Theory

99

vals. Ultimately, numerous literary texts deal with the revelation of the unknown. Referring to David Buss, Carroll has suggested, quite rightly, that the reader’s interest is greater the more the literary texts approach fundamental aspects of indirect fitness, i.e., deal with questions of survival and reproduction, including family connections. “Power and love”, says Buss, “emerge consistently and cross-culturally as the two most important dimensions of interpersonal behaviour” (Buss 1995, p. 21). Aiming to determine core plots of (fictional) stories, Carroll and Gottschall (2006) analysed the contents of 44 successful popular texts of 19th-century English literature and isolated 170 characters. They distinguished different motifs of action: It was all about a) survival, b) finding a partner, c) gaining economic prosperity, d) improving one’s social status, e) acquiring knowledge and education, f) helping one’s offspring, relatives and friends.19 Studies of this type investigate “traces of evolution”, discussing whether and how they are represented in selected plot structures. In other words, these studies are concerned with interpretations of literary texts from the perspectives of socio-biology and evolutionary psychology. Such interpretations can look at Homeric poems, stories from the Old Testament, Arthurian legends, folktales and fables, as well as texts from the Romantic era or literature of the 20th and 21st centuries. Still, they are limited to literature and are not applicable to other arts like painting or music. We also have to question whether such interpretations have any kind of additional value apart from identifying basic story plots.

IX. Handicap Principle and Literature – Hermann Hesse’s “Beneath the Wheel” In 2007, Carroll presented an inventory of publications on literature which base themselves on evolutionary psychology. There are not many studies making use of parameters from evolutionary psychology for the analysis of individual literary texts. Because of that, I would finally like to use the handicap principle (which has been much discussed concerning the role of art within evolution) for the interpretation of a well-known German literary text. The handicap principle is a hypothesis originally proposed by the Israeli zoologists Amotz and Avishag Zahavi. They assume that biological evolution can be divided into two different varieties, a) evolution of utility and b) evolution of signalling. While in the evolution of utility, all those features are furthered which constitute immediate fitness advantages, the selection of signals develops “extravagant” characteristics and modes of behaviour which, at first 19 See the profound analysis of children’s and youth literature in Schneider 2010. See also Johnson et al. 2008, who analysed 435 characters from 201 19th-century English novels, concerning their status awareness and dominance as well as forms of cooperative behaviour.

100

Carsten Gansel

sight, seem to be a sheer waste (cf. Zahavi and Zahavi 1998, p. 82). The Zahavis came up with this theory after observing gazelles for several years. When spotting a wolf in close proximity, some of the gazelles did not remain petrified or flee instantly, but instead “barked”, stamped their front hooves or jumped around (so-called “stotting”). Stotting, however, consumes a lot of energy which is actually needed to get away from the predator. Such behaviour, seemingly wasting energy, brought the Zahavis to work out their handicap hypothesis according to which a signal has to be reliable in order to be effective, and costly in order to be reliable (cf. p. 14). In a story in which gazelle and wolf are able to talk, the gazelle might say something like this: “Hey, wolf, don’t stress us both out. It does not make any sense that you waste time and energy trying to catch me. I have already spotted you, and I am so quick that you will never get me. Why don’t you just leave it in the first place?!” The Zahavis recognised this mechanism of forgery-proof and costly messages also in the peacock’s extravagant tail and in deer antlers. A peacock that manages to find food and get away from enemies despite the enormous weight of its tail signalises that it is a genetically valuable partner that will produce healthy offspring. The “carrier” sends out a signal to its environment which says, simply speaking: “Have a look, I can afford to handicap myself. And because this is the case, I must really be ‘good’”. In other words, the carrier manages to excel its rivals in the competition for reproduction (sexual selection) by stressing its “good genes”. The handicap principle has then been applied to human society, as that is similarly concerned with producing forgeryproof signals. It is for this very reason that exclusive goods such as expensive houses, cars, clothes and jewellery play such an important role within human society (cf. Uhl and Voland 2002). In what follows, I would like to verify the functioning of this handicap principle by taking a closer look at Hermann Hesse’s narrative “Beneath the Wheel” (1906). Hans Giebenrath, the story’s protagonist, grows up in a small village in the Black Forest and stands out due to exceptional achievements at school. He receives special support from the principal and the school priest, turns second in the statewide exams in Stuttgart and is offered the opportunity to attend the A-level seminar at Maulbronn Monastery. In Maulbronn, Hans initially ranks among the best students. But the closer he gets to Hermann Heilner, an intelligent young artist, the more his school performance deteriorates and the more tired and exhausted he feels. In the end, he has to leave the seminar and serves an apprenticeship with a locksmith. One night, after getting very drunk at a pub, Hans drowns in the river. The question of whether his death was an accident or suicide remains unanswered. Until today, this narrative is interpreted as a criticism of the school system as a reflection of the authoritarian state of Prussia around the turn of the century. While it is, of course, possible, to read the narrative in this way,

Storytelling from the Perspective of Evolutionary Theory

101

I have my doubts if this approach is, in the long run, sustainable.20 Instead, let us look at the text and the school situation in Maulbronn that it portrays from the perspective of evolutionary psychology. The seminar serves to adjust the students to the basic mechanisms of a functionally differentiated society. In other words, the school environment is all about a) variation, b) selection and c) stabilisation. The adolescents have to get used to learning from schoolmates and adults in a special situation. The teachers, the location of the school and the educational context represent a “selective advantage” in the sense that they replace the social structure of family relationships. The school represents the structure of a modern society, based on performance and mutual acceptance (cf. Scheunpflug 2001, p. 170). The individual is assessed and evaluated according to his specific performance, not (fatherly or motherly) love. For Hans Giebenrath, this situation constitutes a great challenge, and his strategy initially does prove to be successful, as he gains the respect of his roommates (cf. Hesse 2001, p. 189). There is another aspect that speaks for the evolutive role of the seminar, preparing the students for survival in the modern society: the students are encouraged to practise “forms of cooperation” in competitive circumstances, which shall prepare them for life in a functionally differentiated society. The narrator relates that the “young people” gradually get used to living together and form friendships which, again, fulfil a cooperative function: “There were students good at Latin and bad at orations who teamed up with those bad at Latin and good at orations, so that they could all benefit from the fruit of cooperative work” (p. 72, transl. C. H.). Finally, the Maulbronn school serves to introduce the young people to a “humanised form” of competition. Not the physical fitness of an individual shall be the decisive factor for victory or defeat, but his knowledge in specific fields. All of this is also about preparation for unknown forms of communication, as Luhmann has shown for the educational system (cf. Luhmann 2002). This is one reason why, in Maulbronn, all forms of physical competition among the students are strictly forbidden. When Hermann Heilner ignores this policy, using his fists to solve a conflict, he is locked up in the detention room. At this school, the assessment of performance is the main, crucial benchmark, and this corresponds to a fundamental evolutionary principle: good grades are a scarce resource, and only those who excel, through effort or talent, will be among the best. When Hans first joins the Maulbrunn seminar, he gladly follows the school policies. In the story, there is a situation where he does not confess to his friendship with Hermann Heilner, which the narrator comments on as follows: “His ideal was to get on, achieve first-class degrees and play a role, but not a romantic or dangerous one” (p. 79, transl. C. H.). He has adopted a fundamental evolutionary rule, the principle of imitating the successful, those 20 For a contrary interpretation, see Gansel 2004.

102

Carsten Gansel

who, as Hans believes, “get on”. In this respect, the narrative provides a good picture of how evolutive status strategies are tried out at a school as a “social habitat”. As soon as Hans gives up his risk-minimising behaviour and half-heartedly teams up with Hermann Heilner who, as an artist, symbolises the alternative and innovative, he is thrown off-course. His journey ending in death (or suicide) can be interpreted along the lines of the handicap principle: Through hard work and the loss of leisure time (= handicap), Hans has achieved an outstanding performance and surpassed the schoolmates in his small hometown. He even turns second in the statewide exam, which underlines his extraordinary abilities. If we wanted to describe this in terms of evolutionary psychology, we could say that Hans has, thanks to considerable expenditure (handicap), achieved results (good grades, respect from his teachers, statewide exam) that constitute forgery-proof signals. These signals cannot be imitated or forged by others, because the exams reveal who is only a “bigmouth” and whose intellectual performance is truly excellent. In this sense, Hans is one of the “strong” ones faced with high expectations. However, we understand early on in the story that the continuous production of forgery-proof signals (achievements at school) drains Hans’ resources and “handicaps” him too much. He constantly feels pressurised and, simply speaking, breaks his own back. When he fails at Maulbronn, Hans loses his forgery-proof signals and thus the basis for his outstanding position at the boarding school and in the town. His hierarchical position plummets. Initially he does not mind joining the group of workmen and their rituals, but he soon realises subconsciously that, because of his physical condition, he will never be able to reach a similarly elevated position in this environment as he did at school where intellectual achievement was all that counted. The threat of destroying himself and, finally, self-destruction seem to be the only weapons for a weaker competitor in a world that he does not feel up to.

X. Summary In this contribution, I have tried to combine selected aspects and findings from different academic disciplines in view of the problem of storytelling. There seems to be a general consensus among scholars that the brain mirrors and imitates actions no matter if they really happen or merely constitute mental representations. Man can thus, presuming that he has experience of a specific type of action, mirror this action in his brain as if it were really happening. This ability forms the basis for empathy which plays a central role for the understanding of stories and narratives. We cannot decide here whether or not art constitutes an adaptive feature of human evolution. Against the backdrop of co-evolution of consciousness and communication, which we have

Storytelling from the Perspective of Evolutionary Theory

103

discussed in this essay, it seems likely, though, that storytelling has fulfilled such an adaptive function, even below the fictional level. As an adaptive feature, storytelling leads to the development of specific genres of art.

References Allman, William F., Mammutjäger in der Metro. Wie das Erbe der Evolution unser Denken und Verhalten prägt, Heidelberg, Berlin: Spektrum, Akademischer Verlag, 1999. Anz, Thomas / Heinrich Kaulen (eds.), Literatur als Spiel. Evolutionsbiologische, ästhetische und pädagogische Konzepte, Berlin, New York: Walter de Gruyter, 2009. Augst, Gerhard, “Zur Ontogenese der Erzählkompetenz in der Primar- und Sekundarstufe”, in: Textformen als Lernformen, ed. by Thorsten Pohl and Torsten Steinhoff, Cologne: Gilles & Francke Verlag, 2010, pp. 63–96. Augst, Gerhard / Katrin Disselhoff / Alexandra Henrich / Thorsten Pohl, Text – Sorten – Kompetenz. Eine echte Longitudinalstudie zur Entwicklung der Textkompetenz im Grundschulalter, Frankfurt/M.: Lang, 2007. Barkow, Jerome H., “Universalien und evolutionäre Psychologie”, in: Universalien und Konstruktivismus, ed. by Peter M. Hejl, Frankfurt/M.: Suhrkamp, 2001, pp. 126–138. Baron-Cohen, Simon, “The extreme male-brain-theory of autism”, in: Neurodevelopmental Disorders, ed. by Helen Tager-Flusberg, Cambridge, MA, et al.: MIT Press, 1999, pp. 1–68. Barsalou, Lawrence W., “Frames, Concepts, and Conceptional Fields”, in: Frames, Fields, and Contrasts. New Essays in Semantic and Lexical Organization, ed. by Adrienne Lehrer and Eva Federkittay, Hillsdale: Erlbaum, 1992, pp. 21–74. Bayertz, Kurt (ed.), Evolution und Ethik, Stuttgart: Reclam, 1993. Bierwisch, Manfred, “Evolutionsbiologie und Linguistik – Drei Probleme”, in: Evolutionstheorie und Geisteswissenschaften, ed. by Klaus Richter, Erfurt: Akademie gemeinnütziger Wissenschaften, 2000, pp. 129–190. Bischof, Norbert: Das Kraftfeld der Mythen. Signale aus der Zeit, in der wir die Welt erschaffen haben, Munich, Zürich: Piper, 1998. Boueke, Dietrich / Frieder Schülein, Wie Kinder erzählen, Munich: Fink, 1995. Boyd, Brian, “Evolutionary Theories of Art”, in: The Literary Animal. Evolution and Nature of Narrative, ed. by Jonathan Gottschall and David Sloan Wilson, Evanston: Northwestern UP, 2005, pp. 147–176. –, On the Origin of Stories: Evolution, Cognition, and Fiction, Cambridge, MA: Belknap Press of Harvard UP, 2009. Burkert, Walter, Kulte des Altertums. Biologische Grundlagen der Religion, Munich: Beck, 1998. Buss, David, Die Evolution des Begehrens. Geheimnisse der Partnerwahl, Munich: Goldmann, 1997. –, “Evolutionary Psychology: A New Paradigm für Psychological Science”, in: Psychological Inquiry 6.I (1995), pp. 1–30. Byrne, Richard W. / Andrew Whiten (eds.), Machiavellian Intelligence, Oxford: Clarendon Press, 1988. Call, Josep / Michael Tomasello, “Does the chimpanzee have a theory of mind: 30 years later”, in: Trends in Cognitive Sciences 12 (2008), pp. 87–92.

104

Carsten Gansel

Carroll, Joseph, Evolution and Literary Theory, Columbia et al.: University of Missouri Press, 1995. –, “Universalien in der Literaturwissenschaft”, in: Universalien und Konstruktivismus, ed. by Peter M. Hejl, Frankfurt/M.: Suhrkamp, 2001, pp. 235–256. –, Literary Darwinism. Evolution, Human Nature, and Literature, New York, London: Routledge, 2004. –, “Evolutionary approaches to literature and drama”, in: Oxford Handbook of Evolutionary Psychology, ed. by Robin Dunbar and Louise Barrett, New York: Oxford UP, 2007, pp. 637–648. Carroll, Joseph / Jonathan Gottschall, “Human Nature and Agonistic Structure in Canonical British Novels of the Nineteenth and Early Twentieth Centuries. A Content Analysis”, in: Heuristiken der Literaturwissenschaft. Disziplinexterne Perspektiven auf Literatur, ed. by Uta Klein, Katja Mellmann and Steffanie Metzger, Paderborn: Mentis, 2006, pp. 473–487. Chatman, Seymor, Story and Discourse: Narrative Structure in Fiction and Film, Ithaka, London: Cornell UP, 1978. Cosmides, Leda / John Tooby, “From evolution to behavior. Evolutionary Psychology as the missing link”, in: The latest on the best, ed. by John Dupré, Cambridge, MA: MIT Press, 1987. –, “Cognitive Adaptations for social exchange”, in: The Adapted Mind: Evolutionary Psychology and the Generation of Culture, ed. by J. H. Barkow, L. Cosmides and J. Tooby, New York: Oxford UP, 1992, pp. 163–228. Dawkins, Richard, The Selfish Gene, Oxford: Oxford UP, 1976. –, The Ancestor’s Tale, London: Weidenfeld & Nicolson, 2004. Dissanayake, Ellen, Art and Intimacy. How the Arts Began, Seattle: University of Washington Press, 2000. –, “Kunst als menschliche Universalie: Eine adaptionistische Betrachtung”, in: Universalien und Konstruktivismus, ed. by Peter M. Hejl, Frankfurt/M.: Suhrkamp, 2001, pp. 206–234. Dunbar, Robin, Grooming, Gossip and the Evolution of Language, London et al.: Faber and Faber, 1996. –, Klatsch und Tratsch, Munich: Goldmann, 2000. Eckholdt, Matthias, “Über die Bedeutung der Spiegelneuronen für Sprachwissenschaft und Systemtheorie”, in: Textsorten und Systemtheorie, ed. by Christina Gansel, Göttingen: Vandenhoeck & Ruprecht, 2008, pp. 171–180. Eibl, Karl, “Zurück zu Darwin. Bausteine zur historischen Funktionsbestimmung von Dichtung”, in: Modelle literarischen Strukturwandels, ed. by Michael Titzmann, Tübingen: Niemeyer, 1991, pp. 347–366. –, “Strukturierte Nichtwelten. Zur Biologie der Poesie”, in: IASL 18 (1993), pp. 1–36. –, Die Entstehung der Poesie, Frankfurt/M., Leipzig: Insel-Verlag, 1995. –, “Textkörper und Textbedeutung. Über die Aggregatzustände von Literatur, mit einigen Beispielen aus der Geschichte des Fauststoffes”, in: Kanon – Macht – Kultur: theoretische, historische und soziale Aspekte ästhetischer Kanonbildung, ed. by Renate von Heydebrand, Stuttgart, Weimar: Metzler, 1998, pp. 60–77. –, Animal Poeta. Bausteine einer biologischen Kultur- und Literaturtheorie, Paderborn: Mentis, 2004.

Storytelling from the Perspective of Evolutionary Theory

105

–, Kultur als Zwischenwelt. Eine evolutionsbiologische Perspektive, Frankfurt/M: Suhrkamp, 2009 (= 2009a). –, “Vom Ursprung der Kultur im Spiel. Ein evolutionsbiologischer Zugang”, in: Literatur als Spiel. Evolutionsbiologische, ästhetische und pädagogische Konzepte, ed. by Thomas Anz and Heinrich Kaulen, Berlin, New York: Walter de Gruyter, 2009, pp. 11–26 (= 2009b). Ekman, Paul / Richard J. Davidson (eds.), The Nature of Emotion. Fundamental Questions, New York et al.: Oxford UP, 1994. Eroms, Hans-Werner, Stil und Stilistik. Eine Einführung, Berlin: Erich Schmidt, 2008. Gansel, Carsten, “Von Angst, Unsicherheit und anthropologischen Konstanten – Modernisierung und Adoleszenzdarstellung bei Hermann Hesse”, in: Hermann Hesse und die Modernisierung. Kulturwissenschaftliche Facetten einer literarischen Konstante im 20. Jahrhundert, ed. by Andreas Solbach, Frankfurt/M.: Suhrkamp, 2004, pp. 224–255. –, “Zwischenzeit, Grenzüberschreitung, Störung – Adoleszenz und Literatur”, in: Zwischenzeit, Grenzüberschreitung, Aufstörung. Bilder von Adoleszenz in der deutschsprachigen Literatur, ed. by C. Gansel and Pawel Zimniak, Heidelberg: Winter, 2011, pp. 17–40. Gansel, Carsten / Frank Jürgens / Kurt Rose (eds.), Deutsch plus. Klasse 9, Berlin: Cornelsen-Scriptor, 2004. Gansel, Christina (ed.), Textsorten und Systemtheorie, Göttingen: Vandenhoeck & Ruprecht, 2008 (= 2008a). –, “Systemtheoretische Perspektiven auf Textsorten. Vorbemerkungen“, in: Textsorten und Systemtheorie, ed. by C. Gansel, Göttingen: Vandenhoeck & Ruprecht, 2008, pp. 7–20 (= 2008b). –, Textsortenlinguistik, Göttingen: Vandenhoeck & Ruprecht, 2010. Genette, Gérard, Die Erzählung, Munich: Fink, 1998. Haddon, Mark, Supergute Tage oder Die sonderbare Welt des Christopher Boone, Munich: Goldmann, 2003. –, The Curious Incident of the Dog in the Night-Time, London: Vintage, 2004. Hausendorf, Heiko, “Vertextungsmuster Narration”, in: Text- und Gesprächslinguistik. Ein internationales Handbuch zeitgenössischer Forschung, ed. by Klaus Brinker, Gerd Antos, Wolfgang Heinemann and Sven F. Sager, vol. 2, Berlin and New York: De Gruyter, 2000, pp. 369–385. Heine, Heinrich: “Nordsee”, in: Sämtliche Schriften, vol. 3: Schriften 1822–1831, ed. by Günter Häntzschel, Munich: Hanser, 1976. Hejl, Peter M., “Konstruktivismus und Universalien – eine Verbindung contre nature?”, in: Universalien und Konstruktivismus, ed. by P. M. Hejl, Frankfurt/M.: Suhrkamp, 2001, pp. 7–67. Heschl, Adolf, Das intelligente Genom, Berlin et al.: Springer, 1998. Hesse, Hermann, “Unterm Rad”, in: Sämtliche Werke, vol. 2: Die Romane. Peter Camenzind. Unterm Rad. Gertrud, ed. by Volker Michels, Frankfurt/M.: Suhrkamp, 2001, pp. 137–280. Hogan, Patrick Colm, The Mind and its stories. Narrative universals and human emotion, Cambridge: Cambridge UP, 2003. Huber, Martin / Gerhard Lauer, “Neue Sozialgeschichte? Poetik, Kultur und Gesellschaft – zum Forschungsprogramm der Literaturwissenschaft”, in: Nach der Sozialgeschichte. Konzepte für eine Literaturwissenschaft zwischen Historischer Anthropologie, Kulturge-

106

Carsten Gansel

schichte und Medientheorie, ed. by M. Huber and G. Lauer, Tübingen: Niemeyer, 2000, pp. 1–12. Huber, Martin / Simone Winko (eds.), Literatur und Kognition. Bestandsaufnahmen und Perspektiven eines Arbeitsfeldes, Paderborn: Mentis, 2009. Jahraus, Oliver, “Evolutionsbiologie als Literatur- und Kulturtheorie. Zu: Karl Eibl, ‘Animal poeta. Bausteine einer biologischen Kultur- und Literaturtheorie’”, in: KulturPoetik. Zeitschrift für kulturgeschichtliche Literaturwissenschaft 5.2 (2005), pp. 264–267. Jannidis, Fotis, Figur und Person. Beitrag zu einer historischen Narratologie, Berlin, New York: Walter de Gruyter, 2004. Johnson, John / Joseph Carroll / Jonathan Gottschall / Daniel Kruger, “Hierarchy in the Library: Egalitarian Dynamics in Victorian Novels”, in: Evolutionary Psychology 6,4 (2008), pp. 715–738. Johnson, Mark, Moral Imagination, Chicago, London: University of Chicago Press, 1997. Klix, Friedhart, Erwachendes Denken. Eine Entwicklungsgeschichte der menschlichen Intelligenz, Berlin: Deutscher Verlag der Wissenschaften, 1985. –, “Wissenselemente: Bausteine für Gedächtnis und Sprache”, in: Sprache und Kognition. Perspektiven moderner Sprachpsychologie, ed. by Joachim Kornadt, Joachim Grabowski and Roland Mangold-Allwin, Heidelberg et al.: Spektrum, Akademischer Verlag, 1994, pp. 133–160. Kühnel, Sina / Hans J. Markowitsch, Falsche Erinnerungen. Die Sünden des Gedächtnisses, Heidelberg: Spektrum, Akademischer Verlag, 2009. Labov, William / Joshua Waletzky, “Erzählanalyse: mündliche und persönliche Erfahrung”, in: Literaturwissenschaft und Linguistik, vol. 2, ed. by Jens Ihwe, Frankfurt/M.: Athenäum Fischer, 1973, pp. 28–127. Lauer, Gerhard, “Spiegelneuronen. Über den Grund des Wohlgefallens an der Nachahmung”, in: Im Rücken der Kultur, ed. by Karl Eibl and Rüdiger Zymner, Paderborn: Mentis, 2007, pp. 133–159. –, “Das Spiel der Einbildungskraft. Zur kognitiven Modellierung von Nachahmung, Spiel und Fiktion”, in: Literatur als Spiel. Evolutionsbiologische, ästhetische und pädagogische Konzepte, ed. by Thomas Anz and Heinrich Kaulen, Berlin, New York: Walter de Gruyter, 2009, pp. 27–38. Luhmann, Niklas, Soziale Systeme, Frankfurt/M.: Suhrkamp, 1987. –, Die Realität der Massenmedien, Opladen: Westdeutscher Verlag, 1995 (= 1995a). –, Die Kunst der Gesellschaft, Frankfurt/M.: Suhrkamp, 1995 (= 1995b). –, Die Gesellschaft der Gesellschaft, 2 vols., Frankfurt/M.: Suhrkamp, 1998. –, Das Erziehungssystem der Gesellschaft, ed. by Dieter Lenzen, Frankfurt/M.: Suhrkamp, 2002. –, Einführung in die Systemtheorie, ed. by Dirk Becker, Heidelberg: Carl Auer, 2004. Martínez, Matías / Michael Scheffel, Einführung in die Erzähltheorie, Munich: Beck, 1999. May, Karl, Der Schatz im Silbersee, in: Karl Mays Gesammelte Werke, vol. 36, Radebeul: Karl-May-Verlag, 1930. Mayr, Ernst, What Evolution is, New York: Basic Books, 2001. Meer, Elke van der, “Mentale Repräsentationen von Alltagstexten”, in: Zeitschrift für Psychologie 201 (1993), pp. 375–391. Mellmann, Katja, “Literatur als emotionale Attrappe. Eine evolutionspsychologische Lösung des ‘paradox of fiction’”, in: Heuristiken der Literaturwissenschaft. Disziplinexterne

Storytelling from the Perspective of Evolutionary Theory

107

Perspektiven auf Literatur, ed. by Uta Klein, K. Mellmann and Steffanie Metzger, Paderborn: Mentis 2006, pp. 145–166. –, “Das ‘Spiegelgesicht’ als poetisches Verfahren. Elemente einer verhaltensbasierten Fiktonalitätstheorie”, in: Literatur als Spiel. Evolutionsbiologische, ästhetische und pädagogische Konzepte, ed. by Thomas Anz and Heinrich Kaulen, Berlin, New York: Walter de Gruyter, 2009, pp. 57–68. Menninghaus, Winfred, Das Versprechen der Schönheit, Frankfurt/M.: Suhrkamp, 2003. Miller, Geoffrey F., “Sexual Selection for Cultural Displays”, in: The Evolution of Culture, ed. by Robin Dunbar, Chris Knight and Camilla Power, Edinburgh: Edinburgh UP, 1999, pp. 71–91. Mitchell, Margaret, Gone with the Wind [1936], New York: Warner Books, 1993. Mithen, Steven, “Handaxes: The First Aesthetic Artifacts”, in: Evolutionary Aesthetics, ed. by Karl Grammer and Eckart Voland, Berlin et al.: Springer, 2003, pp. 261–278. Pinker, Steven, Wie das Denken im Kopf entsteht, Munich: Kindler, 1998. –, Das unbeschriebene Blatt. Die moderne Leugnung der menschlichen Natur, Berlin: Berlin-Verlag, 2003. Ramachandran, Vilayanur, Eine kurze Reise durch Geist und Gehirn, Reinbek: Rowohlt, 2 2006 (original: The Emerging Mind, London: Profile Books, 2003). Remus, Joscha, Infonautik, s.a. (see http://www.infonautik.de/interviews.htm). Rizzolatti, Giacomo et al., “Premotor cortex and the recognition of motor actions”, in: Cognitive Brain Research 3 (1996), pp. 131–141. Rizzolatti, Giacomo / Corrado Sinigaglia, Empathie und Spiegelneurone: Die biologische Basis des Mitgefühls, Frankfurt/M.: Suhrkamp, 2008. Scheunpflug, Annette, Biologische Grundlagen des Lernens, Berlin: Cornelsen Scriptor, 2001. Schmelz, M. / J. Call / M. Tomasello, “Chimpanzees know that others make inferences”, in: Proceedings of the National Academy of Sciences 108 (2011), pp. 17284–17289. Schmidt, Siegfried J., “Literaturwissenschaft als interdisziplinäres Vorhaben”, in: Kultureller Wandel und die Germanistik in der Bundesrepublik. Vorträge des Augsburger Germanistentages 1991, vol. 2: Germanistik und Deutschunterricht im historischen Wandel, ed. by Johannes Janota, Tübingen: Niemeyer, 1993, pp. 3–19. Schneider, Bettina, Zwischen Klassiker und Bestseller – erfolgreiche Kinder- und Jugendliteratur in evolutionspsychologischer Perspektive, Gießen (PhD diss.), 2010. Schönert, Jörg, “Was ist und was leistet Narratologie? Anmerkungen zur Geschichte der Erzählforschung und ihrer Perspektiven”, in: literaturkritik.de 4 (2006), pp. 1–7. Schwender, Clemens, Medien und Emotionen. Evolutionspsychologische Bausteine einer Medientheorie, Wiesbaden: Deutscher Universitäts-Verlag, 2001. Sommer, Volker, Feste – Mythen – Rituale. Warum die Völker feiern, Hamburg: Gruner & Jahr, 1992. –, Von Menschen und anderen Tieren. Essays zur Evolutionsbiologie, Stuttgart, Leipzig: Hirzel, 2000. Stockwell, Peter, Cognitive Poetics. An Introduction, London: Routledge, 2002. Tomasello, Michael, Die kulturelle Entwicklung des menschlichen Denkens, Frankfurt/M.: Suhrkamp, 2002. Tomasello, M. / M. Carpenter / J. Call / T. Behne / H. Moll, “Understanding and sharing intentions: The origins of cultural cognition”, in: Behavioral and Brain Sciences 28 (2005), pp. 675–691.

108

Carsten Gansel

Treml, Alfred K., “Evolutionäre Pädagogik. Umrisse eines Paradigmenwechsels”, in: Zeitschrift für Pädagogik 36 (2002), pp. 652–669. Uhl, Matthias / Eckart Voland, Angeber haben mehr vom Leben, Heidelberg, Berlin: Spektrum, Akademischer Verlag, 2002. Voland, Eckart, “Fortpflanzung: Natur und Kultur im Wechselspiel”, in: Fortpflanzung: Natur und Kultur im Wechselspiel, ed. by E. Voland, Frankfurt/M.: Suhrkamp, 1992, pp. 347–366. –, Grundriss der Soziobiologie, Heidelberg, Berlin: Spektrum Fischer, 2000. –, “Ziele, Chancen und Grenzen weltbürgerlicher Erziehung. Kritische Zwischenrufe eines Soziobiologen in eine pädagogische Debatte”, in: Universalistische Moral und weltbürgerliche Erziehung, ed. by Sigrid Görgens, Annette Scheunpflug and Krassimir Stojanov, Frankfurt/M.: IKO – Verlag für Interkulturelle Kommunikation, 2001, pp. 326–340. –, “Homo naturaliter religiosus. Umrisse des soziobiologischen Arguments”, in: Gewalt und Opfer (Mythoseikonpoiesis), ed. by Anton Bierl and Wolfgang Braungart, Berlin, New York: Walter de Gruyter, 2007, pp. 293–315. Voland, Eckart / Renate Voland, “Die Evolution des Gewissens. Wem nützt das Gute?”, in: Die Natur der Moral. Evolutionäre Ethik und Erziehung, ed. by Dieter Neumann, Arno Schöppe and Alfred K. Treml, Stuttgart, Leipzig: S. Hirzel, 1999, pp. 195–209. Vollmer, Gerhard, Biophilosophie, Stuttgart: Reclam, 1995. –, “Können wir den sozialen Mesokosmos verlassen?”, in: Universalistische Moral und weltbürgerliche Erziehung, ed. by Sigrid Görgens, Annette Scheunpflug and Krassimir Stojanov, Frankfurt/M.: IKO, Verlag für Interkulturelle Kommunikation, 2001, pp. 12– 33. Weigel, Sigrid, “Inkorporation der Genealogie durch die Genetik. Vererbung und Erbschaft an Schnittstellen zwischen Bio- und Kulturwissenschaften”, in: Genealogie und Genetik: Schnittstellen zwischen Biologie und Kulturgeschichte, ed. by S. Weigel, Berlin: Akademie-Verlag, 2002, pp. 71–100. Wenzel, Peter (ed.), Einführung in die Erzähltextanalyse. Kategorien, Modelle, Probleme, Trier: WVT Wissenschaftlicher Verlag, 2004. Willems, Gottfried, “Literaturwissenschaft und Evolutionstheorie”, in: Evolutionstheorie und Geisteswissenschaften, ed. by Klaus Richter, Erfurt: Akademie gemeinnütziger Wissenschaften, 2001, pp. 191–215. Wilson Edward O., Sociobiology. The New Synthesis, Cambridge, MA, London: Belknap Press, 1975. Wuketis, Franz M., Soziobiologie. Die Macht der Gene und die Evolution des sozialen Verhaltens, Heidelberg et al.: Spektrum Akademischer Verlag, 1997. Zahavi, Amotz / Avishag Zahavi, Signale der Verständigung. Das Handicap-Prinzip, Frankfurt/M. et al.: Insel-Verlag, 1998. Zymner, Rüdiger, “Poetogene Strukturen, ästhetisch-soziale Handlungsfelder und anthropologische Universalien”, in: Anthropologie der Literatur. Poetogene Strukturen und ästhetisch-soziale Handlungsfelder, ed. by R. Zymner and Manfred Engel, Paderborn: Mentis, 2004, pp. 13–29. –, “Körper, Geist und Literatur. Perspektiven der ‘Kognitiven Literaturwissenschaft’ – eine kritische Bestandsaufnahme”, in: Literatur und Kognition. Bestandsaufnahmen und

Storytelling from the Perspective of Evolutionary Theory

109

Perspektiven eines Arbeitsfeldes, ed. by Martin Huber and Simone Winko, Paderborn: Mentis, 2009, pp. 135–155.

110

The Unlovely Little Sister Storytelling as an Exaptive Phenomenon Dirk Vanderbeke

It may be safely assumed that in a collection of essays on “Literature and Evolution” most of the contributors will hold this truth to be self-evident that the rise of literature as a ubiquitous phenomenon in human cultures is in some way linked to biological adaptation, that in the course of human evolution it must have offered some advantage and that, in consequence, it became a feature that was selected. Literature in one form or the other exists in all human cultures and thus belongs to the human universals together with a host of phenomena that are closely related to literature, as, for example, literary tropes and most of the aspects of texts that we consider to be literary or poetic. As the co-editor of such a volume, I am, of course, not going to reject the notion of a biological basis for literature; that would be pretty much similar to a creationist hosting a conference on “The Evolutionary Foundations of Religion”. Nevertheless, in my paper I would like to challenge the concept that literature, and in particular fiction, are human traits that were selected for their usefulness and the resulting biological advantage of those individuals or groups who practised them. Instead, I want to argue that they are the result not of adaptation but of exaptation, i.e., they are the by-product of adaptive processes, but not themselves selected for. This suggestion is intended as an alternative approach to a phenomenon that has been explored for a while now. And while Steven Pinker has already suggested that art and literature are “not adaptive in the biologist’s sense of the word” (Pinker 1999, p. 524) and that the mental toolbox can be used not only for useful purposes but also for “projects of dubious adaptive value” (ibid.), his arguments for why we enjoy literature seem to be chiefly concerned with the ‘pleasure buttons’ pressed in the mind of the present reader and less with the evolutionary origins of literature. Among the aspects he mentions are the unquestionable facts that sex and violence make up quite a lot of literature and are, of course, exciting, or that literature not only entertains by offering something akin to gossip, but also instructs the reader. In addition, he follows Paul Rozin’s suggestion that our delight in tearjerkers may be the result of some benign masochism (cf. Pinker 1999,

111

The Unlovely Little Sister

pp. 540–543).1 This paper intends to approach the concept of literature as an exaptive phenomenon from a different angle and to pursue the question which items of the mental toolbox may have been coopted for new purposes in the genesis of storytelling. The evolutionary investigation of literature has not yet reached the point at which all the fundamentals are sorted out and only have to be filled in with the details. The work that has been done is amazing, but the theory is nevertheless in its early stages, and a different view may yet prove to be useful. The term “exaptation” was coined by Elizabeth S. Vrba and Stephen Jay Gould in their 1982 paper “Exaptation – A missing term in the science of form”; in his later book The Structure of Evolutionary Theory (2002, p. 1233), Gould offers the following table of definitions: Process Natural selection shapes the character for a current use – adaptation A character, previously shaped by natural selection for a particular function (an adaptation), is coopted for a new use – cooptation A character whose origin cannot be ascribed to the direct action of natural selection (a nonadaptation), is coopted for a current use – cooptation

Character Adaptation

Usage Function

Exaptation

Effect

Exaptation

Effect

Nobody seems to like exaptation very much – she is the unlovely little sister of adaptation –, and the suggestion that a characteristic trait is the result of exaptation is frequently rejected as a kind of pedantry, a niggling over some points of finesse. After all, if physical or mental phenomena are the result of evolutionary processes, they must be the result of selection; so why make the distinction? It may, however, be useful to do so in order to evade some conceptual problems and to refute some of the challenges the evolutionary approach meets from its opponents who are still legion. The most problematic aspect in the discussion of evolution is, of course, time. Without lots of it, William Paley’s argument that an intricate mechanism like a clock requires a watchmaker and that a far more complex phenomenon like a living organism obviously requires a creator would still be absolutely valid. Only the discovery of deep time made it possible to overcome the logic of biblical literalism and pave the way for Darwinian evolution. Evolution, no matter whether we take a gradualist perspective or follow the theory of long stasis interrupted by sudden bursts of accelerated developments, also known as punctuated equilibrium, still requires a long 1

For a critique of Pinker’s approach that also rejects the suggestion of exaptation cf. Boyd 2009, pp. 81–84.

112

Dirk Vanderbeke

time for change. Of course, the development of the arts and literature, if we actually describe them as adaptive features, would not indicate a major change compared to speciation, but the appearance of undisputed artefacts seems to have taken place in the course of some millennia (ca. 50,000– 35,000 B.C.) which is rather short if we dismiss the idea that a single mutation could be at the core of it. Moreover, as it is quite improbable that all forms of art, from cave paintings to the sculpting of figurines to the development of narrative and poetic structures, appeared simultaneously and spread together over the globe in one process of expansion, genetic adaptation is even more unlikely, as similar adaptive changes would have to have taken place independently in various locations. So I want to suggest that it may be more useful to see the development of the arts and in particular fictional narration as discoveries and to search for previous adaptive human traits that would favour such discoveries as an exaptive phenomenon. One of the problems in the reconstruction of the evolutionary process is that we know the result and try to explain it as intrinsically coherent. We know that literature and fiction are universals and thus we look for the advantages they may offer so that the genetic disposition for them may quickly spread through the population and become part of the human genome. In fact, we tell the tale as a true story with a coherent plot. In its simplistic form, this follows the structure that Alan Dundes attributed to the North American Indian Folk Tale. He suggested that there are correlated structural elements, motifeme sequences, as for example Task / Task Accomplished, Lack / Lack Liquidated, Interdiction / Violation, Deceit / Deception etc. (cf. Dundes 1964, pp. 61–84). Looking backward and seeing that a particular phenomenon in an organism is useful and necessary or at least desirable for survival in its present state, we tend to regard the absence of it as a lack that has to be overcome. This then is the task evolution has to perform, and as in folk tales it achieves this primarily by finding some new tool – in fairy tales this is the magical object, in evolutionary theory the newly developed feature of the organism. The task is then accomplished, the lack liquidated and the story finds its ending or solution. But as evolution works without any purpose or aim in mind, we may have to explain the very first steps of a development not with the final outcome in mind, but as a series of small changes each of which needs to be useful enough in itself to spread through the population. The obvious example is the wing of birds, which can hardly have been the objective for the first minor changes in the reptile anatomy. It possibly originated in a small flap that helped to regulate the temperature of the body. It also may have been a means to appear larger in size and thus to ward off predators; as such it could have been an element favoured by sexual selection, and only when after a considerable time and increase of the device the animals could jump a little farther or sail a bit on a breeze the selection for that specific purpose could begin. And, of course,

The Unlovely Little Sister

113

the same goes for the feather which certainly was not designed for flight when the first reptile scales began to change their form and purpose. So, ultimately the wing of the bird is an exaptive development which only in the course of the evolutionary process became adaptive. In the case of literature and fiction, I even want to go a step further and argue that they are derivative of aspects of human behaviour that could be adapted to their new functions without any or with only minimal additional genetic adaptation. In his recent book On the Origin of Stories, Brian Boyd points out that “our predisposition for fiction seems at first glance counterproductive in biological terms, unlike our capacity for true narration” (Boyd 2009, p. 129). The sequence “seems at first glance” is, of course, the important element in this sentence and Boyd dismisses the idea quickly in favour of various models which explain the usefulness of fiction. I find them completely convincing, but do not think that fiction needs to be the referent in the arguments. Cooperation, cognitive play, tradition and innovation, the understanding and recalling of events, all of which are the titles of subchapters in Boyd’s book, are quite clearly traits that may have had a significant impact on the survival of prehistoric communities, but while they favour the ability to invent fictitious stories, fiction is not necessarily part and parcel of them. So I would like to return and provocatively suggest that fiction may indeed be unproductive in biological terms and, to add just a little spice to my point, I also want to suggest that nothing is quite as useless for human survival as the recitation and reception of poems.2 Of course, survival is not the only issue that needs to be addressed here – the aspect of sexual selection also has to be considered. Boyd offers the example of the Tale of Genji for a case of sexual selection in which the winner of a painting contest also wins the adulation of many women, but he adds that “sexual selection cannot explain why men and women, boys and girls in the home and outside engage so compulsively in art as both artists and audiences” (Boyd 2009, p. 79). Wolfgang Steinig suggests that good storytellers or those who can impress others by means of their brilliant rhetoric also find more attractive sexual partners, but some caution against overly simplistic explanations may well be required. The idea that a great talent for storytelling leads to sexual selection may have a touch of philological wishful thinking to it, and the later title of a chapter in Steinig’s book, “sex for meat” (cf. p. 118) may be more plausible. In contrast to some tales in which poetic abilities favour erotic conquest, most myths and legends suggest that the hero should be a bully rather than a bard, and that sexual success came to him who killed the bear and not to him who made a song about it. 2

For an elaboration of this point that also draws on some of the following arguments cf. Vanderbeke 2010.

114

Dirk Vanderbeke

Moreover, the concept of sexual selection, of course, does not and cannot explain why we enjoy fiction. Indeed, if the reading of fiction increased the reproductive potential for humans – also known as having more sex –, literary studies would be the most cherished academic field, and instructors would not have to coerce their students into reading the texts for the seminars. And when in Saul Bellow’s novel Humboldt’s Gift the eponymous protagonist tries to seduce a woman with the yell “I’m a poet! I have a big cock!” (Bellow 1984, p. 139), this does not prove to be a particularly successful approach, and the woman later claims that “I was laughing so hard that I could not have done it anyway” (ibid.). On the other side of the game, the stereotypical perspective on the attractiveness of the female bookworm is equally not very favourable, but rather suggests the image of the sexually disinterested blue-stocking, while the famed picture of Marilyn Monroe immersed in the final pages of Ulysses always intuitively seemed just a little bit staged, even though we know that the roles she played in the movies were quite incongruous with the person she was. Writing as well as reading are not especially desirable traits outside a specific cultural niche, and usually regarded as scary rather than sexy. All this considered, there is an even more important reason to suggest that fiction is not the result of an adaptive process, and that is the term “fiction” itself. Of course, fiction nowadays is a well-defined concept, but can we really apply this term to narrations in prehistoric times? Walter Haug argued that fiction as we understand it was a development in European literature as late as the thirteenth century (cf. Haug 2003, passim), and while antiquity used the terms fabula or muthos, they did not really cover the same field as fiction. When Lucian in his True Account satirically attacked the myths of Homeros or the travelogues of yore, he did not assault them as being fictions, but as falsehoods, lies and humbugs. We can find similar passages in earlier critical assessments and dismissals of the ancient tales, i.e., in the works of the Presocratics and of Plato. So the question arises whether it is actually possible to speak of fiction in prehistoric times, which are, of course, the relevant times when we discuss the evolution of literature. In their book Hamlet’s Mill, Giorgio de Santillana and Hertha von Dechend write about the “origins of human knowledge and its transmission through myth” (the subtitle of their work), and they read mythologies as highly complex knowledge systems about astronomical events in narrative forms that seem to have remained astonishingly stable in a pre-literate world not only over centuries but over several millennia. Similarly, Jerome Lettvin analyzed the myth of Perseus as a multi-levelled narration transmitting not only knowledge about astronomical phenomena but also about the marine fauna of the Mediterranean. If we explore the fairy tales handed down to us we can glimpse bits and pieces of ancient cults and belief systems – the story of “Little Red Riding Hood”,

The Unlovely Little Sister

115

for example, bears some remarkable similarities with the ancient fertility cults as described in Carlo Ginzburg’s The Night Battles. Of course, the narrations are fictions to us, but were they fictions to the people who first told them and does the term make any sense in their respect? In a recent workshop at Jena on fantastic literature, Meinolf Vielberg, professor of classical philology, pointed out that prose fiction, while it existed in late antiquity in texts like Petron’s Satyricon, was not a literary category discussed together with the other genres like tragedy or comedy. It is very likely that once we go even further back into the past, equivalents of prose fiction would be hard to find. And once we reach the time of pre-history, the possibility of distinguishing between myth and fiction seems not likely to be an issue any longer – if the ravens Huginn and Muninn tell Odin what happens all over the world, this is not fiction but religion, and if Beaver speaks to Fox in a tale of a prehistoric animistic society, this is what he does. The tendency to project human characteristics and intention onto external reality and natural phenomena does not allow for any classification into factual explanations of our environment based on the prevalent belief systems on the one hand and imaginary constructions of fictional worlds on the other hand. This indicates that fiction indeed is a late phenomenon, so late that an evolutionary predisposition for it is highly unlikely. However, the concept of exaptation would allow for the possibility that fiction when it appeared managed to take advantage of already existing adapted phenomena in the human mind and that it was then favoured by selective processes. After all, the production and reception of fiction may serve useful social and cultural functions and thus be advantageous to individual and communal well-being. However, fiction could also be what Stephen J. Gould and Richard C. Lewontin described as “spandrels”. In their highly controversial essay of 1979, “The spandrels of San Marco and the Panglossian paradigm”, the authors attacked a strictly functionalist approach to evolutionary history and suggested a concept which is similar but not interchangeable with exaptation. It is based on an observation on architecture and art in St. Mark’s cathedral in Venice. Spandrels are “triangular spaces formed by the intersection of two rounded arches at right angles” (Gould and Lewontin 1979, p. 339). They are an architectural necessity, but they also lend themselves to be used for iconographic images. The design is so elaborate, harmonious and purposeful that we are tempted to view it as the starting point of any analysis, as the cause in some sense of the surrounding architecture. But this would invert the proper path of analysis. The system begins with the architectural constraint, the necessary four spandrels and their tapering form. They provide a space in which the mosaicists worked; they set the quadripartite symmetry of the dome above. (p. 340)

A spandrel is then “a secondary epiphenomenon representing a fruitful use of available parts, not the cause of an entire system” (p. 342). As such, the

116

Dirk Vanderbeke

concept of spandrels offers an integrated perspective on an organism instead of a strictly adaptationist programme which, as they claim, “gave us an evolutionary biology of parts and genes, but not of organisms” (p. 355). As already indicated, the concept of the spandrels was received by the academic community with strong criticism and in some cases almost hostility (cf., e.g., Dennett 1996, pp. 267–282), and I certainly do not intend to tread on foreign ground or toes. However, the concept of the spandrels could suggest how specific adaptive traits became instrumental for artistic purposes. It would thus lend itself to an evolutionary explanation of phenomena which seem not to be particularly useful but which have developed into universals of human culture. In fact, Gould suggests that the human mind may well be a site of spandrels: The human brain may have reached its current size by ordinary adaptive processes keyed to specific benefits of more complex mentalities for our hunter-gatherer ancestors on the African savannahs. But the implicit spandrels in an organ of such complexity must exceed the overt functional reasons for its origin. (Gould 1997, p. 10755)

I want to suggest that fiction was originally either an exaptation or a spandrel, resulting from an adaptive human characteristic that was co-opted for new purposes. The production and exchange of fictional tales as a cultural practice either offered enough individual or social advantages to be selected for or else simply became part and parcel of human cultures because telling stories and listening to them is fun. This may well have happened at a time when the previously dominant knowledge and belief systems transmitted by myths and other forms of narration were losing in credibility, but not in fascination. This development would then possibly coincide with a second important change: information was no longer transmitted orally but stored in written texts. This aspect will be further explored later. First it is necessary to ask what the roots of the fascination of fiction may possibly be, for, after all, the production of narration is only one half of the issue, and we also need an audience that is willing to be captivated. The ability to construct imaginary worlds, “worlds as if ”, would, of course, be favourable to survival in a hostile environment. It is a fundamental asset, and its roots can be found already in the animal kingdom. Similarly, some highly intelligent animals like apes and crows seem to have something akin to a theory of mind (cf. de Waal 2006, pp. 69–73; Heinrich and Bugnyar 2007, pp. 30–31). This ability is at the very root of every decision making process, as the decision between alternatives requires the imaginative construction of possible results of the decision and also a calculation of possible behaviours of other agents. Only if we are able to construct coherent possible consequences of our actions, including equally coherent and believable responses by our peers or opponents within a working projection of our present environment into a probable future can decisions prove to be

The Unlovely Little Sister

117

productive. The development of language in humans then allowed for an exchange of suggestions. Within a group or community, the discussion of possible scenarios, of alternative “as ifs”, may lead to an improvement of the choices of actions, which in prehistoric times would have contributed to the welfare of the individual and the group and even may have spelled survival. Moreover, the ability to produce useful plans and suggestions that help to evade danger and hardship may well have been relevant for sexual selection. As Antonio Damasio has argued in his somatic marker hypothesis, decision making involves not only rational planning, but also emotional response – decisions are made in consequence of previous successful decisions which trigger spontaneous bodily reactions when a similar situation arises (cf. Damasio 1998, pp. 165–201). The invention of alternative futures and the discussion of possible courses of action are thus also productive of excitement, pleasure or displeasure, but then even the displeasure may be a source of fascination. Our neurons tend to respond not only to the actual experience, but also to the representation of the experience, albeit in a reduced form – Edmund Burke’s concept of the sublime as “delightful horror” (Burke 1990, p. 67) comes to mind here as the ultimately pleasant response to a situation that would cause terror if it were experienced in reality. These human responses support imagination and the invention of possible or probable worlds, and they can in different circumstances easily be transferred to new and less imperative forms of communication. Decision making is concerned with the future, but narration is equally important for the preservation of the past. Karl Eibl suggests that narrative is a particularly useful form for the transport of significant information – his example is the danger of snakes at a waterhole, which can be transmitted convincingly by a story about a previous experience and enriched with information about the origin of the snakes and possible ways to ward them off (cf. Eibl 2004, p. 257). He adds that stories are also a mnemotechnically superior form for the transmission of content-rich information, and here I would like to add that other aspects we associate with literature proper also come into play. In the early eighteenth century, Giambattista Vico argued in his Scienza Nuova, the New Science, that the first speakers were also poets, and he may well have been correct, if not for fully accurate reasons. He suggested that tropes originally were literally and not only poetically true, as language was not yet fully developed and so the same or similar words had to be used for a variety of different objects and contexts (cf. Vico 1984, p. 131). This may well have been the case, but more importantly, all the elements that Roman Jakobson groups under the huge umbrella terms poetical function or parallelism (cf. Jakobson 1960, passim) also play important roles as

118

Dirk Vanderbeke

mnemotechnical devices.3 Rhymes, alliterations, metre, rhythm, metaphors etc. help us to remember texts, and in a preliterate world they were indispensable tools for the accurate mental storage of information. And the texts that have been handed to us from the pre-literal times are almost invariably poetic in form. This does not necessarily indicate that they were also poetic in their origin, but over the centuries, if not millennia, the alterations that improved on their memorability were retained, because they were better remembered. Moreover, the ability to process and retain information is a valuable asset in a world in which memory is the only possible store for that information. To take pleasure in the form of course helps, and here the adaptive aspect may be of utmost importance. As we know, children from the youngest age onwards take delight in parallelisms, in doubles, rhymes etc., and it is the pure form they enjoy, as the meaning of the first verbal exchanges and also of the nursery rhymes they are confronted with is highly questionable.4 In addition, if repetition favours memory it also favours learning, and the delight in parallelism may ultimately play some role in language acquisition. This pleasure stays with us, and statements in poetic form will be more easily remembered and transmitted – advertising exploits this successfully, and Jakobson’s best example of the poetic function was the election campaign slogan for Eisenhower, “I like Ike”. Actually, the poetic form was in some instances maintained for factual information, Parmenides and Lucretius still used the long poem and a mythological setting for their early “scientific” works, and even in the late eighteenth century some of the works of Erasmus Darwin were written in poetic form. But the number of texts which employed such devices decreased after the introduction of writing as a means of storage. In consequence, texts were now fixed and no longer poetically improved over time. But, as already noted, the pleasure in poetic language remained, and it could now be employed for other, possibly even new purposes, such as lyrical poetry, which may or may not have existed in pre-literate times. I would like to think that it did, as a world without love poetry is certainly an impoverished world, and the ancient Oriental love poetry as found in the Song of Songs indicates a long tradition. But it is not really relevant for the argument presented here that the poetic instinct of humans was originally a tool for memorizing important information, that the delight in the poetic form was, indeed, an adaptation and that poetry as we know it now is a spandrel, a 3 4

For a different, but compatible reading of the significance of parallelism and repetition with variation in the evolution of literature cf. Eibl 2005, pp. 22f. Miall and Dissanayake identified parallelisms and hyperbole, alliteration and assonance, rhyme and vowel matching in a rather short verbal interaction of only about one minute between a mother and her child. They argue that such babytalk plays an important role not only for the affective bond between mother and infant but also for later aesthetic appreciation of literary language and music (cf. Miall and Dissanayake 2003, p. 338).

The Unlovely Little Sister

119

happy side effect of the biologically evolved human characteristic, a universal cultural feature that makes use of adaptive traits without being itself the result of natural or sexual selection. Planning the future and remembering previous fortunate or unfortunate decisions, the exchange of necessary or even vital information and its storage for future use are the phenomena that are at the core of narration, and what we call literature and fiction are late derivatives, which does not make them less important for our world. They help to create communal identities, and serve social cohesion but, less fortunate, also contribute to social exclusion and prejudice. In consequence, they certainly played a significant role in the development of humans as social and cultural beings. But their evolution, the way literature develops and creates new forms and genres, is probably also rather a cultural phenomenon. The ecology of memes is dependent on human evolution, but once the memes have found their habitats, they evolve in their own time and manner, which is far more rapid than biological evolution. But this is no longer within the scope of this paper.

References Bellow, Saul, Humboldt’s Gift [1975], Harmondsworth: Penguin, 1984. Boyd, Brian, On the Origin of Stories, Cambridge, MA, and London: The Belknap Press of Harvard UP, 2009. Burke, Edmund, A Philosophical Enquiry into the Origins of our Ideas of the Sublime and Beautiful [1757], Oxford and New York: Oxford UP, 1990. Damasio, Antonio, Descartes’ Error, New York: Avon, 1998. Dennett, Daniel C., Darwin’s Dangerous Idea, New York: Touchstone, 1996. Dundes, Alan, The Morphology of North American Indian Folktales, Helsinki: Academia Scientarium Fennica, 1964. Eibl, Karl, Animal Poeta. Bausteine der biologischen Kultur- und Literaturtheorie, Paderborn: Mentis, 2004. –, “Biologie und Poetologie auf gleicher Augenhöhe. Mit einigen Hinweisen auf eine biologische Poetik der Wiederholung”, in: Biologie, Psychologie, Poetologie. Verhandlungen zwischen den Wissenschaften, ed. by Walburga Hülk and Ursula Renner, Würzburg: Königshausen & Neumann, 2005, pp. 9–25. Ginzburg, Carlo, The Night Battles: Witchcraft and Agrarian Cults in the Sixteenth and Seventeenth Centuries (I Benandanti [1966], transl. Anne and John Tedeschi), Baltimore: Johns Hopkins UP, 1983. Gould, Stephen J., “The Exaptive Excellence of Spandrels as a Term and Prototype,” in: Proceedings of the National Academy of Sciences 94.20 (September 1997), pp. 10750– 10755. –, The Structure of Evolutionary Theory, Cambridge, MA, and London: The Belknap Press of Harvard UP, 2002.

120

Dirk Vanderbeke

Gould, Stephen J. / Richard C. Lewontin, “The Spandrels of San Marco and the Panglossian Paradigm [1979],” in: Understanding Scientific Prose, ed. by J. Selzer, Madison: University of Wisconsin Press, 1993, pp. 339–356. Gould, Stephen J. / Elizabeth S. Vrba, “Exaptation – A Missing Term in the Science of Form,” in: Paleobiology 8.1 (1982), pp. 4–15. Haug, Walter, “Die Entdeckung der Fiktionalität,” in: Die Wahrheit der Fiktion: Studien zur weltlichen und geistlichen Literatur des Mittelalters und der frühen Neuzeit, Tübingen: Max Niemeyer, 2003, pp. 128–144. Heinrich, Bernd / Thomas Bugnyar, “Intelligenztests für Kolkraben,” in: Spektrum der Wissenschaft 7 (2007), pp. 24–31. Jakobson, Roman, “Linguistics and Poetics,” in: Style in Language, ed. by Thomas A. Sebeok, Cambridge, MA: MIT Press, 1960, pp. 350–377. Lettvin, Jerome, “The Gorgon’s Eye,” in: Astronomy of the Ancients, ed. by Kenneth Brecher and Michael Feirtag, Cambridge MA: MIT Press, 1979, pp. 133–151. Miall, David S. / Ellen Dissanayake, “The Poetics of Babytalk,” in: Human Nature, 14.4 (2003), pp. 337–364. Paley, William, Natural Theology: or, Evidences of the Existence and Attributes of the Deity, London: J. Faulder, 1809 (reprinted at “The Complete Work of Charles Darwin Online,” 29 December 2009: http://darwin-online.org.uk/content/frameset?itemID=A142&viewtype=text&pageseq=1). Pinker, Steven, How the Mind Works, London et al.: Penguin, 1999. Santillana, Giorgio de / Hertha von Dechend, Hamlet’s Mill: An Essay Investigating the Origins of Human Knowledge and Its Transmission Through Myth [1969], Boston: Nonpareil, 1999. Steinig, Wolfgang, Als die Wörter tanzen lernten, Munich: Elsevier, 2007. Vanderbeke, Dirk, “Rhymes Without Reason? Or. The Improbable Evolution of Poetry,” in: Politics and Culture (Special Evolutionary Issue, Bioculture: Evolutionary Cultural Studies), ed. by Joseph Carroll, April 2010 (http://www.politicsandculture.org/2010/04/29/rhymes-without-reason-or-the-improbable-evolution-of-poetry/). Vico, Giambattista, The New Science of Giambattista Vico (Scienza Nuova, transl. from the third edition of 1744 by Thomas Goddard Bergin and Max Harold Fisch), Ithaca and London: Cornell UP, 1984. Waal, Frans de, Primates and Philosophers, Princeton and Oxford: Princeton UP, 2006.

Evolution des Kognitiven

121

Evolution des Kognitiven Nervenzellen, Sprache und kulturelle Adaptationen Olaf Breidbach

I. Ansatz Menschliches Verhalten und auch schon die Erfahrung und die Ordnung von Erfahrungen vollziehen sich in einem Organsystem. Die alte Philosophie sprach von Körperlichkeit, beschrieb Restriktionen und ggf. sogar auch Freiheitsgrade, die dem Menschen durch diese Körperlichkeit und damit gegebene Funktionsausrichtungen und Funktionseinrichtungen erwachsen können und erwachsen (vgl. Reichold 2004). Die moderne Hirnforschung geht nun – zumindest in einigen Interpretationen – noch einen Schritt weiter und fasst Verhalten als die Ausprägung der Physiologie des Hirnorgans, das insoweit für das menschliche Verhalten nunmehr auch als konstitutiv begriffen wird (vgl. Roth 1994; Singer 2002). Kulturentwicklung ist damit letztlich Hirnevolution (vgl. Voland 2007), und auch die Sprache ist damit schließlich als eine Hirnfunktion beschreibbar und so als Resultat einer Evolution zu begreifen (vgl. Fitch et al. 2005; Friederici 2006). Der vorliegende Essay sucht diesem Gedankengang zu folgen. Er zeigt dabei auf, dass eine verengte funktionsmorphologische Analyse der kulturellen Entwicklung in eine Sackgasse führt. Daraus folgt, dass wir den Zusammenhang von Sprache und Evolution in anderer Weise zu denken haben. Kultur erweist sich nicht einfach als etwas, das physiologisch konstituiert ist, vielmehr zeigt sich die Evolution des Menschen gleichsam in die kulturellen Bereiche entlagert (vgl. Tomasello 2009). Was dies bedeutet und wie der Zusammenhang von (Hirn-)Evolution und Sprachentwicklung zu denken ist, sucht der vorliegende Text in ersten Konturen zu umreißen. Dabei ist zunächst zu fragen, wie sich die Außenwelt, in der wir uns orientieren, im Hirn repräsentiert ist (vgl. Breidbach 2000a). Hieraus lässt sich dann die Frage ableiten, inwieweit Kultur schon in der Analyse von Wahrnehmungen als evolutionäre Adaptation zu verstehen ist und ob dazu ein vereinfachendes Funktionsverständnis des Verhaltens eines Organismus – wie etwa des Menschen – in seiner Umwelt ausreicht.

122

Olaf Breidbach

II. Wahrnehmungen Wahrnehmungen sind an eine Sensorik gebunden. Sie werden über ein Hirn vermittelt, und sie finden sich in einer Kultur, die wir selbst nicht als solche, sondern vermittelt über die uns eigenen Sinnesorgane erfahren. Erinnert werden die Bilder, die uns die Sinnesorgane vermitteln, unsere Stimmungen und Reflexionen zu diesen Bildern. Dieser Komplex von Eindrücken und Bewertungen bildet unsere Erfahrung. Eine Darstellung eines solchen Erfahrens kann also nicht umhin, sich mit den Bedingungen auseinanderzusetzen, in denen sich Erfahrung ausformt. Sie muss sich fragen lassen, ob Wahrnehmungen derart als Komplex von hirneigenen und durch die Aktivierung der Sinnesorgane induzierten physiologischen Reaktionen darzustellen sind. Schließlich ist Erfahrung nichts Abstraktes, sondern ein sehr konkreter, durch unsere Sinnesorgane mit ihrem Ansprechverhalten und die mit ihnen umgehenden neuronalen Verrechnungsprogramme bestimmter Prozess.1 Dieser Beschreibungsansatz ist nicht allzu originell. Schon die wissenschaftliche Anthropologie des beginnenden 19. Jahrhunderts zeichnete unsere Wahrnehmungen als Resultat des funktionellen Systems Sinnesorgan & Hirn (vgl. Regenspurger und van Zantwijk 2005). Sie suchte zu verstehen, was hier wie von den Sinnesorganen als Reiz aufgenommen und weitervermittelt wurde. Es war klar, dass auf diese Weise die so gewonnenen Eindrücke unserer Umwelt nicht als solche archiviert, sondern nach den Mustern der hirninternen Verrechnungsprogramme bearbeitet wurden. Es galt nunmehr, den Zusammenhang zu verstehen, in dem sich bestimmte Reizeingabereaktionen und darauf ausgerichtete Verhaltensweisen aufeinander bezogen. Wie dicht etwa war deren Zuordnung, wie rasch konnte ein Organismus auf einen für ihn wichtigen Reiz reagieren? Eine Antwort hierauf und eine Darstellung des Verhältnisses von Reizintensitäten und der Größe einer sich darauf beziehenden Verhaltensantwort versprachen erste Aussagen zur Qualität des Verrechnungsprozesses und zugleich Klarheit darüber, wie eindeutig die Zuordnung bestimmter Reizeingaben und darauf folgender Verhaltensweisen zu bestimmen war. Die Psychophysik suchte in derart ausgerichteten Versuchen das Phänomen Wahrnehmung einzugrenzen, die Teilkomponenten in diesem Funktionsprozess zu identifizieren und in ihrer Abstimmung darzulegen (vgl. Heidelberger 2004). Sie konnte damit Mechanismen bestimmen, die wir nutzen, um zu einem Bild zu finden; und diese vermochte sie zugleich auch als Vorgaben für jede Weltsicht zu identifizieren. Es sind dies ja nicht einfach nur Filter, die aus einer vorgegebenen Fülle möglicher Daten über unsere Umwelt bestimmte Teilbereiche herausgreifen. In dieser Mechanik des Wahrnehmungsprozesses werden vielmehr die Daten in einen Bezug gesetzt, der aus ihnen ein Ganzes bildet, das wir 1

Vgl. für den Ansatz etwa: Breidbach 1993.

Evolution des Kognitiven

123

dann als Welt benennen. Dies setzt schon auf einer einfachen Ebene an: So orientieren wir uns visuell in einem Raum, den wir als solchen gar nicht präsent haben, da wir immer nur das sehen, was in unserem Blickfeld ist, das, was hinter uns abläuft, aber nicht zugleich erfahren, sondern lediglich als Erinnerung abrufen können. So können wir, wenn wir uns umdrehen, das, was wir erfahren, als Teil eines Ganzen sehen, das wir faktisch nur in Portionen erleben. Dass wir unseren Wahrnehmungsraum derart fragmentieren, wird uns im Wahrnehmen allerdings nicht bewusst. Wir müssen auch erst lernen, bestimmte sensorische Qualitäten aufeinander abzustimmen und sie dann in einem Wahrnehmungsgefüge direkt zuzuordnen. Wir bilden uns dafür einen Vorstellungsraum, in dem wir eine Vielfalt von uns erreichenden Signalen abbilden. Dies gilt in einer ersten sehr einfachen Näherung sogar schon für die innere Repräsentation des Bildes, in dem wir uns das, was unser Auge abbildet, zusammensetzen. In dem Bereich, in dem der Sehnerv aus dem Auge ins Hirn abgeht, besitzen wir keine Sinneszellen. Unser Auge hat also einen Bereich in seinem Sehfeld, in dem es nichts abbildet, den sogenannten blinden Fleck. Dieser wird in unserer internen Bildverarbeitung durch imaginäre Ergänzungen überbrückt. Wir sehen diese Lücke in unserem Wahrnehmungsgefüge schlicht nicht, denn sie wird automatisch, entsprechend den wahrgenommenen Mustern im Umfeld des blinden Fleckes, aufgefüllt. Unsere Wahrnehmung folgt, das zeigt sich schon auf dieser sehr vordergründigen Ebene, Vorgaben, die durch die Verrechnungseigenarten des Nervengewebes bestimmt sind. Sie strukturiert sich gleichsam nach diesen Vorgaben. So können wir neue sensorische Qualitäten technisch nachbilden und auf unsere bisherigen Muster beziehen. Wir strukturieren dabei unsere neu gewonnenen Wahrnehmungsbereiche so, dass wir sie auf ein uns bekanntes Wahrnehmungsfeld, meist den optisch wahrgenommenen Raum, beziehen und nach dessen Eigenarten strukturieren. So werden die Daten, die uns ein Radar oder ein Echolot vermitteln, in ein optisch zu erfahrendes Raumbild umgesetzt. Wir strukturieren uns die Impulse, die ein Tunnelelektronenmikroskop vermittelt, in der Art einer geographischen Karte des letztlich gar nicht mehr topographisch zu bestimmenden Verhaltens der so dargestellten Kleinstkomponenten. Dabei wissen wir, dass wir uns, wollen wir in solchen Darstellungen etwa das Weltbild einer Fledermaus darstellen, in einem Grenzbereich bewegen, der uns diese Fledermaus, wie es Nagel sehr drastisch beschrieben hat, nur in Analogie zu dem uns möglichen Erfahrungsraum darstellt, nicht aber an sich in ihren Erfahrungen vermittelt (vgl. Nagel 1974). Wir können von einem Verhaltensforscher erfahren, dass diese Tiere Orientierungsleistungen vollbringen, die sich mit unserer Darstellung von Raumbildern nur schwer begreifen lassen und schließlich zeigen, dass diese Tiere ggf. ein ganz anderes Strukturierungsschema für die sie erreichenden Daten nutzen. Das be-

124

Olaf Breidbach

trifft etwa das Jagdverhalten bestimmter Fledermäuse, die einen Nachtfalter, der in einer bestimmten Bahn vor ihnen fliegt, nicht einfach orten, sondern im Echosignal bestimmte Veränderungen des Flügelschlagprofils wahrnehmen und so verschiedene Arten (und dabei etwa auch giftige und ungiftige) unterscheiden können (vgl. Griffin et al. 2006). Wahrnehmungen folgen – das zeigt sich hier – vorgegebenen Mustern, und dies schon in den ersten Schritten der Reizaufnahme und der Verrechnung der entsprechenden so induzierten Signale. Insoweit zeichnet unsere Sensorik nicht einfach nur die Qualitäten eines dann so als gegeben darzustellenden Raumes nach. Diese Wahrnehmung gewinnt ihre Form vielmehr in den Vorgaben der uns eigenen Verrechnungseigenheiten (vgl. Aviel et al. 2002). In diesen bestimme ich die Gegenstände meines Wahrnehmens. Dies ist nichts anderes als die alte transzendentalphilosophische Wahrheit, der zufolge unsere Erfahrungen zunächst etwas darüber aussagen, wie wir unser Erfahren formen.

III. Hirneigenheiten Die hier nachzufassenden Vorgaben sind nun nicht nur Erfahrungsmuster, denen zufolge bestimmte Attribute, wie etwa Farben und Gerüche, nach bestimmten Kriterien bewertet und differenziert werden. Diese Vorgaben bestimmen auch grundsätzliche Ordnungsfunktionen: Ich erfahre einen Raum, in dem ich Momente meines Erfahrens ordne. Dieser Raum ist in der Art und Weise, wie ich ihn erfasse, ein Konstrukt (vgl. Marr 1982). So gibt es etwa – objektiv – auf der Retina keine gerade Linie. Die rechten Winkel unseres visuell erfahrenen Umfeldes sind vielmehr re-konstruiert, aus einem Wissen um die Zuordnung bestimmter Teilmomente in unserem Wahrnehmungsfeld bestimmt und dann in die von uns erfahrenen Daten eingelesen. Doch weit darüber hinaus führt uns eine Physik, die aufweist, dass die spezifischen Bedingungen der von uns erfahrenen (physikalischen) Raum-Zeit keineswegs universale Größen darstellen, sondern gebunden sind an eine ganz bestimmte Art und Weise, physikalische Daten in einen Bezug zueinander zu setzen. So sind denn auch Raum und Zeit (als physikalische Parameter einer dann nach ihnen zu strukturierenden Natur) nicht einfach die von diesen vorgegebenen Größen, sondern zunächst einmal die Formen, in denen wir uns unsere Physik beschreiben. Doch selbst in unserer Beschreibung sind diese Formen nicht eindeutig einander zuzuordnen. Die physikalische Zeit, in der wir Wirkfolgen betrachten, und die Zeit unseres Erlebens sind nicht identisch. Nicht nur, dass sie sich unterschiedlich dimensionieren und sich damit der Zeittakt im Erleben anders bestimmt als der Takt der physikalischen Zeit. Die Erlebniszeit ist zudem in anderer Weise konstruiert, sie wird nicht als eine durchlaufende

Evolution des Kognitiven

125

Sequenz, sondern als eine immer wieder auf das Jetzt, die Gegenwart zu beziehende Größe verstanden (vgl. Florey und Breidbach 1993). Zudem ist unser Nervensystem auch schon selbst in seinem Zeittakt seiner eigenen Funktionalität unterworfen. Die Verrechnungsprozesse benötigen Zeit, und je nach dem physiologischen Programm, der Art und Weise, wie sich Teileinheiten in diesem Funktionssystem verkoppeln, sind diese Zeiten von unterschiedlicher Dauer. Wir kennen verschieden wirkende chemische Botenstoffe, über lange Zeiträume modulierende Hormone und auch sehr schnelle, direkte Kopplungen zwischen Nervenzellen. Nichtsdestotrotz operieren Nervenzellen nicht allzu schnell. Entsprechend wird im Nervensystem – etwa in der Verrechnung eines Sinneseindrucks – ein komplexer Stimulus in Teilkomponenten zerlegt, die dann parallel zueinander bearbeitet werden (vgl. Rusch et al. 1996).2 Damit wird die Erfahrungseinheit, in der wir eine Abfolge in der uns interessierenden Umwelt bestimmen, im realen Verrechnungsprozess zunächst aufgegeben. Die Zeitfolgen des erfahrenen Gefüges von aufeinander abgestimmten Einheiten des Außenraums werden so in ein Raum-Zeit-Programm, ein Nebeneinander-Takten von ggf. in unterschiedlicher Wiese prozessierten Teilfunktionen aufgelöst. Es sind demnach das Zeitmuster der Außenwelt und das Zeitmuster von deren Verrechnung nicht identisch; oder umgekehrt: Das dann erfahrene Muster einer Außenzeit wird von uns in seiner konkreten Abfolge aus den zunächst parallel zueinander verlaufenden Verrechnungsschritten konstruiert. Dabei ist die Abfolge, in der wir etwas erfahren, keineswegs so schnell, wie uns dies, wenn wir auf unsere Einfälle zurückblicken, vielleicht erscheinen mag. Der Geistesblitz ist – physiologisch gesehen – ein vergleichsweise langsames Ereignis. Es gibt damit aber auch – sehe ich einmal von der grundsätzlichen transzendentalphilosophischen Pointierung unserer Anschauungsformen ab – physiologisch zu bestimmende Vorgaben der uns möglichen Wahrnehmungen, Formationsvorgaben, die uns in unserem Denken und Erfahren bestimmen.3 Wir denken, indem wir unser Gehirn gebrauchen. Wir fangen uns demnach in einer Physiologie, in der eine Vielfalt von Einzelreaktionen zu verknüpfen sind, die jeweils Zeit brauchen. Das Nervensystem hat auch so etwas wie eine Auflösungsgrenze. Von unseren Augen kennen wir dies, denn wir können diese Auflösungsgrenze dafür nutzen, eine diskontinuierliche Folge von Bildern in ein Erfahrungskontinuum umzusetzen. Die Bildfolge eines Films zeigt uns, wie dies funktioniert. Nun nutzen wir aber dann, wenn wir uns derart selbst austricksen, nicht etwa einen freien Raum physiologischer Unbestimmtheit, sondern fangen 2 3

Hierzu detaillierter Engel et al. 1997; Engel und Singer 2001; Rodriguez et al. 1991. Vgl. hierzu generell: Breidbach 1999; Breidbach 2007.

126

Olaf Breidbach

uns vielmehr in den physiologischen Vorgaben unserer Organisation, die ebenso die Reaktionen der einzelnen Zellen wie auch deren Verknüpfungsverband bestimmten. Derjenige, der Kaffee trinkt, um seine Konzentration zu erhöhen, nutzt nichts als die Physiologie seines Körpers, die diesen auf das zugeführte Koffein in der gewünschten Weise reagieren lässt. Es bedarf aber nicht erst der Drogen, um das Eigenleben des Gehirnes erfahrbar zu machen. Unsere Assoziationen, in denen wir einzelne Erfahrungen verknüpfen und nach den uns zugänglichen Erfahrungsmustern verbinden, zeigen in gleicher Weise auf, wie wir an unsere Einbildungen und die Gesetzmäßigkeiten eines physiologischen Umgehens mit ihnen gebunden sind. So wird der, der von einem Wecker aufgeschreckt wird, sich vielleicht noch in seinem Traum daran erinnern, dass sich eine Bildfolge seiner Traumwelten zu einer Handlung verdichtete, in der dann dieses Weckgeräusch fast notwendig erklingen musste. Die so gefundene Ordnung ist aber nur eine rekursive, in der wir kurz nach unserem Erwachen die Erinnerungen an die kruden Bildfolgen unserer Traumwelt in ein Ordnungsgefüge bringen, das es uns erlaubt, diese Bildvielfalt als Einheit und damit überhaupt als solche zu erfassen. Nun führte es in diesem Zusammenhang zu weit, eine umfassende Physiologie des Wahrnehmens vorzulegen. Deutlich wird aber, wie sich die Außenwelt nach den Vorgaben der Verrechnungseigenheiten des Hirnes strukturiert, wie wir demnach eine Welt schon in unserer Erfahrung deuten. Dies mag zunächst nur vorsichtig gegenüber Beschreibungen machen, in denen die Hirnfunktionen als Effekt einer funktionellen Abstimmung gezeichnet sind (vgl. Zeki 1993). Wahrnehmungen verweisen zunächst auf Binnenbestimmtheiten, in denen sie in eine Ordnung finden. Wahrnehmung ist zugleich aber mehr als eine Projektion ererbter oder erworbener Erfahrungsmechanismen auf unsere Außenwelt. Derartige funktionelle Zuordnungen kennzeichnen das Instinktverhalten, in dem das Tier gleichsam nach einem Reiz sucht, der ein vorgegebenes Verhaltensprogramm auslösen kann. Entsprechend eng und fixiert sind die in solch einer Verhaltensorganisation zu erarbeitenden Freiräume im Verhaltensablauf (vgl. Lorenz 1978). Die derart instinktgeführten Tiere müssen diese Verhaltensweisen nicht erlernen; das fixierte Programm läuft nach seiner Auslösung vielmehr entsprechend den schon fixierten Vorgaben ab.

IV. Erfahrungszusammenhänge Die Biologie des Menschen ist im Bereich des Orientierungsverhaltens aber anders organisiert (vgl. von Campenhausen 1993). Das heißt nun nicht, dass sich das Wahrnehmungsverhalten einfach als funktionsbestimmter neurona-

Evolution des Kognitiven

127

ler Verrechnungsprozess kennzeichnen lässt. Vielmehr kann hier eine erste Darstellung unseres Umgehens mit Erfahrungen schon eine weiterführende Perspektive eröffnen, die vielleicht vorab zu benennen ist. Denn bereits auf der Ebene einer Beschreibung von Wahrnehmungsvorgängen zeichnet sich ein Grundproblem ab, das zunächst unter der Perspektive des Umgehens mit und des Mitteilens von Erfahrungsurteilen zu beschreiben ist sowie anschließend in einer allgemeinen Perspektive, die die Form des Beschreibens insgesamt thematisiert. Schließlich ist ja schon die Zuordnung verschiedener Phänomene in ein Wertgefüge ein Tun, das über die unmittelbare Reaktion auf eine Gegebenheit hinausgeht. Wenn in solch einer Aktion zwei oder mehrere Individuen reagieren, erlaubt es zu fragen, inwieweit der Bezug der so erfolgenden Handlungen in und für diese Aktion vermittelt ist oder ob es möglicherweise zureicht, in einer entsprechenden Abstimmung nur eine gestufte Reaktion auf ein allen gemeinsames Perzept anzusetzen. Wenn dann aber noch entsprechende Bezüge tradiert (d.h. über einen jeweiligen momentanen Erfahrungsbezug vermittelt und also in einer Kultur, in einen Kodex von Zuordnungen übernommen und als solcher weitergereicht) werden, gewinnt die Form solcher Tradierungen ein besonderes Interesse. Deutlich wird rasch, dass es dabei entweder darum geht, einen Erfahrungszusammenhang möglichst umfassend zu erinnern und in seiner Komplexität verfügbar zu halten – dies leistet etwa ein Bild; oder aber diesen Erfahrungszusammenhang in den Momenten, die von ihm einsichtig sind, auch losgelöst von der konkreten Konstellation eines bestimmten Erfahrungszusammenhanges zu sichern und als Raster möglicher Zuordnungen auch anderer Erfahrungszusammenhänge zu nutzen – dies leistet die Sprache. Dabei scheinen Bild und Sprache auf zwei sehr verschiedenen Ebenen anzusetzen. In der Sprache wird eine Erfahrungslandschaft nicht in ihrer konkreten Textur möglicher Eindrücke, sondern in ihrer Struktur, respektive in der in ihr erfassten Struktur vermittelt. Dahingegen ermöglicht es das Bild, die Textur zumindest der erfahrenen Bezüge möglichst umfassend zu speichern, womit es im Ideal ggf. auch über den Bereich des bloß Visuellen auszudehnen wäre. Filme, die mit Ton unterlegt sind, und andere denkbare Erweiterungen eines solchen Memorierungsprogramms zeigen eine Richtung auf, die der sprachlichen Vermittlung, in der eine solche Komplexität in Serien von Narrationen aufgelöst ist, doch nur sehr entfernt zu entsprechen scheint. Hier, in der umfassenden Reproduktion des Erfahrenen, scheint zudem eine sehr viel einfachere Instanz einer Realitätsversicherung benannt, als es die einer sprachlichen Fassung sein kann. Allerdings war – und das zeigt schon die Diskussion um die sogenannte mechanische Objektivität, der zufolge im mechanisch / chemisch fixierten Fotogramm die Natur der Dinge quasi an sich selbst darzustellen ist (vgl. Daston und Galison 2007) – eine derart vereinfachende Interpretation von

128

Olaf Breidbach

Repräsentationen obsolet geworden (vgl. Breidbach 2001). Es ließ sich zeigen, dass die Detaillierung des Bildes allein nichts darüber aussagt, was in ihm an Inhalten tradiert wird. Zu zeigen ist, dass schon die technischen Verfahren hier Qualitäten selektieren, Wahrnehmungsinhalte nach vorgegebenen Erfahrungsrastern formen und insofern nur dann, wenn sie auf einer avancierten Bildkultur aufsetzen, wirklich umfassende Erfahrungsgefüge vermitteln können. So muss einer entsprechenden Kultur ein bestimmtes Wahrnehmungsraster, eine bestimmte Art, Räume zu erfahren, Farbe, Licht und Schatten zuzuordnen, deutlich sein, um die Bilder nicht nur einfach als Entsprechungen des Anderen, sondern als in der Tat detaillierte Informationen vermittelnde Darstellungen begreifen zu können. In der Tat sind Bilder ja nicht an sich vermittelt. Das Bild, das ich in einer Situation reaktivieren oder mir vor Augen führen kann, habe ich zu verstehen, zu interpretieren, in seiner Struktur aufzuweisen, um in ihm die Details erkennen zu können, die mir dann eine eingehende Zuordnung des tradierten Bildes mit einem momentanen Perzept ermöglichen. Es muss ja immer jemand auf das Bild schauen, das tradiert wurde, er muss es interpretieren und dabei auch die technisch bedingten Vereinfachungen des Bildes, die materialbedingten Verformungen der Wiedergabe erfassen, um so das Tradierte mit dem momentan Verfügten vergleichen zu können. Das Interpretament ist Voraussetzung dafür, das tradierte Bild nutzen zu können – und nicht umgekehrt. Dabei sind wir in unserer Kultur daran gewöhnt, Erfahrungen zu beschreiben und eine dichte, uns in einem konkreten sensorischen Erfahrungsvorgang liegende Erfahrung in eine Erzählung umzuformen. Wir werden sogar beim Blicken in uns selbst, wenn wir uns an einen Erfahrungszusammenhang erinnern, diesen in einer sprachlichen Abbildung wiederfinden. Finden wir so einen Verweis auf ein vergangenes Erleben, so können wir, ausgehend von dieser Erinnerung an das zuvor erlebte Geschehen, an uns selbst Fragen stellen, in denen wir uns sukzessive, in einer internen Anfrage an das, was uns noch erhalten ist, den zunächst nur in ersten Konturen erahnten vormaligen Erfahrungsraum vergegenwärtigen. Dann, wenn wir uns eines ersten Momentes dieser Erinnerung sicher sind, können wir weiter fragen und unser Erinnerungsbild so zusehends verdichten. Oder aber wir werden durch einen Eindruck, z.B. einen Geruch, gleichsam direkt in eine Stimmung zurückversetzt, erfassen in ihr ein Bild, das wir dann, ausgehend von dieser Stimmung, sukzessive konturieren. Wir halten damit eine Erinnerung fest; fragen aber auch in diesem Bild wieder nach, suchen dieses zu halten, indem wir es uns selbst erzählen. Fassen wir es derart in dem uns so in Bezug auf das Raster unseres derzeitigen Wissensbestandes zugänglichen Zusammenhang, so gewinnen wir weitere Konturen, in denen wir uns dann immer mehr Details vergegenwärtigen. Damit können wir auch Heutiges, das wir mit Bezug auf die vormalige Erfahrung in einen Vergleich setzen, in neuem Licht sehen und so unsere Erfahrung von

Evolution des Kognitiven

129

heute im Bewusstsein des Erfahrenen, d.h. in Bezug auf eine Erinnerung, reorganisieren. Dies führt in eine Erfahrungsdimension hinein, die nicht mehr nur einfach als Abbildung einer Sinneserfahrung verstanden werden kann. In der Gestaltung solcher Erfahrungen sind Zuordnungen zu finden, die sich zwar explizieren lassen, die aber nicht einfach eine Erzählung und damit eine begrifflich geschichtete Welt als Bezugsgröße unseres Erfahrens ausmessen. Es ist hier mehr greifbar. Zu erfassen ist eine Vernetzung zwischen Explikation und einer in der Erfahrung vorgegebenen Zuordnung. Diese kann dann in einer Erzählung abgelegt werden, so dass sie in deren Verdichtung für das begrifflich operierende Denken verfügbar bleibt. Dennoch zeigt aber diese Situation, dass sich die Erinnerung nicht einfach in dieser Begriffsfolge erschöpft. Zwar wird sie an dieser expliziert, doch kann sie selbst nicht einfach auf diese Nacherzählung reduziert werden. Die Begriffe bilden vielmehr Anknüpfungspunkte, Zuordnungen, in denen ein Bild greifbar wird, das über das momentane Verfügen hinaus bestimmbar bleibt, mit dem ich weiter umgehe, das ich mit wachsender Erfahrung neu interpretiere, ohne es doch zu verlieren. Es wird zu überlegen sein, ob das, was wir hier Stimmung nennen, nur der Nachhall eines sensorischen Eindrucks ist oder ob nicht schon auf dieser Ebene der Stimmung eine Abstimmung erfolgt ist, in der sich überhaupt solch ein Bild halten kann, das ja mehr ist als die Erzählung, in der wir uns dieses Bild vergegenwärtigen. Umgekehrt, wir brauchen für unsere Erzählung Rückhalt in einer Vorstellung, auf die sich diese Erzählung bezieht und die wir in dieser Erzählung abbilden. Nur dann, wenn sich derart der Text, in dem wir auch für uns selbst unsere Erinnerung beschreiben, noch offen dafür hält, über ihn ein Erinnerungsbild zu reaktivieren oder überhaupt eine Vorstellung wiederzugewinnen, die wir in den Begriffen unserer Erzählung beschreiben, bleibt dese Erinnerung für uns verwertbar. Sie ist nicht nur an sich bestimmt, sie erlaubt es uns so, uns selbst in neuen Zusammenhängen immer wieder neu zu bestimmen, ohne uns mit unseren Erinnerungen dabei selbst zu verlieren. Hier können wir etwas, von dem wir noch nichts wussten, mit dem vergleichen, was wir kennen, ohne nur in einer Erzählung über das uns schon Bekannte verbleiben zu müssen. Wäre dies so, wäre die Erinnerung nur auf die Begriffe reduziert, so wäre sie dann auch in den Begriffen und deren ggf. wechselnden Bestimmungen eingeschlossen. Sie wäre nicht mehr Erinnerung, sondern nur Teil eines Wissens, in dem sie sich sukzessive als Einzelheit verlöre. Damit wäre in dieser Auflösung des Erinnerns nun aber der Rückbezug des Ichs auf sich selbst aufgelöst. Es selbst wäre als Einheit verloren, in der sich die Vielfalt des Erinnerns zu einem Ganzen bindet. Aber nur dann, wenn dieses Ich derart über den Moment und so auch über das momentan verfügbare Wissen hinausweist, weiß es, worüber es redet.

130

Olaf Breidbach

Der Rückbezug auf ein Vorläufiges zeigt auch das Jetzige als ein Moment, einen Übergang, der sich so nicht in sich selbst genug sein kann. Dieser Rückbezug schreibt nun aber nicht etwa eine vormalige Bestimmung fort, sondern differenziert. Er positioniert das Momentane und gibt diesem in Bezug auf seine Bedingtheit Bestimmung. So vergewissert sich das Momentane in einem Prozess, der über die Erzählung verfügbar bleibt. In deren Begriffen kann sich dieser Rückbezug „verankern“; dadurch, dass über sie eine Erinnerung verfügbar wird, die sich in den einzelnen Bestimmungen fangen und in der weiteren Konturierung des vormaligen Bildes beschreiben lässt, zeigen sich Verschiebungen etwa zu der momentanen Nutzung einzelner Begriffe. So entdecke ich im Bekannten Neues. Es eröffnen sich Zuordnungsmöglichkeiten. Wird demnach etwas in den Blick genommen, das mir so nicht bekannt war, kann ich nun auch dieses bisher Unbekannte mit meinen Erinnerungen vergleichen und auch von diesem im Vormaligen Konturen entdecken, die mir zunächst nicht aufgefallen waren. Im Nachhinein aber ermöglichen sie es, auch das völlig Neue in ein Erfahrungsraster einzubinden, in dem sich nunmehr vorliegende Ordnungen neu verknüpfen und damit Bestimmungen dieses Neuen finden lassen. Hier legt sich in den Erinnerungen etwas an, was ich mit dem Unbekannten vergleichen kann. Aus dem Vergleich erwächst dann eine Einbindung dieses Neuen. Dies lässt sich so abgrenzen, da es sich auf das Bekannte beziehen lässt, und so in dieser Abgrenzung selbst sukzessive einbinden. Dabei passen sich Repräsentation und Erwartung, wie sie sich im Erinnerungsbild fixieren lassen, ein. Ich erkenne diese Erwartung als solche, löse sie aus der Gewissheit einer sich nur in sich findenden Bestimmung und gewinne nicht nur Neues, sondern rekonturiere auch das Alte. Es mag an dieser Stelle sehr spekulativ erscheinen, derart in fast metaphorischer Weise über einen Versicherungsvorgang von Erkennen zu schreiben, wo doch gerade die Alternative einer klaren Rückbindung an ein physiologisches Verständnis von Wahrnehmungsfunktionen expliziert wurde, wobei die Erinnerung einen Reflex der neuronalen Aktivitätsmuster und ihre Zuordnung eine Assoziation des schon Eingelesenen mit neu Eingelesenem darzustellen schienen (vgl. Breidbach 2000b). Wichtig aber ist schon die erste Einsicht, dass es nicht einfach die Bilder sind, die hier eingelesen werden, und dass es auch nicht zureicht, die Bilder – neuronal umschrieben – als die in die physiologischen Funktionen des Hirnes transformierten Repräsentationen sensorischer Stimuli zu begreifen (vgl. Rusch et al. 1996). Der hier geschilderte Prozess ist komplexer und verzahnt Sprache und Vorstellung in einer vertrackteren Weise.

Evolution des Kognitiven

131

V. Sprache und Sprachlichkeit In der Sprache fasst sich dabei ein Phänomen, das nicht einfach als Reflex einer sensorischen Versicherung zu beschreiben und auch nicht nur an individuelle Memorialfunktionen gebunden ist, sondern das sich in Form eines Textes auslösen, externalisieren, vermitteln und ggf. auch abspeichern lässt. Dass nun diese Texte zureichen, derart eine Zuordnung möglicher Erfahrungen zu eröffnen und dann in der Formulierung von Neuem dem individuellen Erfahrungsschatz des Lesers neue Zuordnungen zu ermöglichen, eigene Welten zu erschließen, ja Stimmungen des eigenen Erlebens in einen weiteren Horizont zu setzen und so am Text (etwa eines Buches) ein anderes Erfahren für sich selbst verfügbar zu machen, zeigt die Dichtung (vgl. Fischer-Lichte et al. 2006). Deren Sprache führt an Vorstellungen, die wir selbst durch diese Sprache erst gewinnen. Sie kann dabei, formuliert sie für uns neue Kombinationen, Erfahrungsbereiche eröffnen, Realitäten entdecken, die sich für den Leser zunächst nur in der Sprache finden. Aber auch derjenige, der philosophiert und dabei seine Ideen in einem Text abbildet, führt seinen Leser in eine eigene Vorstellungswelt, die Letzterem vielleicht erst durch diesen Text als solche eröffnet wird. Er setzt dabei die Worte derart ein, dass derjenige, der den Text liest, Zuordnungen nachformulieren kann, wie sie im Gefüge seiner Sprache möglich sind. Er kann so in ein umfassendes Feld weiterer Zuordnung geführt werden. Dort können nun in den möglichen Kombinationen neue Muster angelegt werden, wie in einem Kaleidoskop, wo solche Muster in immer wieder neuer Zuordnung der vorgegebenen Teile entstehen. Vielleicht führt der Text sogar zu einem Spiel, das diese Art der Kombinatorik offenkundig macht und so die Vielfalt der möglichen Einsichten aufweist. Damit wird ein entsprechender Text nicht einfach nur auf der Ebene dessen, was er direkt darstellt, verbleiben, sondern einen Hinweis darauf geben, wie derartige Kombinationen überhaupt möglich sind und was es bedeutet, wenn wir von Ordnungen oder Mustern reden. Die Sprache führt so über den Text hinaus, zeigt in ihm eine Möglichkeit von Zuordnungen auf, in denen sich Vorstellungen neu verfugen. Sie setzt den Text ins Bild und gewinnt damit vielleicht etwas, das dem entspricht, was wir in der Erinnerung finden, in der wir im Bekannten ja auch noch mehr als das an ihm Explizierte aufzuweisen vermögen und damit auch die Erfahrung von heute neu akzentuieren können. Oder aber die Sprache führt uns am Text auf sich, setzt wie bei James Joyce Sprachstimmungen frei, offeriert uns Bilder im Gefüge der möglichen Zuordnungen, die die Erzählung zu benutzen scheinen, um sich selbst als Sprache ins Bild zu bringen (vgl. Joyce 2005): „Sacrifizio incruento, Stephen said smiling, swaying his ashplant in slow swingswong from its midpoint, lightly.“ (Joyce 1977, S. 227). Es sind die Klangbilder der Wortfolgen, in de-

132

Olaf Breidbach

nen über das, was explizit ist, ein Stimmungsbild und in diesen Anleihen an eine im Wortgefüge selbst aufscheinende Wirklichkeit formuliert ist, in dem die Sprache gleichsam noch einmal über das Gesagte hinaus tönt und so sich selbst zum Klingen bringt. Es ist letztlich belanglos, was im Ulysses ein besoffener Besucher einer Kneipe in Dublin in seinen Sätzen aussagt, es wird aber wichtig, wie sich in diesen Aussagen eine Textur von Bezügen sprachlicher Möglichkeiten und Stimmungsphasen verzahnen. Diese werden dann im Text gleichsam in eine Melodie überführt, die sich in mehreren Ebenen – dem Klang, den Bedeutungszuordnungen – gegenüber der trivialen und somit kontrapunktischen Textaussage zu einem Ganzen zusammenfügt. Dieses Ganze baut eine Stimmung auf, in die wir so, wie durch die Dramaturgie eines Films geführt, eingetaucht werden. Dabei sehen wir dann, indem wir uns dem Sprachfluss überlassen, uns an der Melodie entlang führen lassen, wie eine neue Wirklichkeit erwächst: die Textualität der Sprache selbst und das sich in ihr explizierende Assoziationsgewebe, das uns verdeutlicht, was das denn ist, das wir mit Kultur umschreiben. Zu fragen ist natürlich, ob diese Momente unseres Erlebens nicht immer auch als biologische Funktionen zu beschreiben sind. Ist der Text eine Abbreviatur eines Erregungsgefüges, das eine Art von Reaktivierungsstimulus für das Hirn darstellen kann? Schließlich muss ich den Text lesen, ihn über die Augen aufnehmen, in ein Gefüge einer internen Verrechnung einspannen und ihn damit in die Assoziationsschichtungen einspeisen, in denen – wie beschrieben – das Hirn funktioniert. Wäre also die Sprache auch in dieser avancierten Form demnach als Resultat einer Evolution zu fassen? Die simple Antwort, Sprache als Verhaltensausprägung der Spezies Homo sapiens zu fassen und sie so schlicht als Resultat einer Evolution zu denken (Sprachzentren, Kehlkopf und Kleinhirnzentren als etwaige Bereiche solch einer Sprachentwicklung zu begreifen, deren funktionelle Adaptation zu klären ist), ist gegenüber dem entworfenen Szenario zu einfach (vgl. etwa Taub 1993). In diesem Gedankenansatz ist ggf. über die Entstehung von Kommunikationsformen nachzudenken, mit denen dann die speziellen Verhaltenserfolge des Menschen zu deuten wären. Die Evolutionsbiologie könnte Szenarien ausweisen, in denen es dazu hätte kommen können, dass sich solch ein Verhalten und die damit verbundenen Strukturausprägungen stabilisierten. Nur endet diese vereinfachende Form einer Betrachtung von Evolution und Sprache genau dann, wenn sich die Sprachfähigkeit des Menschen etabliert hat (vgl. Cangelosi und Parisi 2002). Literatur wäre dann nichts als das surplus einer Evolution, die in den in ihr erwachsenen Organismen (gleich den ein Sprachprogramm abarbeitenden Robotern, die das Museum für neue Medien im Karlsruher Zentrum für Kultur der Medien ausstellt, vgl. Link, 3.3.2010) einfach nicht anders kann, als das zu produzieren, was sie ihnen ermöglichte: Sprache. Mit solch einer Sicht auf eine sich in ihren eigenen Gesetzen verfangende Natur, die

Evolution des Kognitiven

133

sich selbst entäußert und in diesen Äußerungen dann interessanterweise auch wieder zu sich zurückfindet (wenn sich in dieser Literatur dann die Natur bestimmen lässt, in der solche Literatur entstanden ist), wird reichlich wenig erklärt. Zumal diese Sicht die Existenz von Bildern davon voraussetzt, (a) wie Hirnevolution zu denken ist und (b) wie Sprache in dieser Hirnevolution bedeutsam wird. Dabei ist dann aber Sprache auch nicht einfach auf das zu reduzieren, was in dieser Sichtweise darzustellen ist (so als sei dies nur ein sich zusehends komplizierendes Etikettengefüge im Schilderwald der Verhaltensverweisen), sondern als etwas, das in seinem Selbstverweis auf sich nicht nur Signale immer besser zu benennen erlaubt, sondern überhaupt auch Sichtweisen und Betrachtungsansätze diversifiziert und somit auch die Wahrnehmung solcher Schilder und die damit verbundenen Verhaltensweisen selbst zu thematisieren vermag (vgl. von Savigny 1980). Insofern wäre es denn auch zu einfach, mit Daniel Dennett die Differenzierungen einer Grammatik, die Spezifizierungen eines begrifflichen Beschreibungsgefüges ebenso wie die Entwicklung des mathematischen Denkens schlicht als Fortschreibung der biologischen Evolution zu denken (vgl. Dennett 1991). Glauben wir ihm, dann wäre in dieser Evolution, ausgehend von der Beschreibung des Verhaltens einer primitiven, in ihrem Verhalten kaum abgestimmten Horde, eine Linie zu ziehen: Irgendwann fanden sich einige warmblütige, in ihrem Sozialverhalten schon komplex organisierte Individuen zusammen, die ihre Verhaltensmuster koordinierten. Ausgehend von diesen ersten Zuordnungen, interagierten sie weiter, und diejenigen Gruppen, die bestimmte Interaktionsmuster verstärkten und diese auch an ihre Nachkommen vermittelten, indem sie diese mit in das soziale Verhaltensdifferenzierungsprogramm integrierten, gewannen Vorteile. Solche Gruppen wurden dann in der Evolution – so dieses Szenario – positiv selektiert und dabei fortwährend weiter ausgeformt. Ein Resultat dieses Prozesses, der auf eine immer weiter optimierte Verhaltensabstimmung zielte und dann auch seinerseits evolutionär konsolidierte, ist das menschliche Hirn. Seine Funktionen sind demnach als Effekt dieser Evolution zu begreifen. Ein Spezifikum humaner Hirnfunktionen ist – wie benannt – unsere Fähigkeit, mit Sprache umzugehen. Wir bezeichnen mit dieser einzelne Dinge, verweisen auf Vorstellungen von diesen Dingen, strukturieren unsere Außenwelt und machen uns auch vormalige Erfahrungen und selbst die Erfahrungen anderer in unserer Sprache verfügbar. So gibt sie uns ein Werkzeug, mit dem sich unser Verhalten auch über eine direkt erlebte Situation hinaus vermitteln und abstimmen lässt.

134

Olaf Breidbach

VI. Sprachfunktionen? Biologisch gesehen, hieße dies, dass wir die Sprache als eine Funktion betrachten, die letztlich vom Hirn gesteuert ist und die damit auch als Resultat eines Evolutionsprozesses zu beschreiben wäre. Diesen Evolutionsprozess müsste ich dann, wenn ich die Sprache derart als eine Äußerung der Hirnfunktion betrachte, als Adaptation dieses Hirnorgans beschreiben. Es wird im Weiteren zu zeigen sein, dass dieses verengende Bild nicht stimmig ist, dass – wie zuletzt Tomasello aufwies (vgl. Tomasello 2006) – die enorm rasche Entwicklung und Diversifizierung unserer Kultur schlicht keine Zeit ließ, eine Entwicklung des diese Kultur tragenden Verhaltens, der Sprache, einfach als eine Darstellung funktioneller Besonderheiten von Hirnfunktionen sich etablieren zu lassen. So müssen wir denn, wollen wir Sprache in ihrer Funktionalität begreifen, ein ggf. komplexeres Verständnismodell aufzeigen. Zu fragen wäre also, wie dabei Sprachentwicklung und Hirnentwicklung korrelierbar sind. Zu zeigen ist, (a) inwieweit sich in der Wechselwirkung dieser beiden Ebenen biologische Dispositionen von Sprachlichkeit aufzeigen lassen. Daneben ist b) die Komplexität eines Bezuges zwischen beiden Ebenen aufzuzeigen. Dabei wird sich sehr schnell herausstellen, dass die Bezüge nicht einfach aus der Ebene der Biologie in die Kultur greifen, sondern dass umgekehrt die kulturelle Entwicklung sich im Hirn ausprägt, nicht im Sinne einer Stabilisierung von direkt zuzuordnenden Merkmalsverbänden, sondern in einer komplexeren Weise, die die individuelle Entwicklungskapazität eines Individuums in einen kulturellen Kontext einbindet und damit – vereinfacht gesprochen – das biologische Material kulturspezifisch auszuformen erlaubt. Da dies nur möglich ist, weil umgekehrt die Evolution eine bestimmte Anlage des menschlichen Hirnes erlaubte, sind die Verzahnungen von Hirnevolution und Kulturentwicklung in der Tat zweiläufig, wenn auch in einer vielleicht nicht von vornherein einsichtigen Weise. Hier soll im Weiteren eine noch sehr allgemein gehaltene Rahmenvorstellung skizziert werden, von der ausgehend Sprachevolution ggf. von den klassischen Modellen von Fitnessfunktionen oder den Szenarien einer soziobiologisch unterfangenen Theorie kultureller Entwicklung doch in ihrem Ansatzpunkt abweicht (vgl. Voland 2000). Diese Skizze ist somit in ihren Konturen noch offen, kann aber wohl ein Negativbild zeichnen, in dem sie ausweist, wo sich Vorstellungen – meiner Auffassung zufolge – auch in ihrem prinzipiellen Ansatz zu korrigieren haben. Die einfachste, hier kritisch verfolgte Vorstellung kann ausgehen von der funktionellen Kompartimentierung des menschlichen Hirnes, in der sich nicht nur Sprachzentren, sondern auch Zentren für spezielle Sprachfunktio-

Evolution des Kognitiven

135

nen identifizieren lassen.4 Diese Zentren sind zwar nur temporär stabilisiert und von Individuum zu Individuum variabel, doch geben sie ganz im Sinne der alten Hirnlokalisationslehre einen Ansatz, komplexere kognitive Funktionen und damit auch Sprache als Resultat einer Hirndifferenzierung zu verstehen (vgl. Grüsser et al. 1985). So ließe sich ein erstes Bild eines neuronalen Programms von Sprachgenerierungs- und -prozessierungsprozessen zeichnen. Es wäre nun zu zeigen, wie sich diese speziellen Funktionen in der Ausbildung und im Umgang mit der Sprache entwickeln und differenzieren konnten. Darzustellen sind damit spezifische Phasen der Entwicklung von Mensch und Tier, von Besonderheiten der neuronalen Entwicklung des Menschen und die damit verbundenen Phasen in der Entwicklung kognitiver und damit auch sprachlicher Fähigkeiten. Es lassen sich dabei im Vergleich Besonderheiten der menschlichen Entwicklung ausweisen und damit einhergehende Besonderheiten in kognitiven Bereichen wie etwa der Sprachfähigkeiten korrelieren. Im Sinne einer funktionsmorphologischen Charakteristik wäre danach zu fragen, wo und wie sich in dem Organ, in dem diese spezifischen Fähigkeiten gesteuert werden, spezielle Anpassungen ausbilden, deren Evolution dann zu schildern wäre.5 So könnte in einer funktionsmorphologisch ansetzenden Darstellung die Sprachentwicklung als Ausbildung eines Verhaltensmusters beschrieben werden, das die evolutionäre Fitness des jeweiligen, sie tragenden Individuums erhöhte und sich so langfristig in einer Population und mit ihr dann auch in der Konstruktion der Art stabilisierte. Dabei ist allerdings von vornherein deutlich, dass die Komplexität und die Geschwindigkeit der menschlichen Kulturentwicklung es schlicht nicht zulassen, Sprachentwicklung in einer ähnlichen Weise evolutionsbiologisch zu beschreiben wie den Haarbesatz der Hominiden. Wir können also nicht erwarten, dass die Geschichte etwa der menschlichen Sprache auf der Ebene der Ausbildung des sie kontrollierenden Organs ähnlich darzustellen ist wie die Ausbildung von Pigmentierungsmustern oder die Variation im Haarbesatz der Hominiden. Wie aber ist dann eine Evolution des Organs in Bezug auf die Geschichte solch einer zentralen Eigenheit der menschlichen Kultur, gerade auch mit Blick auf deren hohen Diversifizierungsgrad, darzustellen? Hier und nur in diesem Aspekt möchte der vorliegende Essay ansetzen und erste Ideen formulieren. Dabei kehrt sich in dieser Analyse das Verhältnis von Kulturentwicklung und Hirnevolution gleichsam um. Es kann gezeigt werden, dass die Kausalität in der individuellen Ontogenese nicht einfach ausgehend von der Darstellung eines sich kontinuierlich diffe4 5

Zur Geschichte vgl. Breidbach 1997. Sprachevolution nach Art der biologischen Speziation zu denken, führt dann zu Problemen, wenn über Ähnlichkeitsbeziehungen hinaus nunmehr auch vergleichbare Evolutionsmechanismen aufzuweisen wären (vgl. Schleicher 1863; Taub 1993).

136

Olaf Breidbach

renzierenden Organs, das Verhalten dann nur mehr als Effekt der vorlaufenden Gewebedifferenzierung zu deuten ist. Vielmehr läuft die kulturelle Entwicklung der Hirndifferenzierung vor, in der sie sich in der Ontogenese abbildet. Wenn wir dies denken, kehrt sich zwar ein simplizistisches Evolutionsmodell um. Wir fassen damit aber Kultur- und Organentwicklung als eine Einheit und können von da aus auch in einer ganz anderen Hinsicht nach der Zuordnung von Organfunktionen und kultureller Diversifizierung des Menschen fragen. Dabei ist der hier verfolgte Grundansatz neurobiologisch mitnichten originell, wenn er auch in der aktuellen Diskussion zumindest im Umfeld einer evolutionären Ästhetik, die nach direkten evolutionären benefits kultureller Handlungsdifferenzierungen fragt, weitgehend vergessen ist. Es handelt sich um den Ansatz des Hirnforschers und Klinikers Hughlings Jackson, der, ausgehend von seinen neuropathologischen Befunden, ein vereinfachtes Kompartimentierungsmodell des menschlichen Gehirnes ablehnte (vgl. Jackson 1884). Ihm zufolge entwickelte sich das menschliche Hirn nicht einfach durch eine fortlaufende Spezifizierung einzelner Hirnregionen. Die Höherentwicklung des menschlichen Gehirnes ging für ihn vielmehr mit einem stetigen Abbau spezifischer Abgrenzungen und festgelegter Hierarchisierungen in den Verknüpfungen der Hirngewebebereiche einher. Nicht eine fortlaufende Spezifizierung einzelner Funktionszentren, sondern eine fortlaufende Durchdringung der Funktionseinheiten ist – seiner Auffassung zufolge – kennzeichnend für das sich höher entwickelnde menschliche Hirn: Dissolution, die Auflösung vorgegebener funktioneller Kompartimentierungen, ist, nach Jackson, das Spezifikum der menschlichen Hirnentwicklung (vgl. auch Kennard und Swash 1989). Diese, zunächst aus neuropathologischen und anatomisch vergleichenden Studien erwachsene Idee erfuhr in den letzten Jahrzehnten eine weitgehende Untermauerung durch die Ergebnisse der neuronalen Entwicklungsbiologie. Dabei zeigen schon erste Eckdaten, wie offen dieses Gewebe in der menschlichen Ontogenese angelegt ist (vgl. Feess-Higgins und Larroche 1987; Huang et al. 2009): Die größte Anzahl an Nervenzellen besitzt beim Menschen das embryonale Gehirn. Hier wird auch eine Vielfalt von Verknüpfungen zwischen diesen Nervenzellen angelegt. Aus dieser Vielfalt selektiert sich in der weiteren Entwicklung ein Grundbestand effektiv genutzter Nervenzellen heraus (vgl. Creutzfeldt 1983). Schon in der Embryogenese testen sich diese möglichen Verbindungen aus. Doch erst nach der Geburt, wenn durch die Sinnesorgane Reizeingaben ins Hirn gelangen und dort verarbeitet werden, wird aus diesem Überangebot der Bestand der funktionell genutzten Bahnen gleichsam „herausgeschnitten“ (vgl. Katz und Shatz 1996; Catalano und Shatz 1998; Majdan und Shatz 2006). Das menschliche Hirn legt also ein Überangebot möglicher Bindungsstellen und damit möglicher funktioneller Kontakte an. Es baut einen Grundbestand an

Evolution des Kognitiven

137

notwendigen Funktionsbahnen auf, aus dem dann – erfahrungsbedingt – ein Bestand funktionell genutzter Nervenzellen, wie bereits gesagt, „herausgeschnitten“ wird.6 Das Hirn ist nicht auf eine spezielle Funktion hin ausgerichtet, sondern ist offen angelegt. Die spätere Nutzung determiniert dann, was von der offenen Anlage erhalten bleibt. Durch diese offene Anlage ist das Gehirn nicht auf einen speziellen Zustand hin adaptiert, sondern ist in der Lage, sich auf spezifische Umweltsituationen einzustellen: Die offene Organisation des Reizverarbeitungssystems erlaubt eine Abstimmung auf die jeweiligen lokalen und temporalen Bedingungen. Dabei ist das Hirn auch nach dieser Ausgrenzung nicht wirklich festgeschrieben. Die klinische Neurologie zeigt auf, bis zu welchem Grade selbst Grundfähigkeiten wie Sprachartikulation und Sprachverständnis nach Zerstörung der spezifischen Funktionszentren an anderen Orten im Hirn zumindest in Teilen wieder neu aufgebaut werden können (vgl. Flor et al. 2006). Die Repräsentationen des sensorischen Umfeldes – dies zeigen Studien an Amputationspatienten – bleiben auch bei Erwachsenen zumindest in Grenzen weiterhin variationsfähig. Zumindest bei Mäuseartigen finden sich zudem – entgegen der klassischen Vorstellungen – im Hirn bis ins hohe Alter Neubildungen von Nervenzellen. Die Vorgabe einer neuronalen Funktionsarchitektur determiniert also nicht spezifische Verhaltensmuster, ist nicht auf ein spezifisches Szenario hin adaptiert. Formiert ist vielmehr eine strukturelle Basis für Verrechnungsorgane, die möglichst viele Freiheiten gibt und demnach eine Vielfalt möglicher Verrechnungsschritte auszuführen erlaubt. Insoweit kann dann auch ein in Amerika geborenes Kind zweier Chinesen sich komplett in die für seine Eltern neue Kultur und Sprache integrieren.

VII. Sprachkultur Die Frage ist nur, wie in der normalen Ontogenese eines Individuums diese Abstimmung auf und Einstimmung in eine Kultur erreicht wird. Schließlich sind es ja nicht nur die Wörter der Sprache, die gelernt werden. Die Zuordnungen dieser Wörter zueinander, die Bedeutung, die sie tragen, und die Bedeutungszusammenhänge sind jeweils andere. Es gilt Objekte zu identifizieren, Zuordnungen von Bedeutungsklassen zu ermitteln und damit ein Identifikationsraster aufzubauen, in dem in einer Kultur bestimmte Bedeutungen eingebunden und Erfahrungsobjekte zugeordnet sind. Das bedeutet, dass wir nicht einfach Einzelheiten, sondern Erfahrungszusammenhänge registrieren. Das Einzelne, das wir erfahren, erfahren wir im Kontext eines solchen Erfahrungszusammenhanges, in der Rasterung, 6

So auch in Young et al. 1999; Rushton 2001.

138

Olaf Breidbach

in der wir an dem Einzelnen bestimmte, für uns interessante Merkmale dingfest machen, mit und in diesen Zuordnungen und Abgrenzungen treffen und so einen Zusammenhang aufbauen, in dem das Einzelne verortet und damit als Moment eines uns möglichen Bezuges bestimmt ist. Dieser Erfahrungszusammenhang wird nun vom Einzelnen zwar für sich je neu aufgebaut, aber nicht einfach neu erfunden. Er wird ihm übermittelt. Übermittelt wird ihm damit ein Ordnungszusammenhang, ein Schema der ihm möglichen Zuordnungen. Dieses Schema gibt die Sprache vor, in der er einzelne Dinge benennt, sie unter diesen Benennungen ordnet und zueinander abgrenzt und so als Momente der ihm möglichen Erfahrung erfasst sowie zugleich auch als Momente eines Erfahrungsaustausches in seiner Kultur bestimmt. Es kann hier nur angedeutet werden, dass diese Zuordnung durch die Benennung und die in der Benennung getroffenen Abgrenzungen Moment der frühkindlichen Erfahrung ist, in der sich dann die komplexe Erfahrungswelt für dieses Kind ordnet. Es sind die in der Sprache vorgegebenen Erfahrungsrasterungen, in denen sich der Grundbestand einer möglichen Erfahrung aufbaut. Und es ist diese Rasterung, in der nunmehr auch eine Abstimmung der Erfahrungsinhalte verschiedener Individuen einer Gruppe möglich ist. Die gleichartige Zuordnung, die abgestimmte Benennung erschließt einen gemeinsamen Erfahrungskontext, erlaubt es in diesem Raster, sich auch unabhängig von der konkreten Erfahrung in dieser Gruppe über eine mögliche Erfahrung in dieser Gruppe abzustimmen. Das bedeutet, dass sich in dem mit der Sprache vorgegebenen Raster eine Ordnung des Erfahrungsraumes bestimmen lässt, die nun rein sprachlich vermittelt für jedes Mitglied dieser Gruppe ein gemeinsames Erfahrungsraster tradiert. Damit ist der Einzelne in dieser Gruppe in einen Kommunikationsraum eingebunden, den er versteht und nach dem er seine Erfahrungen bewertet – womit in diesem Kommunikationsraum ein Gefüge von Erfahrungsvermittlungen erwächst, das nicht mehr einfach an eine neurobiologisch nachzuzeichnende Gedächtnisfunktion gebunden ist. In der Kommunikation wird ein Erfahrungsraster verhandelt, das sich dann auch in den Kommunikationsformen und damit in der Sprache abbildet. Diese erhält in ihren Bedeutungszuweisungen, deren essentials in der Phase der Sprachaneignung gelernt werden, die Rahmenbestimmungen, in denen sich Erfahrungen ordnen. Die Regeln, in denen diese Grundbestände an Erfahrungszuordnungen in dieser Sprache formulierbar sind, ergeben zugleich auch Zuordnungsmuster, in denen nunmehr der Erfahrungsbestand, der in einer entsprechenden Gruppe verhandelt wird, seine Ordnung erfährt. Diese verschiedenen Schematismen, der Bedeutungszuweisung und der Ordnung von Bedeutungszuweisungen, werden in der Kultur von der Eltern- an die Nachfolgegeneration vermittelt. Dies geschieht in der Phase, in der ein Kind die Sprache seiner Kultur lernt und damit die Formen adap-

Evolution des Kognitiven

139

tiert, in denen seine Kultur Erfahrungen ordnet und neue Erfahrungen einbindet. Diese Ordnungen, nach denen sich Erfahrungen kondensieren, sind demnach in der Sprache abgebildet und können nun auch in dieser Sprache tradiert werden. Dies betrifft zunächst die Art und Weise, in der sich eine Kultur ihrer unmittelbaren Umwelt versichert. Dies wird von einem Individuum mit der Sprache übernommen, die in den Regeln ihrer Kombination und den möglichen Attribuierungen zu diesen Begriffen (oder ggf. auch anderen Formen) eine Kombinatorik von Verweisstrukturen abbildet, in denen sich zunächst Erfahrungen in ihrer spezifischen kulturellen Rasterung und damit die Bewertungen von Erfahrungszusammenhängen einer Kultur fangen (vgl. Christiansen and Kirby 2005; Christiansen and Kirby 2003; Chater et al. 2009). Dies sind zunächst Vokabular und Grammatik. Mit ihnen sind die Strukturen, in denen sich ein Erfahrungszusammenhang in einer Kultur abbildet, adaptiert.

VIII. Tradierungen In dieser Sprache lassen sich aber auch Aussagen machen, in denen nunmehr konkrete Ausgestaltungen etwaiger Erfahrungszusammenhänge und gegebenenfalls auch Bewertungen fixiert werden. Diese weisen einen detaillierten Erfahrungs- und / oder Bewertungskontext aus, den sie an sich fixieren und sprachlich tradieren. Derjenige, der die Sprache einer Kultur adaptiert hat, kann diese tradierten Aussagezusammenhänge abrufen und damit über die unmittelbaren Strukturbedingungen der Erfahrung seiner Kultur eben auch Erfahrungen seiner Kultur abrufen. Dieser Speicher von Informationen ist – ob er nun verbal oder, in einer dritten Ebene, auch schriftlich tradiert ist – für denjenigen, der die Sprache einer Kultur versteht und damit deren Grundbewertungs- und Zuordnungsmuster adaptiert hat, abrufbar. Er stellt somit eine sprachliche Erinnerung zweiter Stufe dar, die nunmehr voraussetzt, dass eine Sprache verstanden ist, demnach also bestimmte Kommunikations- und Vermittlungsformen gelernt sind, die sich ggf. auch als Verhaltensspezifikationen ausbilden und als solche durchaus neuronale Korrelate haben können. Der derart in der Sprache fixierte Kontext von Aussagen über und Bewertungen von Erfahrungen ist aber selbst unabhängig von einer etwaigen neuronalen Abbildung. Sicher kann ich solche Zusammenhänge auch meinerseits memorieren und etwa in Form einer Verssammlung lernen. Dann sind solche memorierten Zusammenhänge an ein funktionierendes Gedächtnis gebunden. Derart zeigen sie dann auch direkt neuronale Korrelate. Nur kann eine Kultur schon dadurch diese sprachlich kodierten Bestimmungen sichern, dass sie von mehreren Individuen gelernt werden. Die eigentlichen in dieser memorierten Folge von Aussagen fixierten Erfahrungen und Bewertungen

140

Olaf Breidbach

sind damit einer konkreten neuronalen Abbildung enthoben. Vollends aus diesem ggf. fragilen Bereich einer bloß memorierten Tradition herausgenommen sind diese Aussagenzusammenhänge dann, wenn sie in der Schrift fixiert werden. Hier bilden sich dann in Form von Schriftquellen, in Archiven und Bibliotheken sehr rasch eigene Memorialstrukturen aus, in denen sich eine Kultur ihre Erfahrungs- und Bewertungszusammenhänge zu sichern vermag. Die Evolution der Kultur, als Summe und Folge der in ihr agierenden Hirne, zeigt sich so schlicht in die Sprache entlagert. Die Sprache ist das Moment, in dem sich eine höher entwickelte Kultur ihre kulturellen Programme, ihre Art der Sicht auf die Dinge, ihre Art, die Dinge zu identifizieren und einander zuzuordnen, sichert. Die Sprachentwicklung selbst, die in ihr zu findende Referenz, verweist in höher entwickelten Sprachen dann auch auf sich selbst. So schafft sich die Sprache in ihrer Entwicklung eine eigene Realität, indem in der Kombination der in der Sprache verfassten Aussagen neue Kombinationen von Assoziations- und Bedeutungsketten aneinandergeführt sind, die in dieser Sprache eine eigene Welt von sprachlich gefassten und geführten Assoziationen entstehen lassen. Von dieser sich so auf sich verweisenden Sprache reden wir als Literatur. Und so könnte es dann nahe liegen, die Evolution auch der Literatur zu beschreiben. Diese sehr knappe und – gelinde gesagt – spekulative Skizze einer möglichen Zuordnung der Entwicklung von Sprache und Hirn gilt es im Weiteren zumindest in ersten Linien zu untersetzen. Es ist – hier zunächst auf einem sehr grundsätzlichen Niveau, auf dem noch nicht konkrete Experimente, aber vielleicht doch mögliche Ansätze für entsprechende Fragestellungen angedeutet sind – aufzuweisen, ob und inwieweit wir aus der Perspektive der Neurobiologie die Evolution des Hirnes in der Evolution der Sprache weiterdenken können.

IX. Rückbesinnung Bevor wir die Überlegungen hier weiterführen, seien aber noch einmal drei zentrale Aspekte festgehalten, die für diese Überlegungen bedeutsam sind, die (1) die funktionelle Grundstruktur des assoziativ operierenden Hirngewebes, des Cortex der Mammalia, darlegen, (2) dessen Ontogenese charakterisieren und (3) das konkrete Umfeld eines sich entwickelnden Individuums betreffen. (1) Festzuhalten ist der hohe Durchmischungsgrad der funktionellen Verbindungen im Wirbeltierhirn: Bei Ratten ist jede Hirnzelle über nur drei Verbindungen mit jeder anderen verknüpft (vgl. Braitenberg und Schüz 1998). Eine Erregung wird also nicht in kanalisierten Bahnen geführt, sie

Evolution des Kognitiven

141

strahlt vielmehr aus und formiert ein ganzes Erregungsgefüge, das je nach der Binnendisposition des Hirngewebes variiert wird. Wir können dies beschreiben, sehen dabei komplexe Zuordnungen, in denen sich etwas abbildet, fassen das Gedächtnis als etwas, das sich nicht im Sinne eines Zettelkastens, sondern vielmehr als ein komplexes assoziatives Organ begreifen lässt, das mit der Einlagerung von Neuem auch auf das Alte wirkt. Das Hirn schaut von innen nach außen. Es träumt sich seine Welt. Das bedeutet, es ordnet die in Hirnbinnenerregungen umgesetzten Außenreize nach Maßgabe der eigenen Erregbarkeit und entsprechend der in seinen Strukturen vorgegebenen Funktionalität. (2) In der Embryogenese legt sich das Hirn – wie schon festgestellt – im Überfluss an. Es hat im 3-monatigen Embryo mehr Nervenzellen als der erwachsene Mensch; es erhält seinen Überfluss an möglichen Verbindungen dieser Nervenzellen bis über die Geburt hinaus. Doch in den ersten Jahren der Erfahrung wird aus diesen Verbindungen das herausgenommen, was nicht gebraucht, und das stabilisiert, was benutzt wird. (3) Das, was das Gehirn stabilisiert, ist dabei nicht einfach das komplexe Gefüge der visuellen Eindrücke, das einen Außenraum im Hirn abbildet. Das Visuelle ist viel zu kompliziert, um derart eine erste Strukturierung der Verrechnungseigenheiten des Hirnes zu erlauben. So ist ein Ball, ja selbst eine Ecke in einem Zimmer, auf dem Augenhintergrund zunächst nichts als eine Farbfläche, die an andere angrenzt und von ihnen nicht einmal sauber abgegrenzt ist. Ich muss sie selbst als Einheit begreifen, die wechselnden Beleuchtungen, die sich verschiebenden Schatten als solche deuten, die Vielfalt der in variierendem Licht variierenden Farbspektren als Variationen eines Etwas verstehen, um in diesen Farbflächen einen Ball oder eine Ecke zu erkennen. Hierzu bedarf es Interpretationsvorgaben, beginnend von dem einfachen dieses da hin zu komplizierten Vorstellungen über die Organisation von Räumen und der Identifikation von etwas vor einem Hintergrund. Dann aber sind wir in unserer Weltversicherung schon sehr weit gekommen. Um überhaupt so weit kommen zu können, spielt Sprache die entscheidende Rolle. In ihr fassen sich nun auch Erinnerungen nicht einfach als abzuspeichernde Abbilder im Sinne eines Dia-Kastens. Erinnern ist etwas anderes. Die primitiven Ideen von Speicherungsfunktionen, die mit dem Konzept der funktionellen Lokalisation einhergehen, sind wissenschaftsgeschichtliche Atavismen, interessanterweise Derivate der Diskussion, die etwa mit Fludds aus dem 16. Jahrhundert bis in die heutige Neurobiologie transferierter Vorstellung der Entsprechung des Mikrokosmos der Innenwelt und des Makrokosmos der Außenwelt zu greifen ist (vgl. Rossi 1991; Breidbach 2004). Faktisch wird eine Erinnerung nicht abgespeichert, sondern als eine Re-Formation der Verarbeitungsprozesse im Hirn zu begreifen sein, die nicht einfach etwas abbildet, sondern in der erfahrungsbedingten Umstellung in der

142

Olaf Breidbach

hirninternen Verrechnung eben auch weitere Verrechungsprozesse und selbst den Rückgriff auf vormalige Erlebnisinhalte verformt. Es ist dieses Sich-Vereinnahmen einer Erfahrung, das der Neurobiologe erfassen müsste, um sinnvoll mit Erinnerungen umzugehen, die oberhalb der Ebene der Sensibilisierung anzusetzen sind. Interessanterweise bedeutet dies sogar für die Modellierung von Erinnerungen im Computer ein neuartiges Vorgehen, was in der Diskussion um die Speicherungsfunktionen in neuronalen Netzen zwar technisch durchdacht, aber nie im Eigentlichen philosophisch reflektiert wurde. Schließlich werden Erfahrungseindrücke, die ein Hirn durch sein Außen erfährt, durch dieses immer auch transformiert und dann ggf. in der Nutzung eines eigenen Zuordnungsgefüges, der Sprache, abgestimmt. Damit sind diese Transformationen und die in ihnen liegenden Interpretationen aus dem bloßen Bezug auf ein Hier und Jetzt, einer sich nur momentan ausdrückenden Umwelt, herausgehoben. Dass dieses schon einfachste Konstruktionen der Reizverarbeitung auszeichnet, hat der Neuroanatom Valentin Braitenberg in seinem Buch Vehicles beschrieben (vgl. Braitenberg 1984). Darin begriff er – schon vor der Etablierung der evolutiven Robotik als eigener Bereich einer technisch experimentell ansetzenden Kognitionsforschung – die Konsequenzen einer bloß technischen Bestimmung der Evolution der Konstruktion Hirn (vgl. Nolfi und Floreano 2000). Seine Analyse, die den hier kritisch verfolgten Ansatz operabel macht, offeriert ein klares Bild der Grenzen und Möglichkeiten einer Neuroarchitektonik des Kognitiven. Ihm zufolge ist das Hirn eben nur ein Schaltkreis, der in bestimmter Weise an Sinneseingaben und Motoren gekoppelt ist.7 In der Evolution wird nun dieser Verschaltungsapparat variiert und in seiner Funktion evaluiert. Die Variationen, die gegenüber dem Ausgangszustand optimiert erscheinen, werden dann weitergegeben. Verrechnungsprozesse werden so ggf. differenziert, neue Reaktionsmöglichkeiten implementiert. Die Leistung dieser Maschine ist es dann aber, Sinneseingaben in möglichst effiziente und passende motorische Programme umzusetzen. Auch solch eine einfache Konstruktion wäre dann aber über ein Expertensystem zu optimieren. Wenn ich einer solchen Konstruktion ein Programm eingebe, das mögliche Sinnesdatenkonstellationen anhand eines vorgegebenen Lexikons weitergehend klassifiziert und bewertet, werde ich die Reaktion einer solchen Maschine weit schneller optimieren, als wenn ich diese einzelnen Schritte selbst in dem Vernetzungsgefüge der verschiedenen interagierenden Verrechnungselemente implementiere. Zumal die Eingabe eines Lexikons vergleichsweise 7

Letztlich liegt auch Quines Idee, die Identität gerade in synchronen Antwortcharakteristika einzelner Neuronen zu finden, auf dieser Linie (vgl. Quine 2003). So konnte Singer mit seinem Konzept der binding neurons ebenfalls sehr einfach in dieses Konzept eingepasst werden, was denn auch erklärt, was diesen Befund eines Neurobiologen für Philosophen zumindest einer bestimmten Richtung so interessant machte.

Evolution des Kognitiven

143

leicht zu ergänzen oder zu variieren ist; im Falle einer Hardwareimplementierung der zugrunde zu legenden Entscheidungsprogramme müsste ich für solch eine Erweiterung den Gesamtbauplan der Maschine ändern. Auch an diesem einfachen Modell also lässt sich zeigen, wie hier durch Entlagerung der Formierung von Entscheidungsprozessen Verhaltensentwicklungen dynamisiert werden und damit die Performance solch eines Apparates vergleichsweise rasch zu optimieren ist (vgl. auch Nolfi und Mirolli 2010).

X. Funktionsbeziehungen Nun reicht es aber nicht, eine tote Struktur in ihrer Anatomie aufzuweisen, um zu verstehen, was sich für diese und in dieser bewegen lässt. Die Funktion des integrierenden Hirnorgans ist nicht einfach als Addition einzelner Reflexbahnen zu zeichnen. Und so ist auch dessen Evolution eben nicht in einem einfachen Schlüssel-passt-auf-Schloss-Denken zu beschreiben. Von daher sollten wir skeptisch sein mit einer zunächst nur durch unsere private Enkulturation getragenen Lego-Vision, nach der das Hirn eine Art von Baukasten sei, in dem ein Stein zu dem anderen zu fügen wäre, um so, sukzessive, ein komplexes Ganzes entstehen zu lassen. Richtig ist vielmehr, es gibt kein Muster des add on für die Darstellung der Entwicklung des menschlichen Verhaltens. Gut ist dieses da, wo es generalisiert, nicht da, wo es bloß spezifiziert. Die Vorstellungen, dass die populären Hirnaktivitätsbilder der Moderne es erlauben, ein simplifiziertes add-on-Denken auch heute noch zu äußern, überfordern diese diagnostisch eingesetzten tools wie die Positronenemissionstomographie oder das Functional magnetic resonance imaging erheblich. Hier erscheinen Teilfunktionen, hirnmotorische Muster, aber eben nicht die Essenzen eines komplexen Verhaltensgefüges. Selbst ein Radio zeigt während einer Nachrichtensendung auf einem bestimmten Kanal Energieverbrauch in bestimmten Transistoren. Warum sollte es im Hirn anders sein? Nur würde es wohl niemandem einfallen, auf Grund der Angabe über die Wärmeabgabe einzelner Transistoren im Radio zu postulieren, dass er begriffen habe, was nun über diese Transistoren übertragen wurde. Warum sollte dies in dem komplizierten (und nach anderen Prinzipien gebauten) Hirn anders sein? Es ist so eben falsch, bloß nach Funktionszentren zu suchen, die in einem bestimmten, durch Hirnfunktionen gesteuerten Verhaltenszusammenhang Energie benötigen. Deren Zuordnung zeigt, wie sich im Hirn Funktionalität etabliert. Sie erklärt aber nicht, was sich in dieser Funktionalität abbildet. So reicht es auch nicht einfach, solche etwaigen Funktionszentren, die in den verschiedenen Versuchen identifiziert wurden, aufzuaddieren und in deren Summe ein Funktionsmodell der kognitiven Operationalität des Hirnes zu formulieren, in dem dann ggf. auch die Sprache oder zumindest

144

Olaf Breidbach

die Sprachfähigkeit ihren Ort hat. Dieses an einer überkommenen Zentrenlehre anlehnende Bild davon, wie Hirnevolution funktioniert, greift nicht. Der britische Neurologe Hughlings Jackson hat dies – wie erwähnt – schon Ende des 19. Jahrhunderts dargestellt (vgl. Meares 1999). Für ihn ist die Hirnentwicklung nicht durch eine immer größere Spezifikation funktioneller Strukturen, sondern vielmehr durch eine fortlaufende Durchmischung vorgegebener Einheiten gekennzeichnet. Für den Menschen selbst gilt denn auch: All die Hirnreihenuntersuchungen der Rassenlehre des 19. Jahrhunderts, all die Versuche, das Geniale und das Idiotische in Hirnstrukturen zu entdecken, führten um 1900 wie auch um 2000 in die Irre. Es ließ sich keine Reihe vom Einfachen zum Komplexen aufweisen. Merkmale innerhalb der Spezies Mensch variieren in Qualität und Größe, unabhängig von den kulturellen oder intellektuellen Standards der jeweils betrachteten Individuen. Der Neuroanatom Oskar Vogt, der in den 1920er Jahren im Auftrag des Zentralkomitees der Partei in Moskau an Lenins Hirn dessen Genialität neurobiologisch zu beweisen hatte, steckte hier in der gleichen Falle wie eine forensische Psychiatrie, die versucht, Zentren komplexerer kognitiver Funktionen dingfest zu machen; übersehend, dass das Hirn eben kein Baukasten aufzuaddierender TeilFunktionen, sondern ein hochkomplexes Durchmischungsgefüge ist (vgl. Satzinger 1998). So gibt es kein hirninternes Zentrum von Modernität; es gibt aber ein Organ, das in unterschiedlichen Nutzungszusammenhängen unterschiedlich funktioniert, das unterschiedliche Situationen in sich abbildet und in dieser Abbildung variieren kann. Das Hirn muss als ein Ganzes betrachtet werden, in dem sich komplexere Funktionen in einer Vernetzung verschiedener Teilbereiche abstimmen. Dabei steht die Hirnforschung selbst in einer Tradition, die ein Grundverständnis solch integrativer Funktionalität, schon von ihrem Forschungsansatz her, aus dem beginnenden 19. Jahrhundert übernommen hat. Diese Konzeption formulierte James Mill (vgl. Breidbach 1996). Was hier nun interessiert, ist der Bezug von dieser individuellen Fassung des Erinnerns und dem kulturellen Erinnern, ganz im Sinne einer sich durch die Erfahrung modifizierenden Textur möglicher kulturinterner Repräsentationen, in denen auch in der Kultur das Bild des Vormaligen fortwährend transformiert und derart amalgamiert wird. Formiert wird ein Kontext.

Evolution des Kognitiven

145

XI. Exkurs: Lesen Und so ist dann schon auf dieser Ebene die Weltbestimmung eine Textauslese.8 So operiert auch die Neurowissenschaft mit einem Kulturbild, das Wissen als Text und Welt als Kontext, als den Ort möglicher Zusammenstellungen, deutet. So konnte Turing Intelligenz als eine Art von Lesefunktionsfolge denken (vgl. Turing 1950), wie auch das Gehirn als das Organ der Beobachtung, Registrierung, Speicherung und Vermittlung von Inhalten diesem Bild zufolge wie eine Textmaschine funktioniert. Daten werden in dieses Organ eingelesen oder ausgelesen. Die Sinnesorgane lesen aus dem Gesamtspektrum der Offerte möglicher Signale aus, formen eine Nachricht, die sie ins Zentralorgan weiterleiten. Das Hirn wird derart als ein Kommunikationsraum beschrieben, in dem diskursiv decodierte Botschaften „durchgereicht“ werden, die dann entsprechend in den verschiedenen Zentren der Verarbeitung auch dechiffriert oder in den spezifischen das Gehirn kennzeichnenden Formen der Physiologie verschlüsselt werden. Der Forscher ist derjenige, der diesen Text des Hirnes liest, er begreift dessen Textur, entschlüsselt die Bedeutung etwaiger Teilreaktionen und überführt dann in der Beschreibung dieser Entschlüsselung sein Wissen über das Hirn wieder in einen Text, den er der Bibliothek des möglichen Wissens zufügt. Ist damit in der diskursiven Folge von neuronalen Funktionssequenzen in der Tat eine Sprachlichkeit, ggf. so etwas wie eine Vorform des Sprachlichen, formuliert, oder sind dies nur die Bilder der Sprache, in denen wir uns nun auch in unserer Funktion selbst denken? Nun haben wir im Nebeneinander der Neuronen, in der Gleichzeitigkeit einer Vielfalt von Teilfunktionen und auch in deren Durchmischung ein Nebeneinander von Zustandsfolgen zu zeichnen, das nun seinerseits im Vergleich der verschiedenen parallel operierenden Einheiten auf Strukturund Funktions-Isomorphien hin abgetastet werden kann. Gewonnen ist so eine Vorstellung eines komplizierten, aber dennoch einem Lesegerät entsprechenden Ausleseverfahrens, das, wenn auch in einer völlig neu gehaltenen Form, das alte Modell des lesenden Mönches fortschreibt, der im Mittelalter seine Welt eben nur im Text erfasste. Derart philologisiert, wird aber der Wissensfortschritt nicht gerade als etwas erscheinen, das neurobiologisch abbildbar ist, und doch ist dies ein Weg, genau diese Zuordnung zu gewinnen: Sprache gibt das Raster, in dem sich die Vorbestimmungen eines enkulturierten Hirnes zeigen, das sich in seinen Merksätzen nicht mehr an die Genetik seiner Neuronen hält, sondern diese Merksätze in seiner Kultur, in der Syntax und Semantik der Strukturen fasst, mit denen und nach denen es seine Weltsicht ausrichtet. Ich behaupte hier, dass in der Tat die Sprache das Material ist, in dem sich 8

Zu den Details vgl. Breidbach 2007.

146

Olaf Breidbach

die Entwicklung des Kognitiven abbildet. Ich behaupte, rückverweisend auf das eingangs dargestellte Szenario der frühen Hirnontogenese des Menschen, dass die Entwicklung des Hirnes zu einem derart offenen System, das auch die Entlagerung der es formenden Engramme in externe Strukturen zulässt, die eigentliche biologische Disposition in der Evolution des neuronalen System des Menschen darstellt. Und ich behaupte, dass das moderne Hirn nicht einfach nur Modernität generiert, sondern in der Kultur der Moderne überhaupt erst zum modernen Gehirn geformt wird. Selbstverständlich ist das Hirn ein Organ. Für den Biologen ist es damit eine Struktur, die in einer von ihm zu entschlüsselnden funktionalen Organisation zu begreifen ist. Das, was das Hirn kann, ist das, was das Hirn als Hirn, d.h. als neurophysiologisch / anatomisch zu entschlüsselnde Struktur, anstellen kann. Insoweit ist sich Gerhard Roth, wenn er als Biologe spricht, auch so sicher in dem, was er zum Hirn und seiner funktionellen Organisation, seinen Möglichkeiten und den daraus innerbiologisch abzuleitenden Konsequenzen sagt. Schließlich ist das Hirn biologisch eben nichts anderes als die zumindest potentiell physiologisch zu entschlüsselnde Maschinerie, die sich im Laufe einer langen Stammesgeschichte in einer bestimmten, nicht einmal unbedingt optimalen Weise entwickelt hat. Das, was ich im Kopf habe, ist nun aber eben nicht ein bloßer Reflex der Außenwelt.

XII. Welt-Wissen Die Außenwelt ist – hirnintern gesehen – nicht einfach als solche da. Reize, die wir als Reflexe dieser Außenwelt interpretieren, speisen sich in die intern ablaufenden Hirnaktivierungsmuster ein. Es ist falsch, den Menschen als eine Statue zu sehen, die nach dem Imprinting dieser Außenwelt funktioniert. Der Mensch ist ein Kulturwesen; und es ist die Kultur, die ihn ausformt; und es ist die Sprachkultur, in der sich sein Hirn bestimmt. Deswegen dauert es so lange, bis wir als Säuglinge nicht mehr in den Mond zu greifen suchen, deswegen bestimmen wir unsere Erfahrungen in einer Weise, die uns mit dem Heute abstimmt. Deswegen erkennen wir in unserem Sehen, Abbilden und Erzählen Stile wieder, die uns im Moment ihrer Äußerung alles andere als geziert, in sich bestimmt und abgehoben erscheinen. Das sich ins Ich explizierende Hirn ist auch in seiner „Sprache“ immer bei sich. In den Nervenzellen, die die funktionellen Grundeinheiten des Nervengewebes darstellen, werden nicht einfach Fahnen weitergereicht, auf denen vermerkt ist: visuelle Reizqualität oder Geruch. Im Hirn speisen sich alle sensorischen Eingänge in gleicher Art und zudem auch noch hübsch durchmischt in ein hirninternes Funktionieren um. Es ist die gleiche „Sprache“, der gleiche physiologische Code, in der sich dem Hirn Geruch und Geräusch vermitteln. In der Innenwelt des Hirnes baut sich so ein ganz eigenes Gefüge

Evolution des Kognitiven

147

von Weltrepräsentationen auf, die zunächst nur Antworten der eigenen Qualitäten sind (vgl. Breidbach 2000a). Dabei sind diese von außen getriggert, so dass sich die Innenreaktionsschichtung umbauen kann und es so zu einem neuen Verhalten kommt. Bewährt sich dieses, können sich die so erhaltenen physiologischen Re-Positionierungen stabilisieren. Sind wir somit aber nun nicht einfach nur an ein neues Bild verwiesen? Finden wir das Denken in seiner Binnenbestimmtheit nicht im Netz des jeweils Eigenen, in den Kordons einer übernommenen Sprache eingefangen? Der bloße Befund, ein in diesem Gefüge abgebildetes Datum, scheint damit nicht mehr in sich verloren, er wird zum Teil eines Verweisungssystems, aus dem er dann überhaupt bestimmt wird. Dieses Raster ist zunächst für uns in der Übernahme ein Sprachliches, es wird auch in unserem Kopf zu einem Text und ist als solcher Text in der Zuweisung der Assoziationen von dessen einzelnen Elementen über die Zeit variabel, in seiner jeweiligen strukturellen Disposition zu einer Zeit aber fest. Damit scheint dann aber die einfache Sequenz kausalanalytisch zu rekonstruierender und demzufolge linear abzuarbeitender Folgen unzureichend, um das darzustellen, was hier an Bezugsgrößen ausgeformt wird. Die Turing Maschine, die hier zu fordern wäre, wäre denn auch nicht eine sequentiell arbeitende Maschine, sondern ein zellulärer Automat, ein zusehends mehr Teilräume integrierendes System. Der so entstehende Komplex ist nun nicht mehr nach schematisierten Vorgaben in Ordnung zu bringen. Die hier nachzuzeichnende Evolution läuft nicht in einer einfachen Linie, sie explodiert in ihren Bezügen und greift auf verschiedene Tradierungen zurück. Das macht denn auch eine Kultur so kompliziert, die entgegen einem technischen System nicht nur einen Zustand x abbildet, sondern sich allein als eine Folge von offenen, immer je nur an sich zu bestimmenden Zuständen beschreiben lässt, in denen wir zugleich dann auch die diese Zustände jeweils kennzeichnende Sprache fortwährend transformieren. Die Einsicht in die Tatsache, dass wir in unserem sprachlich geleiteten Denken Dinge immer nur sukzessive, in Folge und damit der Reihe nach abzuarbeiten haben, führte um 1800 zu Versuchen, das Ganze solch einer Reihe in Szene zu setzen. Es galt unmittelbar, das anzuschauen, was sonst nur in der Sequenz der Sätze zu umschreiben war. Hier deuten sich Momente an, die auch eine Neurophysiologie konzeptionell weitertragen können, die hier aber zurückzustellen sind; interessieren können an dieser Stelle nur erste Überlegungen zum Problem der Zuordnung von Hirn und Sprache. Dabei ist von den Konkretionen neurophysiologischer Funktionsvorstellungen zunächst abzusehen und zuerst grundsätzlich die Frage einer Darstellung von Sprachevolution anzugehen. Dabei ist festzuhalten, dass es – im Gegensatz zum Instinktverhalten – nicht das Imprinting durch die Sinnesorgane ist, nach dem sich unser Wahrnehmen strukturiert. Vielmehr werden die Wahrnehmungen nach einem Raster

148

Olaf Breidbach

strukturiert, das uns übermittelt ist: Es ist die Konturierung unserer Vorstellung durch unsere Kultur, die sich uns schon von der frühen Embryogenese an das, was unsere Umwelt ist, übermittelt. Dies geschieht durch Sprache. Hier liegt die Antwort auf die Frage nach der zunehmenden Akzeleration in der Evolution des Humanen. Das Hirn ist nicht einfach nur das Kondensat sensorisch vermittelter Impressionen, es ist in seinen Wahrnehmungsdispositionen, dem Feinabgleich der ihm möglichen Bestimmungen und Steuerungen durch die Sprache, durch die logisch operierenden Formalismen einer intersubjektiven Kommunikation geprägt. Wie weit können wir hier gehen, wo bleibt solch eine Analyse analytisch, wo ist sie auch einer Einzelforschung vermittelbar? Das bleibt hier offen. Skizziert ist zunächst nur ein Ansatz, damit aber zugleich eine neue Art von Historie, die nicht einfach nur eine Entwicklung, sondern die eben wirklich Evolution darstellt. Hier ist der Ansatz, Sprachentwicklung als Fortführung von Evolution des Nervensystems bei Hominiden zu betrachten, hilfreich. In meinen Augen wird die Reizverarbeitung und die Verhaltenssteuerung durch ein kognitives System kontrolliert, das einerseits in der Ontogenese erworben wird, das sich aber andererseits in seinen komplexeren Steuerungsvorgängen auch unabhängig vom Hirn konsolidiert und in der Sprachlichkeit einer Kultur abgebildet ist. In der Sprache finden sich die Bestimmungen, nach denen eine Kultur ihr Wahrnehmungsgefüge selbst strukturiert und Bewertungen des Wahrgenommenen standardisiert, so dass es möglich wird, komplexere Verhaltenskontexte auch indirekt zu vermitteln. Diese Überlegungen können hier nur angedeutet werden; sie führen in eine eigene Linie, zumal Sprache ein vergleichsweise junges Resultat der Verhaltensentwicklung der Hominiden ist, das dann aber durchschlagenden Erfolg hatte. Sprachliche Differenzierung und damit einhergehende Bewertungen und Wertungsgefüge unter dieser Perspektive zu analysieren, scheint mir wertvoll und wird – richtig angelegt – auch nicht einfach das Schleicher’sche Programm einer Rekonstruktion von Sprachentwicklungen neu auflegen, sondern etwa die Suche nach sprachlichen Universalien, die Chomsky in seinem Minimalkonzept vorzuschlagen suchte (vgl. Chomsky 1995), umfassend re-akzentuieren. Deutlich dabei wird aber schon sehr schnell, dass sich diese sprachliche Entwicklung nur bedingt in den neuronalen Strukturen niederschlägt. Die Tendenz, in der Evolution von Sprachsystemen Wissensspeicher zu externalisieren, ist das eine, sei es, dass dies wie bei den Druiden durch bloßes Memorieren, sei es dass es durch schriftliche Notationen oder auch durch die Institutionalisierung von Wissensorganisation und Wissensordnungen erfolgt. Mit den zusehends wachsenden Erinnerungsinhalten einher geht – und dies ist das zweite – eine fortlaufende Differenzierung von Sprache, wie sie sich explizit in der mathematischen Notation fassen lässt.

Evolution des Kognitiven

149

Die mathematische Notation ist dabei besonders interessant, da sie zumindest ab einer gewissen Phase quer zu den Regionalisierungen und Typendifferenzierungen von Sprachen steht. Die Frage ist also, auf welcher Ebene hier Sprachlichkeit als evolutionär signifikant anzusehen ist: Die konkrete lautliche Gestalt einer bestimmten Sprache ist, einmal etabliert, ein Muster, das nur mehr variiert und differenziert werden kann. Umgekehrt ist aber ab einer bestimmten Entwicklungshöhe die eine Sprache in eine andere Sprache übersetzbar. Dies bedeutet, dass sich eine differenzierte Sprachlichkeit aus den konkreten strukturellen Bedingungen ihrer Äußerung lösen und somit auch tradieren und damit in externen Speichern – Bibliotheken, dem World Wide Web, etc. – fixieren lässt. Ich kann das damit aufscheinende Problem hier nur andeuten. Nur zeigt sich, dass Sprachlichkeit, derart als kulturelle Differenzierungsleistung beschrieben, zwar im Sinne eine kognitiven Evolution interpretierbar ist, sich aber nur bedingt in der Entwicklung des kognitiven Apparates nachzeichnen lässt. Einen ersten Ansatz zu einer solchen Bestimmung finde ich dabei etwa in einer eingehenden Betrachtung des Lesens. Lesen ist eine Kulturtechnik, die vergleichsweise jung ist und insbesondere als populationsbiologisch relevantes Phänomen erst nach Etablierung einer allgemeinen Lesekultur beschrieben werden kann. Damit bewegen wir uns in einer Zeitdimension von kaum mehr als 500 Jahren. Innerhalb dieses Zeitraumes haben sich die Lesetechniken radikal geändert. Mit der wachsenden Nutzung von Texten haben wir in Europa Lesetechniken entwickelt, die nunmehr spezifische Steuerungen neuronaler Art notwendig machten. Diese Lesetechniken – Sakkadensteuerung, Steuerung von Lese-Sprüngen über bestimmte Zeichenfolgen hinweg – lassen sich mit dem Instrumentarium einer Wahrnehmungspsychologie beschreiben. Es lässt sich dabei zeigen, dass der neuronale Apparat hier in einem sehr kurzen Zeitraum vergleichsweise umfassend adaptiert wurde. Lesen ist nicht einfach ein bewusst gesteuerter Vorgang. Lesen ist ein komplexer Bewegungssteuerungsvorgang, der die Funktion bestimmter neuronaler Programme zur Voraussetzung hat, die wir in unserer Ontogenese vergleichsweise mühsam erwerben. Das heißt, diese Kulturtechnik bilden wir in unserem Nervensystem regelrecht ab. Das Training bestimmter Augenbewegungen führt zu Automatismen, die sich neuronal codieren und deren neuronale Etablierung ich auch messen kann. Das bedeutet zunächst einmal nur, dass sich hier ein Bereich findet, in dem sich eine Kulturtechnik in vergleichsweise kurzer Zeit in der Auswahl einer bestimmten funktionalen Adaptabilität niederschlägt. Hier wird also eine Hirnfunktion top down, aus der Kultur heraus und nicht vice versa geformt. Dies ist natürlich nur ein erster, das Problem lediglich in einem Randbereich auslotender Ansatz, der aber doch zumindest ausweist, dass sich und wie, zumindest im Prinzip, eine kulturelle Evolution neuronal abbildet. Wir sehen damit, dass zwar mit einer vergleichenden Betrachtung angesetzt wer-

150

Olaf Breidbach

den kann, in der Hirnfunktionen zunächst an sich beschrieben werden. Eine umfassende Analyse der hier zu greifenden Entwicklungsprozesse macht es allerdings nötig, den Blick auszuweiten. Eine Biologisierung im engeren Sinne wäre zu relativieren, ggf. ist so auch die Methodik einer Analyse und Bewertung evolutionärer Prozesse radikal zu erweitern. Schließlich zeigt sich Kulturevolution nicht nur an sich effektiv, sie wirkt auch auf das neuronale System, formt dieses zumindest in der jeweiligen Adaptationsphase der individuellen Ontogenese nach ihren Vorgaben aus. Hier wirkt also die Kultur auf die Ausbildung der Natur. Nicht die biologische Evolution beschreibt die Kultur, sondern umgekehrt setzt nun auch die entstandene Kultur neue Prämissen, in denen sich die Natur – hier des Hirns – entwickelt. Zu fragen ist: Muss sich hierfür die Kultur in ihren Wirkungen komplett in die Evolution des Organs und des Verhaltensprogramms der Spezies Mensch hin abbilden? Oder entsteht in der Kultur selbst ein eigener Strukturierungsraum, der nach eigenen Regeln funktioniert und das Biologische nun seinerseits mit einbindet? Wie sich andeutete, hätte das dann zwar ggf. Effekte auf die Auswahl der günstigen „Material“-Eigenheiten und damit auf die Organevolution des Hirnes. Doch wäre diese nicht einfach mit dem Vokabular, das eine mögliche funktionelle Differenzierung des Hirnorgans nachzuzeichnen erlaubt, darzustellen. Vielmehr wäre eine der biologischen Konsequenzen die Präferenz offener Gewebeanlagen. Folglich wären Strukturen dann im Rahmen einer entwicklungsbiologischen, constraints und Dispositionen nachzeichnenden Darstellung aus einem engeren funktionsmorphologischen Kontext zu lösen. Auch kann für eine Beschreibung der Kulturevolution und deren Wirkung auf die biologische Evolution nicht einfach auf die Denkmuster und Methoden einer biologischen Evolutionslehre zurückgegriffen werden. Kulturevolution kann nicht einfach auf biologische Selektionsmuster im Sinne einer vergleichenden Verhaltenslehre rückgestuft oder ggf. im Rahmen einer (diese dann weiter eingrenzenden) Soziobiologie beschrieben werden. Kulturelle Evolution muss aus einer kulturalistischen Perspektive beschrieben werden, deren Methodik nicht einfach aus der cognitive science abgezogen werden kann. Was heißt dies nun aber, wenn wir in den Vorgaben der Sprache für diese eine Entwicklungslinie nachzuzeichnen suchen, die wir dann ja nicht einfach im Sinne eines Optimierungsprogramms gradlinig und zielbezogen auslegen können. Selektionen und Optimierungen können wir in Bezug auf eine Geschichte dieser Kultur beschreiben, die uns aber nicht einfach im Rahmen der biologischen Methoden zu greifen ist. Die Evolution der Sprache vollzieht sich in sehr viel komplizierterem Gefüge. Sie hat – um in den Theorien biologischer Argumentationen zu operieren – Neutralzonen, Räume, in denen Bestimmungen tradiert werden, die wenig oder kaum etwas zu kosten scheinen, die aber ggf. in neuen Konstellationen doch nutzen oder

Evolution des Kognitiven

151

schaden können. Kanonisierungen von Literatur, und damit die Festschreibung von Wert- und Bewertungsurteilen, abgeschlossene Archive, verlorene oder verdrängte Sprachen, tradierte Wortbestände und sich verzahnende Wort- und Bedeutungszuordnungen mögen ein wenig von diesen neuen Freiheiten etwaiger neutraler Bereiche der hier nachzuzeichnenden Entwicklungen erkennen lassen. Ist so die Sprache in dem in diesem Sinne selektionsfreien Raum der Bibliotheken und Archive zugleich das Reservoir, in dem wertneutral eine Fülle von Lösungsmöglichkeiten gespeichert ist? Nun ist aber Sprache immer auch die Form des Denkens und somit die Form, in der sie auf sich selbst zu reflektieren erlaubt. Oder ist Sprache dabei dann doch nur die Artikulationsform eines Denkens, das sich zwar durch diese Artikulationen geführt weiß, sich mit diesen ausweist, aber dabei weit mehr als ein nur in äußerer Ordnung befangenes Gefüge darzustellen erlaubt? Ist das Denken also durch die Sprache geführt, oder setzt es sich selbst zuerst in den Handlungen frei, die, dann in die Sprache überführt, Teil einer Kultur und damit eines zu vermittelnden Raumes vorgegebener Werte darstellen? Öffnen sich also mit der Sprache dem Verhalten – und den dieses leitenden Bestimmungen – neue Horizonte, oder führt die Sprache mit zunehmender Komplexität der ihr eigenen Rückverweisungen die Entwicklung einer Kultur in eine Sackgasse und vernichtet so à la longue die Dynamik, in der eine Kulturevolution als Fortführung der Evolution gezeichnet wurde? Mit der Sprache stehen wir in einem Gefüge, das sich in seinen Verweisen und Referenzen in sich abstimmen lässt. Die Sprache führt aus den Unwägbarkeiten momentaner sinnlicher Vergewisserungen heraus, verweist in der Struktur eines sich in sich verweisenden Bestimmens, in der Grammatik, Topik und Logik an einen Erfahrungszusammenhang, der seinerseits dann die Perzeption und damit die Erfahrung von Neuem vorzuordnen scheint. Vordergründig lösen wir damit die Frage nach der Geltung der von uns getroffenen Aussagen mit dem Verweis auf die subjektive Bestimmtheit, in der wir uns mit dem uns eigenen Gefüge von Aussagezusammenhängen einhüllen und gegenüber der für uns an sich unbestimmten Welt sichern und abgrenzen können. Dieser Mantel von Bestimmungen ist dabei selbst gestrickt. Er belegt damit zunächst nur die innere Ordnung, die wir in uns selbst finden, und die wir in unserer Kultur vermitteln. Er verweist damit aber auch auf einen Zusammenhang von Sprache und Gehirn, der nicht einfach als Fortführung der Biologie in der Geschichte zu schreiben ist, sondern der gerade da spannend wird, wo sich umgekehrt die Kultur als etwas ausweist, das das Neuronale oder zumindest dessen Funktionalität bestimmt. Hier scheint sich somit nicht nur eine einfache Potenzierung eines vorgegebenen Musters im – durchaus schlechten – Schelling’schen Sinne abzuzeichnen. Vielmehr zeigt sich etwas Neues, in dem eine Naturalisierung

152

Olaf Breidbach

der Kultur nicht einfach zu einem Biologismus führt, sondern eine Zuordnung zu benennen ist, die es dann in der Tat auch in neuer Weise sinnvoll erscheinen lässt, eine Kulturgeschichte als Kulturevolution und damit – zumindest in Aspekten – auch eine Sprachgeschichte als Sprachevolution zu denken.

Literaturverzeichnis Aviel, Yuval / Evgeny Pavlov / Moshe Abeles / David Horn, „Synfire chain in a balanced network“, in: Neurocomputing 44 (2002), S. 285–292. Braitenberg, Valentin, Vehicles. Experiments in Synthetic Psychology, Cambridge, MA: MIT Press, 1984. Braitenberg, Valentin / Almut Schüz, Statistics and Geometry of Neuronal Connectivity, Berlin: Springer, 21998. Breidbach, Olaf, Expeditionen ins Innere des Kopfes – Von Nervenzellen, Geist und Seele, Stuttgart: Trias, 1993. –, „Vernetzungen und Verortungen – Bemerkungen zur Geschichte des Konzepts neuronaler Repräsentation“, in: Repräsentationismus – Was sonst?, hg. von Axel Ziemke und Olaf Breidbach, Braunschweig: Vieweg, 1996, S. 35–62. –, Die Materialisierung des Ichs – Eine Geschichte der Hirnforschung im 19. und 20. Jahrhundert, Frankfurt/M.: Suhrkamp, 1997. –, „Internal Representations – A Prelude for Neurosemantics“, in: The Journal of Mind and Behaviour 20 (1999), S. 403–420. –, Das Anschauliche oder über die Anschauung von Welt. Ein Beitrag zur Neuronalen Ästhetik, Wien, New York: Springer, 2000 (= 2000a). –, „Neurologik?“, in: Selbst und Gehirn, hg. von Albert Newen und Kai Vogeley, Paderborn: Mentis-Verlag, 2000, S. 353–363 (= 2000b). –, Deutungen, Weilerswist: Velbrück, 2001. –, „Die letzten Kabbalisten, die neue Wissenschaft und ihre Ordnung. Bemerkungen zu den Traditionslinien bio- und neurowissenschaftlicher Forschung“, in: Form, Zahl, Ordnung. Studien zur Wissenschafts- und Technikgeschichte, hg. von Rudolf Seising, Menso Folkerts und Ulf Hashagen, Stuttgart: Steiner, 2004, S. 63–76. –, „Lesen“, in: Wörterbuch der philosophischen Metaphern, hg. von Ralf Konersmann, Darmstadt: Wissenschaftliche Buchgesellschaft, 2007, S. 195–207. –, „Neurosemantics, neurons and system theory“, in: Theory in Biosciences 126 (2007), S. 23–33. Campenhausen, Christoph von, Die Sinne des Menschen, Stuttgart: Thieme, 1993. Cangelosi, Angelo / Domenico Parisi (Hg.), Simulating the Evolution of Language, Berlin, New York: Springer, 2002. Catalano, Susan M. / Carla J. Shatz, „Activity-dependent cortical target selection by thalamic axons“, in: Science 281 (1998), S. 559–562. Chater, Nick / Florencia Reali / Morten H. Christiansen, „Restrictions on biological adaptation in language evolution“, in: Proceedings of the National Academy of Sciences 106 (2009), S. 1015–1020. Chomsky, Noam, The Minimalist Program, Cambridge, MA: MIT Press, 1995.

Evolution des Kognitiven

153

Christiansen, Morten H. / Simon Kirby, „Language evolution: consensus and controversies“, in: Trends in Cognitive Sciences 7 (2003), S. 300–307. – (Hg.), Language Evolution, Oxford: UP, 2005. Creutzfeldt, Otto D., Cortex cerebri, Berlin, Heidelberg: Springer, 1983. Daston, Lorraine / Peter Galison, Objektivität, Frankfurt/M.: Suhrkamp, 2007. Dennett, Daniel, Consciousness Explained, Boston: Little, Brown, 1991. Engel, Andreas K. / Pieter R. Roelfsema / Pascal Fries / Michael Brecht / Wolf Singer, „Binding and response selection in the temporal domain – a new paradigm for neurobiological research“, in: Theory in Biosciences 116 (1997), S. 241–266. Engel, Andreas K. / Wolf Singer, „Temporal binding and the neural correlates of sensory awareness“, in: Trends in Cognitive Science 5 (2001), S. 16–25. Feess-Higgins, Alison / Jeanne Claudie Larroche, Le développement du cerveau foetal humain: atlas anatomique, Paris: Masson, 1987. Fischer-Lichte, Erika / R. Sollich / S. Umathum / M. Warstatt (Hg.), Auf der Schwelle. Kunst, Risiken und Nebenwirkungen, München: Fink, 2006. Fitch, W. Tecumseh / Marc D. Hauser / Noam Chomsky, „The Evolution of the Language Faculty: Clarifications and Implications“, in: Cognition 97 (2005), S. 179–210. Flor, Herta / Lone Nikolajsen / Troels S. Jensen, „Phantom limb pain: a case of maladaptive CNS plasticity?“, in: Nature Reviews Neuroscience 7 (2006), S. 873–888. Florey, Ernst / Olaf Breidbach (Hg.), Das Gehirn – Organ der Seele? Zur Ideengeschichte der Neurobiologie, Berlin: Akademie Verlag, 1993. Friederici, Angela D., „The neural basis of language development and its impairment“, in: Neuron 52 (2006), S. 941–952. Griffin, Donald R. / John H. Friend / F. A. Webster, „Target discrimination by the echolocation of bats“, in: Journal of Experimental Zoology 158 (2006), S. 155–168. Grüsser, Otto Joachim / Thomas Selke / Barbara Zynda, „A developmental study of face recognition in children and adolescents“, in: Human Neurobiology 4 (1985), S. 33– 39. Heidelberger, Michael, Nature from Within: Gustav Theodor Fechner and his Psychophysical Worldview, Pittsburgh, PA: UP, 2004. Huang, Hao / Rong Xue / Jiangyang Zhang / Tianbo Ren / Linda J. Richards / Paul Yarowsky / Michael I. Miller / Susumo Mori, „Anatomical Characterization of Human Fetal Brain Development with Diffusion Tensor Magnetic Resonance Imaging“, in: The Journal of Neuroscience 29 (2009), S. 4263–4273. Jackson, J. Hughlings, „The Croonian Lectures on evolution and dissolution of the nervous system“, in: British Medical Journal 104 (1884), S. 591–593, 660–663, 703–707. Joyce, James, Ulysses, Harmondsworth: Penguin Books, 101977. –, Ulysses, kommentierte Ausgabe, Frankfurt/M.: Suhrkamp, 32005. Katz, Lawrence C. / Carla J. Shatz, „Synaptic activity and the construction of cortical circuits“, in: Science 274 (1996), S. 1133–1138. Kennard, Christopher / Michael Swash (Hg.), Hierarchies in Neurology: a Reappraisal of a Jacksonian Concept, London, Berlin, New York: Springer, 1989. Link, David, „Poetry Machine (version 1.0)“, http://www.alpha60.de/poetrymachine/ [3.3.2010]. Lorenz, Konrad, Vergleichende Verhaltensforschung: Grundlagen der Ethologie, Wien, New York: Springer, 1978.

154

Olaf Breidbach

Majdan, Marta / Carla J. Shatz, „Effects of visual experience on activity-dependent gene regulation in cortex“, in: Nature Neuroscience 9 (2006), S. 650–659. Marr, David, Vision. A Computational Investigation into the Human Representation and Processing of Visual Information, San Francisco: Freeman, 1982. Meares, Russell, „The Contribution of Hughlings Jackson to an Understanding of Dissociation“, in: American Journal of Psychiatry 156 (1999), S. 1850–1855. Nagel, Thomas, „What Is it Like to Be a Bat?“, in: Philosophical Review 83 (1974), S. 435– 450. Nolfi, Stefano / Dario Floreano, Evolutionary Robotics: The Biology, Intelligence, and Technology of Self-Organizing Machines, Cambridge, MA: MIT Press, 2000. Nolfi, Stefano / Marco Mirolli, Evolution of Communication and Language in Embodied Agents, Berlin, Heidelberg: Springer, 2010. Quine, Willard Van Orman, Ontologische Relativität und andere Schriften, Frankfurt/M.: Klostermann, 2003. Reichold, Anne, Die vergessene Leiblichkeit. Zur Rolle des Körpers in ontologischen und ethischen Persontheorien, Paderborn: Mentis-Verlag, 2004. Regenspurger, Katja / Temilo van Zantwijk (Hg.), Wissenschaftliche Anthropologie um 1800? Stuttgart: Franz Steiner, 2005. Rodriguez, Eugenio / Nathalie George / Jean-Philippe Lachaux / Jaques Martinerie / Bernard Renault / Francisco Varela, „Perception’s shadow: Long-distance synchronization of human brain activity“, in: Nature 397 (1999), S. 430–433. Rossi, Paolo, Il passato, la memoria, l’oblio, Bologna: Molino, 1991. Roth, Gerhard, Das Gehirn und seine Wirklichkeit. Kognitive Neurobiologie und ihre philosophischen Konsequenzen, Frankfurt/M.: Suhrkamp, 1994. Rusch, Gebhard / Siegfried J. Schmidt / Olaf Breidbach (Hg.), Interne Repräsentationen – Neue Konzepte der Hirnforschung, Frankfurt/M.: Suhrkamp, 1996. Rushton, Stephen P., „Applying brain research to create developmentally appropriate learning environments“, in: Young Children 56 (2001), S. 76–82. Satzinger, Helga, Die Geschichte der genetisch orientierten Hirnforschung von Cécile und Oskar Vogt (1875–1962, 1870–1959) in der Zeit von 1895 bis ca. 1927, Stuttgart: Deutscher Apotheker-Verlag, 1998. Savigny, Eike von, Die Signalsprache der Autofahrer, München: dtv, 1980. Schleicher, August, Die Darwinsche Theorie und die Sprachwissenschaft – offenes Sendschreiben an Herrn Dr. Ernst Haeckel, Weimar: Hermann Böhlau, 1863. Singer, Wolf, Der Beobachter im Gehirn. Essays zur Hirnforschung, Frankfurt/M.: Suhrkamp, 2002. Taub, Liba, „Evolutionary Ideas and ‚Empirical‘ Methods: The Analogy Between Language and Species in the Works by Lyell and Schleicher“, in: The British Journal for the History of Science 26 (1993), S. 171–193. Tomasello, Michael, Die kulturelle Entwicklung des menschlichen Denkens: zur Evolution der Kognition, Frankfurt/M.: Suhrkamp, 2006. –, Die Ursprünge der menschlichen Kommunikation, Frankfurt/M.: Suhrkamp, 2009. Turing, Alan Mathison, „Computing machinery and intelligence“, in: Mind 59 (1950), S. 433–460.

Evolution des Kognitiven

155

Voland, Eckart, Grundriss der Soziobiologie, Heidelberg: Spektrum Akademischer Verlag, 2 2000. –, Die Natur des Menschen. Grundkurs Soziobiologie, München: Beck, 2007. Young, Deborah / Patricia A. Lawlor / Paola Leone / Michael Dragunow / Matthew J. During, „Environmental enrichment inhibits spontaneous apoptosis, prevents seizures and is neuroprotective“, in: Nature Medicine 5 (1999), S. 448–453. Zeki, Semir, A Vision of the Brain, Oxford: Blackwell, 1993.

156

“The Roots of Art Are in the Dream” Dreams, Literature and Evolution Michaela Schrage-Früh

I. Introduction In his “Introduction” to Literary Darwinism (2004), Joseph Carroll criticises the humanities for having been reluctant to adopt insights offered by the life sciences. As he explains, “[i]n the humanities, scholars happily confident of their own avant-garde creativity continue to repeat the formulas of Freud, Marx, Saussure and Lévi-Strauss – formulas that have now been obsolete in their own fields for decades” (Carroll 2004, p. x). One example illustrative of this reactionary stance is the way most literary scholars still resort to Freudian dream theory when interpreting literary dreams or exploring the relationship between creativity and dreaming in general – despite the fact that most of Freud’s hypotheses regarding the “dream-work” and the psychoanalytic conclusions he draws from them have been refuted or at least thoroughly modified by recent sleep and dream research. As I will argue in this paper, approaches to dreams based on the findings of neurocognitive science and evolutionary psychology are better suited to explain the functions and benefits of dreams as well as their relevance for consciously created fictions. If, as recent researchers suggest, “dream and art, in all its varieties, are manifestations of the same biological need to convert experiences into structure and […] dreaming, in all likelihood, preceded art-making in historical priority” (States 1997, p. 1), then it follows that the insights of sleep and dream research are deeply relevant to our understanding of the origins, functions and workings of literary fictions. In the following I will first briefly outline Freud’s seminal model of the dream-work in the light of recent scientific findings and Hobson’s activation-synthesis-model ensuing from these findings in particular. I will then turn to some exemplary evolutionary approaches to dreaming and in doing so point out the similarities shared by dreaming and storytelling as adaptive functions. In a final step I will sketch some possible consequences for and

“The Roots of Art Are in the Dream”

157

advantages of a future interdisciplinary combination of dream studies and literary studies.

II. The Function of Dreams According to Freud The idea that dreams, above all, are “the royal road to the unconscious”, as Freud so famously put it, resulted in the fact that dreams were mostly regarded as a means to an end, the psychotherapist’s entrance into the patient’s submerged world of childhood experiences and repressed infantile desires. Dreams, in this theory, are viewed as “wishfulfilling hallucinations” (Rycroft 1979, p. 9). According to Freud, what mattered was not so much what happened ostensibly in the dream, but what buried truths could be excavated through careful interpretation and associative analysis of the dream symbols. For this reason he differentiated the manifest dream content (the dream as we remember and report it) from the latent dream thoughts (that could only be revealed psychoanalytically). What Freud called the “dream-work” worked like this: during sleep, our unfulfilled, often libidinal, wishes usually repressed by our ego, threaten to invade consciousness and disturb sleep. In order to guard our sleep, a censorship mechanism protects the sleeper by disguising these possibly disturbing repressed desires as ostensibly harmless bits of day time residues. Our wishes are secretly fulfilled without disturbing our sleep or destroying our respectable self-image. As Freud himself puts it, “the content of a dream is the representation of a fulfilled wish and […] its obscurity is due to alterations in repressed material made by the censorship” (Freud, quoted in Rycroft 1979, p. 8). These “alterations in repressed material” are achieved through the dream-work, “the process by which the latent content of a dream (i.e. its original, undisguised text) is translated into its manifest content (i.e. the text as actually remembered and reported by the dreamer)” (Rycroft 1979, p. 20). Its most important tools are displacement, symbol formation and condensation. As Rycroft explains, displacement obeys the laws of association and generates figures of speech; displacement from whole to part producing synecdoche, displacement from something to something else which resembles it producing metaphor, and displacement from something to something else associated with it producing metonymy. (Rycroft 1979, p. 17)

The second major mechanism, condensation, “is the process or device by which two or more images are fused to form a composite image which has meaning derived from both (or all) – or which means that which is common to both” (Rycroft 1979, p. 15). As Anthony Shafton puts it, in order to ensure maximum disguise, “[a]n image cannot enter the dream unless more meanings than one converge in and complexify it. Every image is thus ‘over-determined.’ Condensation is responsible for hybrid imagery.” (Shafton 1995,

158

Michaela Schrage-Früh

p. 53). Thus, every dream symbol has a multiplicity of meanings and numerous referents, as exemplified for instance by the tendency of people to merge into composite dream-characters or change their identity in the course of a dream. The latent dream thoughts and repressed desires can only be unravelled by means of the psychoanalytical technique of free association in what Freud termed the process of “secondary revision”. As Shafton points out, “[t]he main point upon which Freud insisted is that his upper level of coherence, the manifest dream, is a mere façade and not a direct analog for, not a helpful metaphor for his lower and more essential level of coherence, the latent dream-thought” (Shafton 1995, p. 59). Instead, according to Freud, “we should disregard the apparent coherence between a dream’s constituents as an unessential illusion” and view the “dream [as] a conglomerate which, for purposes of investigation, must be broken up once more into fragments” (ibid.). According to Freud’s view, then, dreams fulfil the biological function of guarding the dreamer’s sleep by converting any disturbing thoughts and wishes present during sleep into disguised wish-fulfilling hallucinations. They also fulfil a therapeutic function because through the method of secondary revision of the manifest dream content patient and analyst can bring to consciousness the repressed latent dream thoughts. Since Freud viewed dreams as repressive mechanisms, he saw them as “analogous to neurotic symptoms inasmuch as they are constructed by the same psychological mechanisms despite the fact that they occur not only in neurotic but also in healthy persons” (Rycroft 1979, p. 8).1 Since he, at the same time, agreed that there “is some connection between dreams and the waking imagination”, the problematic conclusion that “imagination must also be an abnormal psychic phenomenon” (p. 5) suggests itself all too easily.2 The majority of recent researchers have refuted the assumption that the processes of dreaming and (by implication) of literary creation are analogous to neurotic processes. As Stanley Palombo sums up, “Freud’s theory remains a powerful and clinically useful statement about the psychopathology of dreaming, though no longer […] a reasonable explanation for the phenomenon of dreaming in its entirety.” (Palombo 1983, p. 312). What is more, as we will

1

2

In Freud’s own phrasing in “Revision of the Theory of Dreams”: “[I]n the construction of neurotic symptoms the same mechanisms (we do not venture to say ‘processes of thought’) are operative as those which have transformed the latent dream-thoughts into the manifest dream” (1992, p. 41). Cf. also Freud’s essay “Der Dichter und das Phantasieren” (1908), translated as “Creative Writers and Daydreaming”, in which Freud elaborates on the relation between child’s play, dreams and waking fantasies such as novels. Rycroft discusses the dangerous implications and inconsistencies arising from “Freud’s attempts to explain a normal activity [such as dreaming or waking imaginative activity] in language designed for illness” (1979, p. 5).

“The Roots of Art Are in the Dream”

159

see, the insights offered by empirical brain research are mostly incompatible with Freud’s purely psychological model.

III. The Randomness of Dreams According to Hobson The most noteworthy turning point in dream theory since Freud’s Die Traumdeutung (1899) was certainly the discovery of rapid eye movement sleep (REM sleep).3 REM sleep occurs in regular 90-minute cycles and is accompanied by especially vivid, visual and intense dreams. Its characteristics are as follows: not only is the brain found to be in a heightened state of activation similar to wakefulness, but other bodily symptoms are activated as well, such as accelerated breath and heartbeat or stimulation of the genitals. At the same time the skeletal muscle tone (with the exception of the musculature controlling the eye movements) drops considerably. The sleepers’ paralytic state serves the function to prevent them from acting out their dream and possibly endanger themselves in doing so. It has been found that 25 % of our sleep each night is spent in the REM state, which suggests that this state serves an important biological function that cannot be explained on purely psychological grounds alone (cf. Solms and Turnbull 2002, p. 183). The initial assumption that dreaming is confined to REM sleep has by now lost its currency, since dreams have been found to occur during nonREM sleep phases, if to a lesser extent, especially during the transitional stages between waking and sleeping. Nevertheless dreams mostly – and most vividly – occur during REM sleep. The perhaps most influential theory to have emerged from the discovery of REM sleep is Hobson’s and McCarley’s activation synthesis model, introduced in 1977 and initially based on the assumption that REM sleep is the physiological correlate to dreaming. The original theory has since been revised and adapted by Hobson, but the basic assumption has remained intact, namely that the brain functions as “a dream machine” (Hobson 1992, p. 452) trying to make “the best of a poor job” (Vogel 1993, p. 3) by struggling to turn randomly produced images into coherent stories. According to Hobson and McCarley, the pontine hindbrain produces electric signals that are both random and psychologically meaningless, which accounts for what they consider the bizarreness of dreams or distortion of dream images. Thus, although the forebrain tries to “synthesize its random patterns into a meaningful whole” by drawing on “ordered activation patterns of stored memories” (Vogel 1993, p. 3), these attempts are not always successful. With this explanation, Hobson and McCarley, then, account for what they consider dream bizarreness and occasional dream coherence at 3

In 1953 Eugene Aserinsky and Nathaniel Kleitmann discovered that sleep consists of two cyclically alternating states, REM (Rapid Eye Movement) and non-REM sleep.

160

Michaela Schrage-Früh

one go. At the same time “they were able to claim that since the generation of REM is an automatic, preprogrammed process, its unconscious mental correlate [dreaming] is as ‘motivationally neutral’ [...] as the brainstem mechanism that generates your heartbeat” (Solms and Turnbull 2002, p. 187). Dreaming, according to this theory, is the result of the forebrain’s more or less successful attempts at coming up with “the best possible fit of intrinsically inchoate data produced by the auto-activated brain-mind” (Hobson 1992, p. 453). It is thus ultimately a psychologically meaningless, because random, by-product of physiological processes. Moreover, Hobson concurs with Freud in so far as he interprets our nocturnal visions as a form of delirium and psychosis: “The study of dreams is the study of a model of mental illness.” (Hobson 1988, p. 9).

IV. Evolutionary Approaches to Dreams While dream research in the twentieth century was dominated by Freudian theory on the one hand and Hobson’s model on the other, the beginning of what has been termed the “cognitive revolution” brought to the fore numerous rivalling theories. Based on the physiological insights of empirical dream research, these theories come up with different and, I would argue, on the whole more convincing explanations as regards the functions of dreaming. Their shared basic assumption is that if dreaming occurs as often and as regularly as it does in all humans (and for that matter in all mammals), it very likely serves some crucial function assisting the individual’s and the species’ survival. Among these more recent approaches are those which might be subsumed under the heading of evolutionary approaches to dreams in that they argue that “the dream state was selected for as an adaptation which increases overall fitness” (Franklin and Zyphur 2005, p. 60). IV.1 Threat Rehearsal The first of these theories that I would like to outline here was suggested by the Finnish evolutionary philosopher Antti Revonsuo. He proposed that dreaming provides threatening scenarios so that individuals can rehearse for real-life threats without endangering themselves. This claim is supported by current neuroimaging data showing that the same brain regions are activated no matter if we actually perform a task or only imagine that we do. By being able to rehearse certain scenarios, exercising a part of the brain without having to physically experience potentially dangerous behaviour-eliciting stimuli, we can optimise mental functioning and our response real-life situations – even more so during a dream whose content is “perceptually indistinguishable from waking perception” (Franklin and Zyphur 2005, p. 65). Drawing on data collected by Calvin Hall and Robert Van de Castle in 1966, Franklin

“The Roots of Art Are in the Dream”

161

and Zyphur suggest that “the overrepresentation of threatening elements in dreams, which should not occur if dream content is random” (p. 66), clearly supports Revonsuo’s threat rehearsal theory. Finally, Revonsuos’s theory accounts for the fact that during REM sleep the sleeper’s higher-order mental processes needed to intellectually assess situations are deactivated. According to his theory, this is necessary as the perceived threats must be experienced as real in order effectively to school the individual’s survival capacities. Questioning the reality of the dream experience would obviously be counterproductive to the effect of rehearsal. All these aspects suggest the adaptive function of REM sleep that is clearly advantageous to an individual’s survival. As Franklin and Zyphur sum up, [e]vidence from mental imagery and dream studies suggest that rehearsal in the dream is treated as a real threat and, therefore, those individuals with these imagery skills to rehearse threatening scenarios should have an improved ability to deal with threat, making them more likely to be the progenitors of offspring. (p. 66)

IV.2 Rehearsal of Social Cognition Revonsuo’s model of threat rehearsal has been expanded and complemented by other evolutionary researchers. Among those are Franklin and Zyphur who, in an article from 2005, suggest that “the fitness-enhancing benefits of dreaming is [sic] not restricted to threat rehearsal, and the evolution of other higher-order cognitive faculties has been strongly influenced by a dreaming mechanism” (Franklin and Zyphur 2005, p. 66). Interestingly, during REM sleep there is an activity increase in those brain regions implicated in decision making, conflict resolution and social cognition. This suggests that, during REM sleep, cognitive faculties concerned with the processing of social information are strongly activated, which accounts for the large number of dreams in which we are involved in social interaction, dealing with other people in various social situations (cf. p. 69). According to Franklin and Zyphur, not only the rehearsal of life-threatening scenarios, but also the rehearsal of social situations plays a significant role for an individual’s survival. Their theory that during REM sleep we practise and rehearse social scenarios is supported by the fact that REM sleep occurs most frequently in newborns and decreases throughout the life span. This would suggest that children learn their social cognitive abilities to a large extent during REM sleep.4 Franklin and Zyphur conclude that “the experiences we accrue from dreaming over a lifespan are

4

Interestingly, this theory might also at least partly account for the phenomenon of autism. As Franklin and Zyphur note, “[a]utism has been likened to a TOM-deficit and is associated with disrupted sleep patterns.” In the light of this, they propose the hypothesis that “a portion of the deficits observed in autistics may be due to their lack of REM sleep” (Franklin and Zyphur 2005, p. 72).

162

Michaela Schrage-Früh

sure to influence how we interact with the world and are bound to influence our overall fitness, not only as individuals, but as a species” (p. 73). IV.3 Capacity for Cross-Connecting It is by now widely accepted that REM sleep plays an important role in processes of memory consolidation as well as the assimilation of new experience into the structure of memory. The question that has caused disagreement is whether dreams are simply an unavoidable and meaningless by-product of this physiological process or whether they, too, are implicated in or even needed for the processing and ordering of memories and memory connections. The latter view is confirmed by the majority of dream researchers for several reasons, the most basic argument being that, after all, dreaming is not confined to REM sleep but occurs during other phases of sleep as well. As Ernest Hartmann points out, “[b]ecause of its broader connection making, dreaming is especially good at noting similarities and creating metaphor. Dreaming makes use of our visual / spatial picturing abilities and provides an explanatory metaphor for the dreamer’s emotional state of mind.” (Hartmann 1998, p. 4). Accordingly, dreaming “does not simply consolidate memory, but interweaves and increases memory connections. These new connections, or increased connections, are what make dreaming useful in problem solving, as well as in scientific and artistic creation.” (ibid.). One possible function of dreaming, then, might be the “broadening of memory through cross-connections, which may be useful in increasing adaptation for future functioning” (p. 123). In a similar vein, Palombo regards dreaming as an intermediate step in the overall process through which new experience is assimilated into the structure of memory; condensation is not primarily a defensive operation, as Freud suggested, but a test of congruence that determines which associative links will bind the new experience into the structure of the dreamer’s past. (Palombo 1983, p. 306)

Interestingly, Palombo likens what he calls “the genius of the dream” to other natural processes that recombine existing elements to produce new shapes and configurations. We experience the same mystery when we contemplate the generation of unique individuals through the matching process of sexual reproduction or the origin of new species through natural selection. The magic works because very complex elements are being matched, and the mechanisms that bring them together are not restricted in their experiments by narrowly logical categories. If the opportunity for new combinations arises repeatedly, as we now know it does in the regular cycles of dreaming sleep, then the emergence of novel forms and qualities becomes inevitable. (p. 307)

Moreover, he emphasises the ability of the matching process to go beyond the narrow logical categories of waking thought to reach deeper levels of experience otherwise inaccessible to the

“The Roots of Art Are in the Dream”

163

dreamer. This ability accounts for the important role played by dreaming in the creative process generally and in the day-to-day working-through process of psychoanalytic therapy. (p. 312)

Elaborating on the inherent creativity of the dream process, Hartmann suggests that “[i]f we consider the artist as someone who can see things a bit more broadly or can make connections a bit more easily than most, we can see this as a developed form of an ability we all possess in dreams” (Hartmann 1998, p. 164). IV.4 The Dual-Memory System Michele Stephen’s model of the “imaginal mind” is particularly suited to account for the creative, transformative and visionary potential inherent in dreams. Her model suggests the co-existence of two separate memory registers, the “semantic / language register of memory”, which is usually available to waking consciousness, and the “emotionally-coded memory register” (Stephen 2003, p. 97), which catalogues experience according to its emotional significance and operates outside consciousness. Stephen associates dreaming with this latter memory register of the “imaginal mind”. According to Stephen, one major function of REM sleep and dreaming “is to review the day’s sensory input and relate it to, and encode it in, the emotional memory system. This process of storing in memory involves linking new sensory information to existing emotional categories or schemas.” (p. 98). Dreaming, then, “represents a different way of apprehending and evaluating the world” (p. 110). Freed from our semantically constructed conceptions of the world, dreams can provide us with insights occluded in everyday life by representing “the incomprehensible, the unthinkable – unthinkable, that is, in language and words” (ibid.). As Stephen points out, “[t]he creativity of the imaginal system is of a special kind that arises from its capacity to represent information and express things which cannot be represented or expressed verbally, and thus are not registered in the verbal memory system. It steps in where language fails.” (p. 111). This, according to Stephen, accounts for the central role attributed to dreams in prophecy and, I would suggest, links the roles of prophet / dreamer and poet / writer, both of whom are enabled to “transcend the semantically created world of society and culture, and thus [are provided with] the means of formulating a new vision which can be translated into language at a later date” (ibid.).

V. Dreams and (Literary) Art Attempts to highlight and explore the dream’s creative instead of its pathological potential have led recent dream researchers to become more interested in the manifest dream content and to explore the aesthetic value of our dream

164

Michaela Schrage-Früh

experiences. They view dreams as products of play rather than work and as artistic visions rather than neurotic symptoms. As Kelly Bulkeley notes, [w]hat the play metaphor clearly highlights is the genuine creativity that is involved in dream formation. Whereas Freud repeatedly depreciated the creativity of dreaming, the vast majority of contemporary dream researchers insist that creativity is an essential, integral part of the dream formation process. (Bulkely 1999, p. 64)

Dreams, then, are seen as expressive, rather than repressive, as offering metaphorical expressions of emotional content rather than distorted symbols of repressed wishes. If viewed, in Montague Ullmann’s phrase, as “metaphors in motion” (Ullmann 1969, pp. 696ff.), dream images are not distorted, but they simply express many things at once, uncovering analogies in at first glance unrelated objects or activities that tend to be overlooked by our more rationally oriented waking minds in a similar way to literary metaphors. As Hartmann puts it, dreaming and artistic creativity indeed share the same “basic mechanism”: In a broad sense, artistic creativity involves making new arrangements or new connections, obviously not randomly, but picturing or expressing in some way the emotional state of the artist. In other words artistic creativity, exactly like dreaming, involves making new connections, or making connections broadly, guided by the dominant emotions. The work of art, much like the dream, contextualizes the emotion or emotional concern for its creator. (Hartmann 2000, p. 72)

The resulting dream images may appear bizarre, nonsensical and distorted when compared to our waking experiences, but their way of capturing not just one incident in our lives and its emotional impact but rather a complex and condensed emotional trajectory is very similar to how literary images are employed. Bert O. States here draws a useful parallel between dream images and cubistic images, explaining that the dream’s business is “to enact the emotion in its entirety as a psychic state that can only be represented cubistically – that is, a fusion of past and present experience. Cubism is the all-atonceness of an object; the dream is the all-at-onceness of an emotional history.” (States 1993, p. 102). This explanation accounts for the seeming bizarreness of dreams in which dream characters and settings are fluid and in which we are confronted with what States calls “literal metaphors” whose “tenor has collapsed into the vehicle and is lost” (p. 134). Accordingly, quite a few literary critics have turned their attention to the interconnectedness of dreams and fictions, most notably among them States. According to him, not only are “the roots of art” (States 1987, p. 79) in the dream, but “the dream […] is the ur-form of all imaginative thought” (States 1993, p. 85). He argues that “[t]he dream precedes art both in the history of the race and the history of the individual psyche” (States 1987, p. 78). To States, then, dreams are “naked fictions” and fictions are “dreams in street clothing” (States 1997, p. 236). In other words, a dream can be compared to a first rough draft of fiction, developing according to the same

“The Roots of Art Are in the Dream”

165

compositional rules as a work of literature and deriving from a similar innate need to structure the world by turning our experience into narrative. Both dreams and fictions, then, can be viewed as adaptive functions because the capacities they school such as condensing “emotions and abstractions into images and [finding] resemblances in categories that are miles apart [...] are what enable the organism to adapt to unexpected changes in its environment” (States 1987, p. 95). This view ties in with John Tooby’s and Leda Cosmides’ hypothesis that the human delight in fictions and other products of the imagination serves an adaptive function. As they point out, “[i]nvolvement in fictional, imagined worlds appears to be a cross-culturally universal, species-typical phenomenon” (Cosmides and Tooby 2001, p. 7). Of course the same is true of the cross-culturally universal activity of dreaming, which David Mitchell aptly describes as being “near the genderless feet of the totem pole of Homo sapiens’ common denominators” (Mitchell 2008, p. 437). A further similarity is that “fictional worlds engage emotion systems while disengaging action systems (just as dreams do)” (Cosmides and Tooby 2001, p. 8). In contrast to all other species, humans are uniquely equipped with the capacity to distinguish between actual truth and imagined or contingent truth. Dreams and consciously created fictions alike, then, serve the purpose of broadening our scope of experience in an almost unlimited way. This again has the powerful and highly advantageous effect of unleashing our reactions to potential lives and realities [so that] we feel more richly and adaptively about what we have not actually experienced. This allows us not only to understand others’ choices and inner lives better, but to feel our way more foresightfully to adaptively better choices ourselves. (p. 23)

In this way Tooby and Cosmides account for the fact that as human beings we spend much of our time immersed in recreational activities involving aesthetic enjoyment that has no ostensible survival-value in the outside world. As they argue, both aesthetically driven behaviour and dreaming may have been selected for to “cause fitness-enhancing changes to the brain / mind” (Cosmides and Tooby 2001, p. 14) and hence may be driven by adaptations operating in their organizational mode. According to this analysis, aesthetically driven behaviour only appears non-utilitarian because our ordinary standards of function are focused on the struggle to achieve adaptive changes in the external world, such as caring for children, acquiring a mate, foraging, and so on. When we recognize that for many actions the goal is instead to make adaptive changes in the immense and subtle internal world of the mind and brain, then the puzzle of how natural selection could build complex systems to produce pointless behaviors (potentially) evaporates. (p. 16)

There is some evidence, moreover, that the need to tell stories may have been sparked not least of all by the need to communicate one’s dreams. The earliest documents of written down stories actually record and interpret the author’s

166

Michaela Schrage-Früh

dreams, e.g., a Sumerian dream text inscribed on a clay tablet over 5000 years ago (cf. Rupprecht Schreier 2007, p. 2). As Carol Rupprecht Schreier points out, this example shows that “from the beginning, storytelling and dreaming overlapped and were seen as having meaningful affinities” (ibid.). The concept of a “dream-and-literature-symbiosis” (p. 4) has been confirmed by numerous authors throughout the ages, who have found creative inspiration and sustenance in dreams; S. T. Coleridge, R. L. Stevenson and Franz Kafka are just the most obvious examples that come to mind. To the Argentinean writer Jorge Luis Borges (1899–1986) literature is a “directed dream” (quoted in Rupprecht Schreier 2007, p. 4) while the German Romantic poet Jean Paul (1763–1825) famously referred to dreams as “involuntary poetry” (quoted in Rupprecht Schreier 2007, p. 4). As Rupprecht Schreier claims, “[r]arely in any culture can one find a poet, playwright, novelist, or short story writer with a significant body of work who does not include dreaming in some form” (p. 21). Incidentally, empirical research supports the hypothesis that a rich and vivid dream life frequently coincides with heightened creativity. Thus, Hartmann has found that persons with “thin boundaries”, “in whose minds, things are relatively fluid” (Hartmann 1998, p. 220), thoughts and feelings tending to merge and overlap, are both more likely to experience frequent vivid dreams and to be creative in their waking lives (cf. ibid.). Naomi Epel’s, Writers Dreaming (1993) and Roderick Townley’s Night Errands: How Poets Use Dreams (1998) bear testimony to the close interconnection between dreams and consciously created fictions. In both collections, contemporary American writers / poets are given the opportunity to explore and reflect about the manifold ways in which dreams impact on their own work. Writers and poets as various as William Styron, Isabel Allende, Stephen King, Bharati Mukherjee, Denise Levertov and Joyce Carol Oates compellingly testify to their own rich dream life that many of them see as indispensible to their waking imagination. As Rupprecht Schreier sums up, “[a]lthough the hypothesis about dreaming as the origin of all human creativity will always remain unprovable, we can hear in the voices of these writers an unassailable conviction that their dreams enable them to create. And their voices echo through centuries and across cultures” (Rupprecht Schreier 2007, pp. 7f.). Of course, the differences between dreaming and the creation of art are at least as illuminating as the similarities. If the dream translates our feelings and thoughts into what States calls “their imagistic equivalents” (States 1987, p. 71), it is the writer’s task to translate these back into verbal images as well as to capture the dreamlike atmosphere in a dream’s literary rendering. What the dreamer seems to experience in a seemingly first-hand and unmediated way, must be translated into language to evoke similar experiences and emotions in the reader. In this context Denise Levertov usefully differentiates between being taken over by the imagination in a dream as op-

“The Roots of Art Are in the Dream”

167

posed to taking control of the imagination in creating art (cf. Levertov 1998, p. 114). To States, a dream is like “a first draft of thought. Unlike most drafts, however, it is also the final draft, having no inclination to ‘please or instruct’ a waking audience – or even a sleeping audience, for that matter.” (States 2001, p. 110). In order to turn the rough draft of a dream into a piece of art relevant beyond the dreamer’s own subjective experience, the “author’s gloss” (Levertov 1998, p. 109) is indispensible. It is then that the dream text is “more than recapitulation, it is of one substance with the dream; and its power has the chance to extend beyond the limits of the artist’s own life” (p. 119).

VI. Towards an Oneirocritical Approach In her 2007 article “Dreaming, Language, Literature”, Rupprecht Schreier outlines some of the “possible futures for a new humanities approach to the interdependent spheres of dreaming, language and literature” (Rupprecht Schreier 2007, p. 3). In this context she introduces the term “oneirociritcism” (ibid.) for this innovative and interdisciplinary field of research involving the combined study of dreams (oneirics, oneirology), linguistics (oneirolinguistics, translation studies) and of literature (poetics). As Rupprecht Schreier and Bulkeley explain in their “Introduction” to The Dream and the Text: Essays on Literature and Language, oneirocriticism involves the use of critical methods from various fields of study to explore dreams, the use of critical insights from dreams to explore various kinds of texts, and the development of a dialogue among these explorations. Dreaming is thus both a subject / object of inquiry itself and a process by which inquiry proceeds. Double focusing on dream texts and literary texts highlights their differences, as well as their similarities, by foregrounding their shared aesthetic components: image, language, and narrative. (Rupprecht Schreier and Bulkeley 1993, pp. 1f.)

Although the scope of this paper leaves no space to discuss literary case studies, I would like to conclude by at least sketching a few possible points of departure for the new field of oneirocriticism. On the most basic level, as Patricia Kilroe points out, “the study of the form of dreams helps to show that narrative structure is not an artful invention but rather a natural process of the mind” (Kilroe 2000, p. 136). This assumption suggests that the oneirocritical approach might offer new insights into creative processes, for instance as regards the similarities and differences in the activities of dreaming / creative writing on the one hand and of dreaming / reading on the other. The latter might bear on reader-response theory in particular. At the same time, according to States, “[d]ream study might adapt the reader-response approach by putting more emphasis on the experience within dreaming rather than on the artefact itself, either as a dream report or as the dreamer’s personal memory of the dream”

168

Michaela Schrage-Früh

(States 1993, p. 76). Another aspect as yet largely unexplored is the mutual influence of dreams and consciously created literary as well as cinematic fictions. Thus, it might be interesting to explore the “complex interplay between films and dreams” (Bulkeley 1999, p. 103), investigating, for instance, how certain genre expectations and conventions influence our dream plots and images. What is more, drawing on the findings of dream research in literary studies opens up new approaches to and perspectives on literary dreams and their functions. This would also entail the rediscovery of neglected (e.g., untranslated, unpublished) dream texts and thus possibly a revision of certain conventional views about dream beliefs and literary dream conventions in former times and in different cultural contexts. Moreover, studying the uses of what Rupprecht Schreier calls “oneiric patterns in literary texts” (Rupprecht Schreier 2007, p. 18), such as the frequently employed binary oppositions between dreamer / non-dreamer and dream believer / dream dismisser might be instrumental in reassessing both cultural and literary conventions. Finally, the study of “dreamlike” texts on the basis of recent dream research might provide fascinating insights into the authors’ translation of dream processes into literary texts. As mentioned earlier, dreaming is a universal biological activity, shared by humans (and, for that matter, by all mammals) across different ages and cultures. As dreams primarily deal with emotional concerns and the self, they “are more similar than they are different around the world” (Domhoff 2003, p. 32) and “the dream experience [may be] less variant than other aspects of culture” (Thomas Gregor, qtd. in Domhoff 2003, p. 32). Even so, the ways in which dreams are perceived, evaluated and interpreted are to some extent culturally impacted. So is the “manifest content” of individual dreams or at least the recapitulated contents to be found in dream reports that never render the “authentic” experience but rather a biased and fragmented version recollected (and possibly amended upon waking) and quickly receding unless written down or reported immediately. Moreover, as Domhoff notes, whatever their original function and purpose may be, “[d]reams have ‘emergent’ uses that have been developed in the course of history and passed on through culture” (p. 36).5 Therefore, looking at dreams as they were experienced, conceived of and employed through the ages necessitates the inclusion of a cultural-historical perspective, which may bring to light the way dreams are part and parcel of cultural history, implicated in historical change and related to evolving concepts of the imagination.

5

To give just one example, in the early modern period dreams were often read as divinely inspired or prophetic and were put to religious and political uses accordingly, sometimes serving as “tools of change” (Sobel 2000, p. 10).

“The Roots of Art Are in the Dream”

169

Conversely, a reading of historical and literary dreams on the basis of the insights gleaned from contemporary dream research may facilitate an understanding of a common core of unchanging human concerns as experienced and expressed in dream narratives dressed in culturally varied garb. Moreover, although it goes without saying that spontaneous and literary dreams should not be conflated and certainly cannot be equated with each other, the assumption that both share the same imaginative roots and basic rules and that their rendering is influenced by the same cultural conditions justifies their comparative analysis which may unearth new insights into both the literary imagination and the “involuntary poetry” of dreams as well as their possible intersections. I would like to conclude this paper with a quote from Bert States that accentuates the relevance of recent dream studies with respect not only to literary critics but human beings in general: “It seems important to remind ourselves now and then that dreams are not simply the stuff that psychiatry is made on but the fair share of imaginative life we all inherit.” (States 1978/79, p. 571). Ultimately, this insight corresponds to Tooby and Cosmides’ belief “that art is universal because each human was designed by evolution to be an artist, driving her own mental development according to evolved aesthetic principles” (Cosmides and Tooby 2001, p. 25). Acknowledging the intersections between dreams and waking fictions by employing an oneirocritical approach will not only enhance our understanding of the origins and evolution of literature but open up new insights into the creative processes of our storytelling imagination in both its dreaming and waking manifestation.

References Bulkeley, Kelly, Visions of the Night: Dreams, Religion, and Psychology, Albany: State University of New York Press, 1999. Carroll, Joseph, Literary Darwinism: Evolution, Human Nature, and Literature, New York: Routledge, 2004. Cosmides, L. / J. Tooby, “Does Beauty Build Adapted Minds? Toward an Evolutionary Theory of Aesthetics, Fiction and the Arts,” in: SubStance 30.1/2 (2001), pp. 6–27. Domhoff, G. William, The Scientific Study of Dreams: Neural Networks, Cognitive Development, and Content Analysis, Washington, D.C.: American Psychological Association, 2003. Epel, Naomi, Writers Dreaming: William Styron, Anne Rice, Stephen King and 23 Other Writers Talk About Their Dreams and the Creative Process, New York: Carol Southern Books, 1993. Franklin, M. S. / M. J. Zyphur, „The Role of Dreams in the Evolution of the Human Mind,” in: Evolutionary Psychology 3 (2005), pp. 59–78. Freud, Sigmund, “Revision of the Theory of Dreams,” in: Essential Papers on Dreams, ed. by Melvin R. Lansky, New York: New York UP, 1992, pp. 32–52. –, Die Traumdeutung [1899], Frankfurt/M.: Fischer, 2005.

170

Michaela Schrage-Früh

Hall, C. / R. Van de Castle, The Content Analysis of Dreams, New York: Appleton-Century-Crofts, 1966. Hartmann, Ernest, Dreams and Nightmares: The New Theory on the Origin and Meaning of Dreams, New York: Plenum Trade, 1998. –, “The Psychology and Physiology of Dreaming: A New Synthesis,” in: Dreams 19002000: Science, Art, and the Unconscious Mind, ed. by Lynn Gamwell, New York: Cornell UP, 2000, pp. 61–76. Hobson, J. Allan, The Dreaming Brain, New York: Basic Books, 1988. –, “The Brain as a Dream Machine: An Activation-Synthesis Hypothesis of Dreaming,” in: Essential Papers on Dreams, ed. by Melvin R. Lansky, New York: New York UP, 1992, pp. 452–473. Hobson, J. A. / R. McCarley, “The Brain as a Dream State Generator: An ActivationSynthesis Hypothesis of the Dream Process,” in: American Journal of Psychiatry 134 (1977), pp. 1335–1348. Kilroe, Patricia A., “The Dream as Text, the Dream as Narrative,” in: Dreaming 10.3 (2000), pp. 125–138. Levertov, Denise, “Interweavings: Reflections on the Role of Dreams in the Making of Poems,” in: Night Errands: How Poets Use Dreams, ed. by Roderick Townley, Pittsburgh: University of Pittsburgh Press, 1998, pp. 105–119. Mitchell, David, “What Use Are Dreams in Fiction?” in: Journal of European Studies 38.4 (2008), pp. 431–441. Palombo, Stanley R., “The Genius of the Dream,” in: American Journal of Psychoanalysis 43.4 (1983), pp. 301–313. Rupprecht Schreier, Carol, “Dreaming, Language, Literature,” in: Cultural and Theoretical Perspectives (vol. 3 of The New Science of Dreaming), ed. by D. Barrett and P. McNamara, Westport: Praeger, 2007, pp. 1–34. Rupprecht Schreier, Carol / Kelly Bulkeley, “Reading Yourself to Sleep: Dreams in/ and/as Texts,” in: The Dream and the Text: Essays on Literature and Language, ed. by C. Rupprecht Schreier, Albany: State University of New York Press, 1993, pp. 1–10. Rycroft, Charles, The Innocence of Dreams, London: Hogarth, 1979. Shafton, Anthony, Dream Reader: Contemporary Approaches to the Understanding of Dreams, Albany: State University of New York Press, 1995. Sobel, Mechal, “Introduction,” in: Teach Me Dreams: The Search for Self in the Revolutionary Era, ed. by M. Sobel, Princeton, Oxford: Princeton UP, 2000, pp. 3–16. Solms, M. / O. Turnbull, The Brain and the Inner World: An Introduction to the Neuroscience of Subjective Experience, New York: Other Press, 2002. States, Bert O., “The Art of Dreaming,” in: Hudson Review 31.4 (1978/79), pp. 571–586. –, The Rhetoric of Dreams, Ithaca: Cornell UP, 1987. –, Dreaming and Storytelling, Ithaca: Cornell UP, 1993. –, Seeing in the Dark: Reflections on Dreams and Dreaming, Yale: Yale UP, 1997. –, “Dreams: The Royal Road to Metaphor,” in: SubStance 30.1/2 (2001), pp. 104–118. Stephen, Michele, “Memory, Emotion and the Imaginal Mind,” in: Dreaming and the Self: New Perspectives on Subjectivity, Identity, and Emotion, ed. by Jeannette Marie Mageo, New York: State University of New York Press, 2003, pp. 97–129. Townley, Roderick, “Introduction,” in: Night Errands: How Poets Use Dreams, ed. by R. Townley, Pittsburgh: University of Pittsburgh Press, 1998, pp. 1–12.

“The Roots of Art Are in the Dream”

171

Ullmann, Montague, “Dreaming as Metaphor in Motion,” in: Arch Gen Psychiatry 21 (1969), pp. 696–703. Vogel, Gerald W., “Activation-Synthesis Hypothesis,” in: Encyclopedia of Sleep and Dreaming, New York: Macmillan, 1993, pp. 2–6.

172

Felix Frey

Erfahrungshaftigkeit als Attraktivitätspotential narrativer Formen Evolutionäre Argumente für ein Primat der erfahrungshaften Medienrezeption Felix Frey

Geschichten sind überall – dieses stark strapazierte Diktum (vgl. z.B. Toolan 2001, p. viii) bezieht sich inzwischen nicht mehr nur auf die eigentlich gemeinte Objektebene, meint also nicht mehr nur die Verbreitung und zentrale Stellung von Geschichten und damit des Geschichtenerzählens und -rezipierens im Alltag und Leben von Menschen aller Kulturen, sondern gilt inzwischen auch und vielleicht sogar vor allem für die Ebene der wissenschaftlichen Beobachtung. Im Zuge eines inzwischen als narrative turn oder auch narrativist turn bezeichneten Bedeutungsgewinns des Konzeptes des Narrativen innerhalb der Kultur- und Sozialwissenschaften erweiterte sich das Inventar der als „narrativ“ charakterisierten Phänomene in den vergangenen Jahrzehnten weit über die Sphäre des Literarischen hinaus, zunächst auf den Bereich der nichtliterarischen Texte und Diskurse, beispielsweise auf Sachtexte bzw. mündliches Erzählen im kommunikativen Alltag und in spezifischen, beispielsweise therapeutischen, Anwendungskontexten. Dann, im Gefolge des sich erweiternden Textbegriffs, außerdem auf symbolische Ausdrucksformen nichtsprachlicher Natur, wie Musik und Bildende Künste, und schließlich sogar auf nichtsymbolische und -symbolvermittelte Phänomene, bis hin zu Behauptungen der narrativen Qualität mentaler Operationen, aber auch des menschlichen Handelns und gar des Lebens insgesamt.1 Dieses anschwellende Korpus der als „narrativ“ klassifizierten Phänomene wurde zudem nicht mehr nur auf traditionelle hermeneutische und erzähltheoretische Fragestellungen hin untersucht, sondern zunehmend auch in epistemologischer und ontologischer, psychologischer, ethischer, ideologischer und politologischer Perspektive. Mit diesen Entwicklungen einhergehend nahmen sich im Lauf der vergangenen Jahre immer mehr wissenschaftliche Disziplinen mit ihren je unterschiedlichen Erkenntnisinteressen und 1

Vgl. zu dieser Entwicklung Kreiswirth 2000, pp. 294ff.; Wolf 2002.

Erfahrungshaftigkeit als Attraktivitätspotential narrativer Formen

173

methodischen Herangehensweisen der Untersuchung narrativer Phänomene an. Auch die Kommunikationswissenschaft interessiert sich in letzter Zeit in zunehmendem Maße für narrative Formen der Kommunikation, vor allem deshalb, weil diese in zentralen Untersuchungsfeldern kommunikationswissenschaftlicher Forschung immer mehr an Bedeutung gewinnen: Bei Praktikern im Bereich des Journalismus und der Organisationskommunikation stehen narrative Kommunikationsformen und daraus abgeleitete Kommunikations- und Managementstrategien wie „Story-Telling“, „Story-Dealing“, „Storitising“ und Ähnliches mehr hoch im Kurs.2 Ratgeberliteratur, Lehrbücher und Institutionen an der Schnittstelle von Wissenschaft, Beratung und Praxis propagieren dramaturgische Kompositionsprinzipien, lebendig-anschaulichen Detailreichtum und die Personalisierung abstrakter Zusammenhänge durch Fokussierung auf menschliches Handeln und Fühlen – mit anderen Worten, das Erzählen von Geschichten –, um dem Publikum journalistische bzw. marketingrelevante Botschaften schmackhaft zu machen. „Menschen nehmen Informationen am liebsten in Form von Geschichten auf“ (Heussen 1997, S. 264), so lautet das Credo, in dem sich die größte Hoffnung ausdrückt, die mit dem Einsatz narrativer Elemente und Strategien verbunden wird: Zwar werden Botschaften in Form von Geschichten auch als verständlicher, einprägsamer, emotional berührender, spannender und unterhaltsamer sowie stärker persuasiv wirksam als nichtnarrative Kommunikationsformen erachtet. Der stärkste Impetus für ihre Verwendung jedoch dürfte aus der Erwartung resultieren, daraus Vorteile im sich verschärfenden Konkurrenzkampf um die begrenzte Aufmerksamkeit der jeweiligen Adressaten ziehen zu können und im Falle journalistischer Medien Verlusten an Reichweiten und Marktanteilen zu entgehen bzw. im Bereich der Öffentlichkeitsarbeit PR-Botschaften besser bei deren Zielgruppen unterbringen zu können. Kommunikaten in narrativer Form wird von Seiten vieler professioneller Kommunikatoren also v.a. eine höhere Attraktivität für den Rezipienten zugeschrieben als etwa drögen Nachrichten und Pressemeldungen nach dem Muster der „umgekehrten Pyramide“, die dem Rezipienten die Auflösung vor dem Rätsel präsentieren, oder faktengesättigte Geschäftsberichte und zahlenstrotzende Imagebroschüren ohne mitreißende Unternehmens-„Story“. Geschichten erzählen heißt also das Rezept, um sauren Informationsrhabarber genießbar zu machen, oder mit den Worten des Pulitzerpreisträgers Rick Bragg: „A little bit of narrative, like sugar, makes everything better!“ (Bragg 2000, S. 30). 2

Vgl. als Beispiele für entsprechende praxisnahe Publikationen und Strategien in Journalismus und (Kommunikations-)Management Franklin 1987; Raiteri 2006; Herbst 2008; PosnerLandsch 2007; Simoudis 2004. Allerdings werden „narrativistische“ Tendenzen v.a. im Bereich des Journalismus vor dem Hintergrund demokratietheoretischer und epistemologischer Erwägungen inzwischen auch kritisiert (vgl. z.B. Köhler 2005).

174

Felix Frey

Diese Annahme einer besonderen Attraktivität narrativer Formen ist auch im wissenschaftlichen Bereich durchaus verbreitet, wird zudem im Regelfall weitgehend unhinterfragt als Faktum präsentiert und geradezu als Prämisse akzeptiert.3 Dass diese Prämisse jedoch gegenwärtig nicht durch den empirischen Forschungsstand gedeckt wird (wie außerdem das Alltagskonzept „Attraktivität“ exakter und ausführlicher expliziert werden könnte und worin seine Relevanz auch für die akademische Forschung, genauer: die empirische Medienrezeptionsforschung, besteht), werde ich im folgenden Abschnitt aufzeigen. Anschließend möchte ich die Qualität der Erfahrungshaftigkeit oder Experientialität als eines der möglicherweise grundlegenden Charakteristika narrativer Kommunikation beschreiben und als Rezeptionsmodalität konzeptualisieren. Und schließlich werde ich einige evolutionspsychologische Argumente für die Annahme vorstellen, dass mit dieser Erfahrungshaftigkeit auch eines der grundlegenden Attraktivitätspotentiale narrativer Formate identifiziert sein könnte.4

I. Zur behaupteten Attraktivität narrativer Kommunikationsformen Wie bereits angedeutet, ist die Attraktivität von Medienbotschaften und Strategien zu deren Steigerung offenkundig von großer, nicht zuletzt ökonomischer Bedeutung für professionelle Kommunikatoren jeglicher Couleur. Allerdings sind mit der Frage der Anziehungskraft von Kommunikaten für Rezipienten auch zwei der zentralen Explananda der akademischen Mediennutzungs- und Medienwirkungsforschung berührt: das Problem der Selektion von Medienangeboten durch den Rezipienten und die Frage der psychologischen Qualität der Interaktion mit diesen Kommunikaten während der Rezeption. Mit dem Konzept der Attraktivität wird also von der Seite des Medienangebots her diejenige „Kraft“ begrifflich zu fassen versucht, die dafür verantwortlich ist, dass sich Menschen erstens in einer Situation nicht nur überhaupt für die Beschäftigung mit Medien und nicht etwa für einen Spaziergang oder andere Alternativbeschäftigungen entscheiden, sondern zudem für ein bestimmtes aus der Vielzahl der zur Verfügung stehenden Medienangebote, und dass sie zweitens in die Rezeption einiger Medienangebote mehr kognitive Ressourcen investieren als in anderen Fällen. Die Relevanz der Medienselektion als Forschungsproblem dürfte recht offensichtlich sein, aber 3 4

Vgl. z.B. Scalise Sugiyama 2001, S. 223; Dow 2006; Glaser et al. 2009, S. 429; Steen 2005. Die Begriffe „Erzählen“ und „Storytelling“ werde ich im Folgenden als Bezeichnungen für die Aktivität des Hervorbringens narrativer Kommunikate, die Begriffe „Geschichte“, „Story“, „Erzählung“, „narrative/erzählende Formen“, „Formate“ bzw. „Botschaften“ u.Ä. als Bezeichnungen für diese Kommunikate verwenden und dabei die für den vorliegenden Zusammenhang wenig relevanten, weitergehenden Differenzierungen dieser Begriffe als erzähltheoretische Fachtermini vernachlässigen.

Erfahrungshaftigkeit als Attraktivitätspotential narrativer Formen

175

auch die Frage der Qualität und Intensität der bei der Rezeption eines Medienangebots ablaufenden psychischen Prozesse beschäftigt die Medienrezeptionsforschung, nicht zuletzt deshalb, weil diese Prozesse ihrerseits die weitergehenden Wirkungen dieser Rezeption im kognitiven, emotionalen und evaluativen Bereich hinsichtlich ihrer Art und Intensität modifizieren. Wie aber lässt sich der bisher in seiner Alltagsbedeutung, im Sinne seines deutschen Pendants „Anziehungskraft“ verwendete Begriff „Attraktivität“ zu einem tauglichen wissenschaftlichen Terminus explizieren? Mit dem Begriff soll – eine erste Annäherung – diejenige Entität begrifflich erfasst werden, welche die unterschiedlich stark ausgeprägte Neigung von Individuen bedingt, sich in bestimmten Situationen mit bestimmten Objekten (beispielsweise Kommunikaten) zu beschäftigen, wobei diese Entität als Eigenschaft dieser Objekte interpretiert wird: Wenn wir von einem Objekt aussagen, dass es für uns „attraktiv“ ist, wollen wir damit ausdrücken, dass wir die Neigung verspüren, uns diesem Objekt zuzuwenden und uns mit ihm zu beschäftigen, und wenn wir es als „attraktiver“ als andere bezeichnen, dass diese Neigung bei diesem bestimmten Objekt stärker ist als bei den anderen. Psychologisch gewendet lässt sich die Konstellation als Entscheidungssituation beschreiben und mit den Konzepten der Entscheidungspsychologie modellieren: Die Zuwendung zu einem (bestimmten) Medienangebot ist nichts anderes als die Auswahl einer Handlungsoption aus dem Universum subjektiv wahrgenommener Optionen. Damit lässt sich die Frage nach der Attraktivität von Objekten umformulieren zur Frage nach derjenigen psychologischen Größe, die diese Auswahlentscheidung bedingt. Die Entscheidungspsychologie beantwortet diese Frage mit dem Konzept des antizipierten subjektiven Wertes der zur Verfügung stehenden Optionen und der Konsequenzen ihrer Auswahl. Wir können „Attraktivität“ bezogen auf die Rezeption von Medienangeboten bzw. Kommunikaten also definieren als den antizipierten subjektiven Wert (oder auch Vorhersagenutzen), den eine Person der Rezeption eines Medienangebotes zumisst.5 Die Attraktivität einer Handlungsoption resultiert damit aus einem Bewertungsprozess durch das Individuum vor dem Hintergrund seiner situativ aktuellen Handlungsziele. Je höher die situative Priorität der Handlungsziele ist, die das Subjekt durch eine Handlungsoption realisieren zu können antizipiert, und je effizienter diese Option das Ziel zu verwirklichen verspricht, desto attraktiver ist die Handlungsoption im Vergleich zu anderen. Weder dieser Bewertungsprozess noch sein Resultat müssen „rational“ ablaufen oder dem Individuum bewusst sein, zudem erfassen die Begriffe „Nutzen“

5

Vgl. zur Herleitung und Begründung dieser Definition, sowie der ausführlicheren Modellierung des Bewertungsprozesses Frey 2009, S. 13ff. (vgl. auch Hartmann 2006, S. 130f.).

176

Felix Frey

oder „Wert“ gleichermaßen sachlich-instrumentelle (extrinsische) wie erlebensbezogen-affektive (intrinsische) Komponenten.6 Die Frage der relativen Attraktivität der Rezeption narrativer und nichtnarrativer Kommunikationsformate wäre also nicht nur von praktischer und grundlagenwissenschaftlicher Relevanz, sie könnte zudem empirisch beantwortet werden.7 Allerdings liegen bislang nur wenige empirische Studien zu dieser Fragestellung vor, die zudem uneindeutige Ergebnisse liefern. Der Mangel an Studien dürfte zum einen der vorwiegend nichtempirischen Ausrichtung einiger der an dieser Diskussion beteiligten wissenschaftlichen Disziplinen (insbesondere der Literaturwissenschaften) geschuldet sein, zum anderen der Einordnung dieser Frage als durch Plausibilität und anekdotische Erfahrungen ausreichend geklärt, vor allem aber beträchtlichen theoretischen und methodischen Problemen: Schon die theoretische Unterscheidung zwischen narrativen und nichtnarrativen Kommunikationsformaten bereitet aufgrund ungeklärter Definitionsfragen Schwierigkeiten (vgl. Georgakopoulou und Goutsos 2000, S. 66f.; Wolf 2002, S. 28).8 Diese terminologischen Schwierigkeiten pflanzen sich bis in die Konzeption empirischer Untersuchungen hinein fort, weil dort begründete Kriterien für die Auswahl bzw. Erstellung der in diesen empirischen Untersuchungen zu verwendenden Materialien fehlen. Zudem erweist sich ein zentrales Problem jeglicher experimenteller Untersuchungen bei der experimentellen Gegenüberstellung narrativer und nichtnarrativer (meist argumentativer oder expositorischer) Kommunikationsformen als besonders diffizil: Wie können für experimentelle Untersuchungen Stimuli, etwa in Form schriftlicher Texte oder audiovisuellen Materials, ausgewählt oder hergestellt werden, die sich außer in den für die Unterscheidung narrativ vs. nichtnarrativ als wesentlich erachteten Merkmalen nicht auch noch in ihrem Thema, Inhalt, Vokabular, ihrer Komplexität, ästhetischen Qualität und in weiteren möglicherweise attraktivätsrelevanten Eigenschaften unterscheiden? Das damit angesprochene Problem der internen Validität empirischer Untersuchungen könnte auch mitverantwortlich dafür sein, dass die vergleichsweise wenigen mir bekannten empirischen Studien zu insgesamt uneindeutigen Ergebnissen gelangen: So fanden Fernald sowie Halkia und Mantzouridis in zwei eher explorativ angelegten Studien Indizien für eine Präferenz narrativer Lehrmittel unter 6

7 8

Die in der Entscheidungspsychologie vorgenommene Differenzierung zwischen „Wert“ und „Nutzen“, je nachdem, ob die Konsequenzen der Auswahl sicher oder unsicher sind, vernachlässigen wir für den vorliegenden Zusammenhang. Vgl. zu den Konzepten der Entscheidungspsychologie einschließlich der diversen Unterscheidungen innerhalb des Nutzenbegriffs Jungermann et al. 1998, S. 55ff. Im Folgenden, wie im Beitrag insgesamt, wird ausschließlich die (angenommene) Attraktivität narrativer Kommunikation für den Rezipienten betrachtet. Ausgeblendet bleibt also die mögliche Attraktivität des Geschichtenerzählens für den Erzähler bzw. Produzenten. Vgl. auch den folgenden Abschnitt.

Erfahrungshaftigkeit als Attraktivitätspotential narrativer Formen

177

Schülern und Studenten (vgl. Fernald 1989; Halkia und Mantzouridis 2005). Demgegenüber wurden in einer Untersuchung von Kelly und Kollegen (2003) narrative Nachrichtenbeiträge als weniger interessant beurteilt als traditionell gestaltete, Pappas (1993) beobachtete bei Schülern eine Präferenz für expositorische Sachbücher (engl. information books) gegenüber narrativer Lektüre (story books), und Kamil (1994; Kamil und Lane o.J.) stellte fest, dass zwar in einer Schulbibliothek mehr story books als information books ausgeliehen wurden, in einer Stadtteilbibliothek jedoch die Ausleihe von information books überwog. Cervetti und Kollegen (2009) wiederum konnten bei einer Gegenüberstellung von narrativen und informationellen Texten zum selben Thema keine klaren Präferenzen für eine der beiden Textsorten unter Drittund Viertklässlern ausmachen. Abschließend beantworten können wir die Frage nach der relativen Attraktivität unterschiedlicher Textsorten und Kommunikationsformen derzeit also keinesfalls, weder in die eine noch die andere Richtung. Immerhin aber kann festgehalten werden, dass die oftmals im Brustton der tiefsten Überzeugung vorgebrachte Annahme einer kontextunabhängigen Präferenz des Menschen für narrative Kommunikationsformen momentan nur eine privatempirisch plausible Hypothese ist, die noch des empirischen Nachweises bedarf.

II. Erfahrungshaftigkeit der Rezeption als Charakteristikum narrativer Kommunikation Bereits bei dem Versuch, den Mangel an empirischen Studien in diesem Bereich zu erklären, war eine beträchtliche Komplikation bei der theoretischen wie empirischen Beschäftigung mit dem Untersuchungsgegenstand Narration bzw. Narrativität zur Sprache gekommen: Nicht nur in denjenigen wissenschaftlichen Disziplinen, die sich empirisch mit der Rezeption und Wirkung narrativer Kommunikate befassen, herrscht bei einem zugleich gering ausgeprägten Problembewusstsein Uneinigkeit darüber, was denn im Einzelnen unter den Begriffen „narrativ“, „Narration“, „Narrativität“, „Geschichte“, „Erzählung“ bzw. „Erzählen“ zu verstehen sei; auch in den Literatur- und Sprachwissenschaften als den für dieses Material- und Formalobjekt einschlägigen Leitwissenschaften kann die damit angesprochene Definitionsproblematik keineswegs als gelöst angesehen werden. Vielmehr bietet sich dem Beobachter eine verwirrende Vielfalt an teilweise unvereinbaren Definitionsvorschlägen unterschiedlichster Provenienz und Prominenz, die sich teils radikal in ihren Perspektiven und Prämissen, teils in scheinbaren Nuancen wie der für die Klassifikation eines Textes als „narrativ“ notwendigen Anzahl der

178

Felix Frey

durch diesen Text darzustellenden Ereignisse unterscheiden.9 Zwar ist für diese Vielfalt auch das breite Spektrum der sich inzwischen in diesem Forschungsfeld tummelnden wissenschaftlichen Disziplinen mit verantwortlich zu machen, die Wurzel des Problems dürfte jedoch methodologischer Natur sein: Aufgrund der letztlich textimmanent-induktiven Vorgehensweise der Literatur- und Sprachwissenschaften bei der Entwicklung der genannten Termini sind die möglichen Ergebnisse der Merkmalsanalyse durch das jeweils zugrunde gelegte Korpus präfiguriert und damit letztlich durch ein disziplinär, aber auch jeweils individuell geprägtes Vorverständnis davon, welche Phänomene (bzw. Texte) als „narrativ“ gelten sollen.10 Den sich auf diese Weise ergebenden Definitionen – wie auch deren Diskussion – ist deshalb zwangsläufig ein beträchtliches Maß an Willkür in der Auswahl, Kombination und konkreten Ausformulierung der als definierend erachteten Merkmale eigen (vgl. Wenzel 2004, S. 20; Wolf 2002, S. 36). Diesem Problem wäre nur durch Setzungen und Konvention beizukommen oder dadurch, dass textexterne Phänomene, z.B. Merkmale der Produktion, Rezeption oder Wirkung narrativer Kommunikate, als Referenzkriterien für die Formulierung und Beurteilung der Definitionen herangezogen werden.11 Mit etwas Abstand betrachtet aber findet sich in vielen der vorgeschlagenen Definitionen von „Narrativität“ und damit verwandten Termini ein Gedanke wieder – in unterschiedlichen Variationen und Graden an Vollständigkeit bzw. Explizitheit –, der auch in Beschreibungen der Rezeption und Produktion narrativer Kommunikationsformen auftaucht und zugleich einige ihrer typischen Verwendungskontexte charakterisiert: der Gedanke nämlich, dass dem Narrativen die Qualität der Erfahrungshaftigkeit eignet, dass also narrative Kommunikationsformen etwas mit menschlicher Erfahrung zu tun haben. Sie gelten als Mittel der Wahl, wenn individuelle Erfahrungen vermittelt oder auch – in diagnostisch-therapeutischen Kontexten – 9

Vgl. zur Definitionsproblematik v.a. Wolf 2002, S. 23ff.; Ryan 2005, S. 344–348; Ryan 2007, S. 22–35; Echterhoff und Straub 2003, S. 317–346, sowie im Überblick und für weitere Hinweise Frey 2009, S. 35ff. Den Versuch einer inhaltsanalytischen Erfassung der in der Fachliteratur des vergangenen Jahrzehnts verwendeten Definitionen von „Narration“, „Erzählung“, „Geschichte“ und „Narrativität“ und ihrer inhaltlichen Systematisierung und methodologischen Evaluation unternimmt ein derzeit laufendes Projekt an der Universität Leipzig. 10 Echterhoff und Straub 2003 weisen außerdem auf Probleme hin, die sich durch semantische Verschiebungen bei der Übertragung der zentralen Termini zwischen den an der Fachdiskussion hauptsächlich beteiligten Sprachen (Englisch, Deutsch, Französisch) ergeben (vgl. S. 329). 11 Insofern für Vertreter nominalistischer Definitionslehren Definitionen nur sprachliche Festsetzungen sind, ist die geschilderte Situation freilich nicht als Problem aufzufassen, sondern als per Konvention und Setzung handhabbarer Normalfall, höchstens als kommunikatives Ärgernis. Wenn aber mit Definitionen über den bloßen Anspruch der Sprachregulierung hinaus auch der Anspruch verbunden wird, etwas über die sprachlich-begrifflich zu beschreibende Realität auszusagen, also (im weitesten Sinn) empirisch gehaltvolle Termini und Aussagen zu formulieren, wird die Vielfalt tatsächlich zu einem im Hinblick auf den wissenschaftlichen Erkenntnisfortschritt problematischen Punkt.

Erfahrungshaftigkeit als Attraktivitätspotential narrativer Formen

179

aufgearbeitet werden sollen.12 Die Rezeption von Geschichten wird beschrieben als das Machen von stellvertretenden oder Quasi-Erfahrungen.13 Narrative Kommunikate werden als Ausdruck, Simulation oder Repräsentation menschlicher oder anthropomodaler Erfahrung beschrieben (vgl. Mar 2008; Scalise Sugiyama 2001, S. 224; Stierle 1979; Tengelyi 2007, S. 293ff.). Und schließlich stellen verschiedene Autoren entsprechende Verknüpfungen des Narrativen mit menschlicher Erfahrung auch definitorisch her: „Erzählung“ (engl. narrative) wird von Branigan als „a perceptual activity that organizes data into a special pattern which represents and explains experience“ (Branigan 1992, S. 3) definiert, von Labov und Waletzky als „one method of recapitulating past experience“ (Labov und Waletzky 1967, S. 20). Als elaborierteste literaturwissenschaftliche Konzeption auf Basis dieses Grundgedankens kann die Position Monika Fluderniks gelten. Sie definiert „Erzählung“ als Präsentation von Erfahrungshaftigkeit (experientiality), basierend auf der Vermittlungsleistung eines (menschlichen) Bewusstseins, oder auch als quasi-mimetische Evokation lebensweltlicher Erfahrung (vgl. Fludernik 1996, S. 12, 49). Mit den eben erwähnten Charakterisierungen des narrationsspezifischen Rezeptionserlebens als stellvertretende oder Quasi-Erfahrung ist Fluderniks Konzeption insofern nicht deckungsgleich, als ihr zufolge beim Rezipienten nicht etwa eine stellvertretende oder Quasi-Erfahrung selbst evoziert wird, sondern lediglich der Eindruck, der rezipierte Text repräsentiere menschliche Erfahrung, einhergehend mit einer Interpretation und kognitiven Verarbeitung dieses Textes als eine solche Manifestation menschlicher Erfahrung. Demgegenüber finden wir eine enge definitorische Verknüpfung zwischen dem narrativen Kommunikat einerseits und einem Rezeptionsphänomen in Form einer Quasi-Erfahrung des Rezipienten andererseits in der linguistischen Konzeption von Volkmar Lehmann. Als übergeordnetes Definitionskriterium für narrative Textpassagen dient ihm die Erzeugung einer „Illusion der Präsenz“ (Lehmann 2008, S. 211), die ein solcher Text beim Leser durch eine wahrnehmungsäquivalente Präsentation des Geschehens erzeugt. Erfahrungshaftigkeit als eine spezifische Qualität narrativer Kommunikationsformen – diesen Gedanken aufzugreifen und konzeptuell weiter auszuformulieren erscheint nicht nur aufgrund der intuitiven Plausibilität dieser These vielversprechend, sondern auch aufgrund ihrer Anschlussfähigkeit für die Erzählforschung auf der einen, für Konzepte und Forschungsinteressen der kommunikationswissenschaftlichen Medienrezeptionsforschung und der Sprach- und Medienpsychologie auf der anderen Seite: Im Hinblick 12 Vgl. zum Zusammenhang von Erzählung und der Aktualisierung und Reflexion menschlicher Erfahrung Bruner 1990; Freeman 1997; Polkinghorne 1988. Zur Rolle narrativer Kommunikation in der Psychotherapie vgl. die Beiträge in Angus und McLeod 2006. 13 Vgl. z.B. Bruner 1990, S. 54; Coulter 2009, S. 609.

180

Felix Frey

auf die erzähltheoretische Diskussion um die Definition der zentralen Termini „Geschichte“, „Erzählung“ usw. erfüllt das Rahmenkonzept der Erfahrungshaftigkeit geradezu ordnende Funktion. So lassen sich die gängigsten und am wenigsten kontrovers diskutierten Definitionsmerkmale, mit Ausnahme vielleicht der Erzählinstanz, durch dieses Rahmenkonzept integrieren: Menschlicher (Primär-)Erfahrung ebenso wie Erzählungen bzw. Geschichten eignet die Qualität der Zeitlichkeit, hauptsächliche Objekte der Erfahrung wie der erzählerischen Repräsentation sind in einer Welt situierte, chronologisch oder kausal in Beziehung stehende Ereignisse, menschliche oder anthropomorphe Akteure und deren Denken, Fühlen und Handeln. Zugleich aber filtert das Konzept eine ganze Reihe der diskutierten Definitionskriterien als letztlich sekundär und nicht im strengen Sinn definitorisch aus der Diskussion heraus, die zwar intuitiv zunächst zweifellos plausibel erscheinen, über deren Status man sich aber argumentativ nicht einig wurde, was möglicherweise auf ihre Akzidentialität hindeutet. Beispielsweise wurde im Rahmen formalistischer, strukturalistischer und kognitionswissenschaftlicher Beschreibungs- und Definitionsansätze weitgehend fruchtlos über die notwendigen und hinreichenden formalen bzw. strukturellen Elemente von Geschichten debattiert, also beispielsweise darüber, wie viele Ereignisse dargestellt werden müssen, um die betreffende Darstellung als „Geschichte“ gelten lassen zu können, ob und auf welche Weise diese Ereignisse verknüpft sein müssen, ob zwingend menschliche oder anthropomorphe Akteure vorkommen müssen oder nicht, ob diese nur reagieren oder auch handeln oder gar ganze Pläne verfolgen müssen, ob Komplikation und Evaluation notwendige Strukturelemente sind und Ähnliches mehr.14 Vor dem Hintergrund des Kriteriums der Erfahrungshaftigkeit werden diese Streitfragen jedoch gegenstandslos oder zumindest im Hinblick auf die Definitionsproblematik irrelevant, weil alle der genannten Elemente gleichermaßen mögliche, nicht aber notwendige Gegenstände und Charakteristika menschlicher Erfahrung sind. Auf der Seite der Rezeption wiederum bieten zum einen aktuelle psychologische Modelle des Sprach- und Textverstehens Anknüpfungspunkte: Sowohl Johnson-Lairds Theorie mentaler Modelle als auch das Immersed Experiencer Framework (IEF) von Zwaan betonen die Parallelität von Prozessen der Umweltwahrnehmung und solchen des Sprachverstehens (vgl. JohnsonLaird 1983; Zwaan 2004). Johnson-Laird geht davon aus, dass die beim Sprachverstehen aufgebauten mentalen Modelle und die mentalen Modelle, die bei der Wahrnehmung realer Situationen gebildet werden, funktional äquivalent sind und in denselben mentalen Subsystemen gebildet werden, also teilweise auf denselben kognitiven Prozessen beruhen.15 Zwaans Immer14 Vgl. dazu ausführlicher Frey 2009, S. 35ff. 15 Zu dieser Aquivalenz-These Johnson-Lairds vgl. Kelter 2003, S. 513ff.

Erfahrungshaftigkeit als Attraktivitätspotential narrativer Formen

181

sed Experiencer Framework beruht auf der aus dem embodied cognition-Paradigma der Kognitionsforschung stammenden Annahme, dass das Verstehen sprachlicher Äußerungen einer stellvertretenden Wahrnehmung der denotierten Situation gleichkommt, bei der durch sprachliche Hinweisreize Gedächtnisspuren realer Erfahrungen aktiviert, sequenziert und integriert werden. Selbst das Verstehen abstrakter Sprache wird lediglich als eine Erweiterung dieser primären, grundlegenden Prozesse verstanden (vgl. Zwaan 2004).16 Zum anderen könnte es mit Hilfe des Konzepts der Erfahrungshaftigkeit möglich sein, narrative Kommunikate auf eine systematischere und kohärentere Art und Weise als bisher mit einer Reihe einander ähnlicher Phänomene des Rezeptionserlebens in einen Erklärungszusammenhang zu bringen, nämlich mit den in der Medienpsychologie und Rezeptionsforschung gegenwärtig intensiv untersuchten Rezeptionsphänomenen der Immersion und Transportation sowie des räumlichen Präsenzerlebens. Vielversprechende theoretische Anknüpfungspunkte scheint das Konzept der Erfahrungshaftigkeit also zu bieten. Was aber ist mit dem Begriff genau gemeint, wie kann diese „Qualität narrativer Kommunikation“ präziser verortet und konzeptualisiert werden? Ausgangspunkt ist zunächst die analytische Unterscheidung zwischen der immanenten Beschreibung eines Kommunikats und seiner Charakteristika einerseits und der Beschreibung von Merkmalen seiner Rezeption, d.h. Wahrnehmung und Interpretation durch den Rezipienten, andererseits. Die Begriffe „Erfahrung“ bzw. „Wahrnehmung“17 bezeichnen einen Interaktionsprozess des Menschen mit Erfahrungs- bzw. Wahrnehmungsobjekten sowie dessen Produkte. Auch die mit dem Konzept der „Erfahrungshaftigkeit“ vorgeschlagene Analogisierung von Wahrnehmung / Erfahrung einerseits und einem bestimmten Subtypus medienvermittelter Kommunikationsprozesse andererseits sollte sich also bei letzteren nicht auf die Ebene der Kommunikate (als Objekte), sondern die ihrer Rezeption und deren Ergebnisse beziehen: Als „erfahrungshaft“, der menschlichen Erfahrung also in noch näher zu beschreibender Weise ähnlich, wären demnach nicht etwa narrative Kommunikate, sondern bestimmte Typen von Rezeptionsprozessen bzw. entsprechende Rezeptionsepisoden zu charakterisieren. Ein begriffliches Instrumentarium für die systematisierende und typologisierende 16 Vgl. zur Diskussion des Substitutionsverhältnisses zwischen realen Ereignissen und medialen Ereignisdarstellungen und dessen Einschränkungen speziell auf das Medium Film bezogen auch Schwan 2001, S. 19ff. 17 Die Bedeutungsunterschiede zwischen diesen beiden schon für sich genommen uneindeutigen Begriffen werden für den vorliegenden Zusammenhang ignoriert und beide Begriffe als Bezeichnung für die kontinuierlich stattfindenden, situativ gebundenen Prozesse der menschlichen Selbst-, Fremd- und Objekt- bzw. Weltwahrnehmung in deren subjektivem Erlebniszusammenhang verwendet.

182

Felix Frey

Beschreibung unterschiedlicher Rezeptionshaltungen bzw. „Arten und Weisen“ der Rezeption bieten verschiedene Rahmenkonzepte, die in den letzten Jahren in der kommunikationswissenschaftlichen Rezeptionsforschung entwickelt wurden. Konzepte wie „Rezeptionsmodalität“, „Rezeptions-“ oder „Kommunikationsmodus“ oder „Rezeptionsstrategie“ sollen – mit jeweils unterschiedlichen Akzentuierungen – musterhafte Konfigurationen von während der Rezeption beim Rezipienten ablaufenden, auf das Medienangebot bezogenen psychischen Prozessen beschreiben, die jedoch über die bloße Summe verschiedener kognitiver, emotionaler, evaluativer und konativer Prozesse hinaus als emergente Einheiten neuer Qualität mit möglicherweise eigenen Wirkungspotentialen verstanden werden. Als eine solche spezifische Konstellation mehrerer psychischer Teilprozesse, und damit als „Rezeptionsmodalität“, lässt sich nun auch die erfahrungshafte Rezeption in Abgrenzung zu nichterfahrungshaften Rezeptionsprozessen konzipieren.18 Die Erfahrungshaftigkeit dieser Rezeptionsmodalität besteht darin, dass der betreffende Rezeptionsprozess bzw. die durch diesen Rezeptionsmodus konstituierten Rezeptionsepisoden dem Prozess der (Primär-)Erfahrung oder -wahrnehmung einer zeitlich und räumlich situierten Umweltsituation weitgehend analog und funktional äquivalent sind, so die These. Analog insofern, als in erfahrungshaften Rezeptionsprozessen dieselben psychischen Verarbeitungsprozesse in ähnlicher relativer Gewichtung in Anspruch genommen werden wie in einem Akt der unmittelbaren Umweltwahrnehmung – als prominentere Teilprozesse wären hier Objekt- und Personenwahrnehmung, räumliches, kausales und induktives Denken zu nennen –, hier allerdings bezogen nicht auf eine reale Umweltsituation, sondern die medial dargestellte Situation.19 Die funktionale Äquivalenz wiederum besteht darin, dass Wahrnehmungsprozesse einerseits und erfahrungshafte Rezeptionsprozesse andererseits weitgehend dieselben Resultate und Begleiterscheinungen zeitigen, beispielsweise in Gestalt des Erwerbs bestimmter Typen von Gedächtnisrepräsentationen (insbesondere episodische in Form sog. Situa18 Zum hier zugrunde gelegten Konzept der Rezeptionsmodalität vgl. Paus-Hasebrink und Hasebrink 2005, S. 239, außerdem Früh 1991, S. 131. 19 Freilich ist die hier vorgebrachte These aus argumentativen Gründen stark zugespitzt formuliert. Erhebliche Unterschiede zwischen erfahrungshaften Medienrezeptionsprozessen und umweltbezogenen Wahrnehmungsprozessen sind für mehrere Bereiche anzunehmen. Beispielsweise unterscheiden sich der „Input“ des kognitiven Systems und die unmittelbar daran geknüpften Prozesse für die (Umwelt-)Erfahrung und die erfahrungshafte Medienrezeption: Die Aufnahme und Verarbeitung von Sinnesreizen physikalischer oder chemischer Natur im Fall der Wahrnehmung und die Interpretation von Zeichen im Fall erfahrungshafter Medienrezeption unterscheidet sich zumindest hinsichtlich der basalen Reizverarbeitungsprozesse, die den weiterverarbeitenden kognitiven Funktionen vorgelagert sind. Dabei kann davon ausgegangen werden, dass die bei der Medienrezeption ablaufenden kognitiven Verarbeitungsprozesse umso weniger medienspezifisch sind und der Prozess damit der Umweltwahrnehmung umso ähnlicher, je höher der Grad der Ikonizität des jeweiligen Zeichensystems in Bezug auf die medial dargestellte (Umwelt-)Situation ist (vgl. Schwan und Hesse 2004, S. 80).

Erfahrungshaftigkeit als Attraktivitätspotential narrativer Formen

183

tionsmodelle), der Evokation emotionaler Reaktionen, des Aufbaus (para-) sozialer Bindungen und Beziehungen zu Personen bzw. Medienpersonae usw. Ein Großteil dieser Prozesse läuft dabei unbewusst und automatisch ab – also ohne kontrolliert gesteuert werden zu können, bis zu einem gewissen Grad aber dürfte eine solche Rezeptionsweise vom Rezipienten auch bewusst als Quasi-Erfahrung erlebt werden.20 In Abgrenzung dazu würden sich nicht-erfahrungshafte Medienrezeptionsmodalitäten dadurch auszeichnen, dass sie stärker nicht unmittelbar umweltwahrnehmungsbezogene psychische Prozesse in Anspruch nehmen, etwa komplexere Formen des logischen Schließens und Urteilens, kontrafaktisches Denken, Prozesse der Problemlösung, komplexen Handlungsplanung, Begriffsbildung usw., und in entsprechenden mentalen Repräsentationen resultieren. Wir haben also erfahrungshafte Rezeptionsprozesse als eine bestimmte Rezeptionsmodalität skizziert und damit zunächst unabhängig von Kommunikaten und ihren Charakteristika bestimmt. Gleichwohl gehen wir davon aus, dass die Einnahme dieser Rezeptionsmodalität durch eine Reihe von Merkmalen des jeweils rezipierten Medienangebots, aber auch des Rezipienten selbst, zumindest begünstigt oder gehemmt, wenn nicht sogar zwangsläufig evoziert wird. Welche Faktoren dies im Einzelnen sind und wie sie zusammenwirken, ist eine letztlich empirisch zu klärende Frage. Einige wahrscheinliche Anwärter lassen sich jedoch identifizieren, indem nach Merkmalen gesucht wird, die das vermutete oder empirisch gesicherte Potential haben, wahrnehmungsähnliche psychische Prozesse beim Rezipienten zu induzieren. Auf diese Weise gelangt auch Lehmann (2008), ausgehend vom Konzept der „Wahrnehmungsäquivalenz“, zu einem Inventar linguistischer Parameter und zu einer Bestimmung derjenigen Ausprägungen dieser Parameter, die eine „Illusion der Präsenz“ in der dargestellten Situation zu evozieren vermögen. Demnach rufen sprachliche Äußerungen beim Rezipienten genau dann kognitive Prozesse hervor, bei denen Produkte von Wahrnehmungsprozessen reproduziert werden, wenn sie ein Ereignis 20 Die damit angesprochene Parallelisierung von Medienrezeptions- und nicht medienbezogenen kognitiven Prozessen ist in evolutionspsychologischen Konzeptionen alles andere als außergewöhnlich. Ein solches Verständnis liegt etwa Pinkers These zugrunde, das Vergnügen an künstlerischen Aktivitäten und deren Produkten speise sich aus der Aktivierung eigentlich für andere Funktionen evolvierter psychischer Adaptationen, beispielsweise durch literarische Fiktionen (vgl. Pinker 1997). Auch Schwender analysiert mediale Darstellungen als „Attrappen“ für das menschliche Gehirn bzw. die Sinne (vgl. Schwender 2001). Diese und andere Konzeptionen legen den Fokus auf die generelle Parallelisierung oder gar Ineinssetzung medienbezogener und nicht-medienbezogener psychischer Aktivitäten. Demgegenüber liegt mein Interesse in der zu dieser Parallelisierung quer liegenden Differenzierung unterschiedlicher Prozesstypen, also in der Beschreibung mehrerer unterschiedlicher, nichtmedienbezogener psychischer Prozesstypen (hier: erfahrungshafte vs. nichterfahrungshafte) und ihrer jeweiligen medienbezogenen Pendants, sowie der Untersuchung ihrer Wirkungs- und insbesondere Attraktivitätsrelevanz (vgl. als vergleichbares Unternehmen Weiß 2001).

184

Felix Frey

mit spezifischen Partizipanten darstellen, wenn der dominante zeitliche Bezug nicht derjenige zur Sprechzeit des Autors (bzw. der Erzählinstanz) ist, sondern der zu einem vom Rezipienten als subjektiv gegenwärtig vorgestellten Zeitintervall (dem „Psychischen Jetzt“), wenn das dargestellte Ereignis als gleichzeitig zu diesem „Psychischen Jetzt“ ablaufend interpretiert wird, wenn die Darstellung zudem im Indikativ steht, in ihrer lexikalischen Genauigkeit dem vergleichsweise feinkörnigen Auflösungsgrad des menschlichen Zeiterlebens entspricht und wenn, schließlich, die Referenten sinnlich wahrnehmbar bzw. konkret vorstellbar sind und auf Basiskategorienebene liegen.21 Mit Zwaan wären dieser Auflistung noch die der menschlichen Erfahrung entsprechende perspektivische, räumliche und zeitliche Kontinuität der Darstellung hinzuzufügen (vgl. Zwaan 2004) und zudem möglicherweise die Multimodalität der Darstellung, also eine möglichst umfassende Ansprache des dem Menschen gegebenen Sinnesspektrums – selbst wenn diese Ansprache ggf. nur zeichenvermittelt geschieht. Auf Seiten des Rezipienten sind vor allem zwei vermutlich notwendige Bedingungen für das Zustandekommen einer erfahrungshaften Rezeptionsepisode zu nennen: zunächst das für jegliche Medienrezeption unabdingbare Einlassen auf die Medienbotschaft und damit eine teilweise Übergabe der kognitiven Autonomie an einen medialen Stimulus. Damit unterscheiden sich die Medienrezeption ebenso wie die Umweltwahrnehmung als stimulusgeleitete – wenngleich nicht stimulusdeterminierte – psychische Aktivitäten von innengeleiteten Aktivitäten wie beispielsweise der autonomen Generierung mentaler Vorstellungsbilder, etwa in Form von Tagträumen.22 Diese grundsätzliche Bedingung ist zu ergänzen durch eine weitere, nämlich die Übertragung der von Husserl und später Schütz und Luckmann beschriebenen „natürlichen Einstellung“ mit ihrer Generalthesis, dass die Welt da ist, und zwar so, wie wir sie erfahren – die Übertragung also dieser Einstellung der alltäglichen Lebenswelt gegenüber auf die medienvermittelt erfahrene Situation sowie auf die Umstände dieser Vermittlung (vgl. Schütz und Luckmann 1975, S. 25ff.).23 Nachdem wir nun erfahrungshafte Rezeptionsprozesse als eine bestimmte Rezeptionsmodalität skizziert und damit analytisch losgelöst von 21 Damit sind für sprachliche Äußerungen, aber größtenteils verallgemeinerbar auf jegliche Zeichenprozesse als relevante Parameter angesprochen: ihre Aktionalität bzw. aktionale Gestalt, ihr Spezifitätsgrad, ihre temporale Orientierung, ihr Episodizitätsgrad, ihre Modalität, ihr Granularitätsgrad, ihre referenzielle Konkretheit und ihre Kategorienebene (vgl. zu diesen Parametern Lehmann 2008, S. 210ff.). 22 Im Hinblick auf Literatur wurden entsprechende Beobachtungen von Sartre, zuletzt von Hernadi und Scarry ausformuliert (vgl. Scarry 1995; Hernadi 2002, S. 24f.). 23 In Literaturwissenschaft und Medienrezeptionsforschung wird dieser Aspekt unter dem Etikett uspension of disbelief verhandelt. Vgl. zum Ursprungskonzept Coleridge 1967, S. 168f., für die medienpsychologische Forschung bezogen auf die Filmrezeption zuletzt Böcking 2008.

Erfahrungshaftigkeit als Attraktivitätspotential narrativer Formen

185

Kommunikaten und ihren Charakteristika bestimmt haben, bleibt vor dem Hintergrund unserer Ausgangsfragestellung noch das Verhältnis von narrativen Kommunikaten – also Geschichten bzw. Erzählungen – einerseits und eben dieser erfahrungshaften Rezeptionsmodalität andererseits zu bestimmen. In Abhängigkeit von theoretischen bzw. terminologischen Entscheidungen bieten sich zwei Möglichkeiten einer solchen Verhältnisbestimmung: Die Beziehung kann erstens als eine lediglich empirische bestimmt werden, indem „Narration“ bzw. „Narrativität“ ohne Bezüge zu erfahrungshaften Rezeptionsprozessen definiert und auf Basis empirischer Untersuchungen eine Aussage über eine Koinzidenz bzw. einen (probabilistisch) kausalen Zusammenhang zwischen narrativen Kommunikaten und erfahrungshaften Rezeptionsprozessen getroffen wird. Die zweite Möglichkeit besteht in einer konzeptuellen Verknüpfung dieser beiden Seiten per definitionem, indem, wie bei Fludernik und Lehmann der Fall, eine funktionale Definition des (narrativen) Kommunikats über seine Wirkung beim Rezipienten bzw. die bei der Rezeption ablaufenden Prozesse formuliert wird. In unserem Fall hieße das, dass Kommunikate dann als „narrativ“ (bzw. „Narration“) bezeichnet werden sollen, wenn sie eine erfahrungshafte Rezeptionsweise beim Rezipienten evozieren. Zwar hätte eine solche Definition den Vorteil, die oben angesprochene Definitionsproblematik durch einen Bezug auf das textexterne Außenkriterium der erfahrungshaften Rezeption zu beheben. Trotzdem entscheide ich mich an dieser Stelle – zumindest vorläufig – gegen eine definitorische Verknüpfung der beiden Ebenen und damit für die empirisch zu prüfende Grundthese, dass narrative Formen der Kommunikation lediglich empirisch typischerweise mit einer erfahrungshaften Rezeptionsmodalität einhergehen.24

III. Evolutionäre Argumente für die Attraktivität erfahrungshafter Rezeption Weshalb nun, und damit komme ich auf meine Ausgangsfrage zurück, sollte eine solche erfahrungshafte Rezeptionsepisode für den Rezipienten attraktiv sein, d.h. eine in irgendeiner Form erstrebenswerte, von ihr oder ihm als belohnend erlebte Aktivität? Um es noch einmal zu wiederholen: Diese besondere Attraktivität narrativer Kommunikate, ebenso wie die der erfahrungshaften Rezeption, ist bisher nur Behauptung – privatempirisch plausibel zwar, aber wissenschaftlich nicht schlüssig nachgewiesen. Gleichwohl steht vor der empirischen Prüfung die Bildung begründeter Hypothesen, weshalb ich im Folgenden einige Argumente zusammentragen möchte, die für die 24 Gegen eine funktionale Definition im vorgestellten Sinne spricht aus pragmatischer Sicht v.a. deren problematische Anschlussfähigkeit für und schwierige Anwendung durch die nicht empirisch ausgerichteten Sprach- und insbesondere Literaturwissenschaften.

186

Felix Frey

Möglichkeit einer besonderen Anziehungskraft erfahrungshafter Rezeption und damit, mittelbar, der Attraktivität narrativer Kommunikate sprechen. Besonders fruchtbare Heuristiken zur Generierung solcher Hypothesen können dabei evolutionäre Theorieperspektiven bereitstellen, insbesondere die Perspektive der Evolutionären Psychologie, wie sie maßgeblich in den Arbeiten von Tooby und Cosmides (2005) sowie Buss (2004) ausformuliert wurde. Mit einigen theoretischen wie methodologischen caveats bietet dieser Ansatz nämlich die Möglichkeit, auf Grundlage einer kaum noch ernsthaft in Frage gestellten Theorie – der Darwin’schen Evolutionstheorie und ihrer Modifikationen – unter Einsatz vergleichsweise sparsamer Annahmen und Argumentationsfiguren Hypothesen mit einem hohen Informationsgehalt zu formulieren, solche nämlich über das Erleben und Verhalten der gesamten menschlichen Spezies.25 Bezogen auf unseren Untersuchungsgegenstand – die Attraktivität erfahrungshafter Rezeption – geht es unserem Attraktivitätskonzept folgend darum, zum einen entsprechende Hypothesen über durch erfahrungshafte Rezeptionsepisoden realisierbare Motive und Handlungsziele des Menschen zu formulieren, zum anderen solche über die Effizienz dieser Zielverwirklichung. In evolutionstheoretischer Terminologie suchen wir also nach proximaten Ursachen, d.h. den situativ unmittelbar wirksamen psychischen Mechanismen, die dafür verantwortlich sind, dass Individuen erfahrungshafte Rezeptionsprozesse aufsuchen und damit mittelbar solche Kommunikate, die eine solche Rezeptionsweise evozieren. Solche proximaten Mechanismen versuchen wir wiederum durch Überlegungen über mögliche ultimate Erklärungen für die Herausbildung der fraglichen psychischen Strukturen zu identifizieren bzw. zu plausibilisieren.26 Eine erste relevante Überlegung finden wir bei Tooby und Cosmides. Sie nehmen an, dass sich im Laufe der Phylogenese des Menschen besondere Motivationssysteme herausgebildet haben, die das Individuum zu Aktivitäten motivieren, die ihrerseits die Funktionstüchtigkeit anderer psychischer Funktionen herstellen, sicherstellen oder erhöhen. Dies geschieht in einem sog. organizational mode – einer Art Trainings- und Wartungsmodus, in dem 25 Für eine Darstellung der konzeptuellen Grundlagen der Evolutionären Psychologie als einer unter mehreren verhaltenswissenschaftlich-psychologischen Forschungsrichtungen auf evolutionärer Basis vgl. Tooby und Cosmides 2005, S. 5–67. Vgl. auch und für eine Darstellung anderer evolutionärer Perspektiven Laland und Brown 2002. Kritik zielt v.a. auf den hegemonialen Anspruch der Evolutionären Psychologie, ihren adaptionistischen Fokus bei zugleich nur selektiver Beachtung des State of the art in der biologischen Theoriebildung und methodologische Probleme wie die Spekulativität von Erklärungsansätzen in Kombination mit der mangelnden Thematisierung von Alternativerklärungen zu den angebotenen evolutionspsychologischen Hypothesen (vgl. Buller 2005; Panksepp und Panksepp 2000; Richardson 2007). 26 Auf nicht evolutionär begründete Hypothesen zur Attraktivität erfahrungshafter Rezeption kann ich an dieser Stelle nicht näher eingehen. Vgl. zu den im Folgenden verwendeten Begrifflichkeiten und zur Vorgehensweise bei der Identifikation und Prüfung evolutionspsychologischer Hypothesen neben Tooby und Cosmides 2005 auch Buss et al. 1998, S. 533–548.

Erfahrungshaftigkeit als Attraktivitätspotential narrativer Formen

187

die entsprechenden psychischen Fähigkeiten nicht ihre eigentliche adaptive, reproduktionsrelevante Funktion für den Organismus erfüllen, sondern ausgebildet, kalibriert, mit notwendigem Informationsinput versorgt und damit letztlich für die Erfüllung ihrer adaptiven Funktion geschult und in Bereitschaft versetzt werden. Die angesprochenen evolvierten Motivationssysteme sorgen nun dafür, dass Individuen dieses „Trockentraining“ im Organisationsmodus als intrinsisch belohnend wahrnehmen und entsprechende Aktivitäten in von sonstigem Handlungsdruck befreiten Situationen aufsuchen. „Organisierende“ Effekte auf bestimmte psychische Adaptationen sind dabei insbesondere für solche Aktivitäten zu erwarten, die den eigentlichen Funktionen dieser Adaptationen ähnlich sind bzw. diese bis zu einem gewissen Grad ersetzen oder simulieren.27 Übertragen auf unseren Gegenstandsbereich kann man nun annehmen, dass solche Motivationssysteme auch für psychische Adaptionen existieren, die Funktionen im Kontext der Umweltwahrnehmung erfüllen. Aktivitäten wie erfahrungshafte Medienrezeptionsprozesse, die Umwelterfahrung simulieren bzw. dieser ähneln, würden durch diese Motivationssysteme als „organisierend“ erkannt und von Individuen als intrinsisch belohnend erfahren. Eine gewisse prinzipielle Attraktivität erfahrungshafter Rezeption ließe sich also auf diese Weise begründen. Allerdings lassen sich mit diesem Argument kaum komparative Aussagen treffen, also Aussagen hinsichtlich einer höheren Attraktivität der erfahrungshaften im Vergleich zu anderen Rezeptionsmodalitäten, da vergleichbare Motivationssysteme aus der Logik des Arguments heraus konsequenterweise für sämtliche, auch nicht wahrnehmungsbezogene psychische Adaptationen unterstellt werden müssen. Diese These behauptet also einen intrinsischen Wert erfahrungshafter Rezeptionsprozesse als einer Aktivität, die vom Individuum als positiv und angenehm erlebt wird. Im selben Beitrag von Tooby und Cosmides – wenngleich in etwas unklarem Bezug zur eben dargestellten These – findet sich ein anderes Argument, das demgegenüber eher auf den indirekten, instrumentellen Nutzen erfahrungshafter Rezeption abhebt und in ähnlicher Form auch aus Konzeptionen anderer Autoren heraus begründet werden kann. Der Grundgedanke dieser Argumentation besteht in der Überlegung, dass die psychischen Funktionen des Menschen und seiner stammesgeschichtlichen Vorfahren sich über die längste Zeit ihrer Phylogenese hinweg in Beziehung ausschließlich zur unmittelbaren physischen und sozialen Umwelt des Menschen entwickelt und damit auf die Verarbeitung von informatorischem Input aus der sinnlichen Selbst- und Umweltwahrnehmung spezialisiert haben. Aufgrund dieser evolutionsbedingten Passung des psychischen Apparats auf die Interaktion mit der unmittelbaren Umwelt könnten diverse psychische Funktionen in erfahrungshaften Medienrezep27 Vgl. zur Argumentation ausführlich Tooby und Cosmides 2001, S. 6–27.

188

Felix Frey

tionsepisoden besonders sensibel und effizient arbeiten (vgl. Tooby und Cosmides 2001, S. 24).28 Bezogen auf die im engeren Sinn kognitiven Prozesse wie das Verstehen von Sachverhalten und Botschaften könnte sich diese Effizienz in einer besonderen subjektiven und objektiven Verständlichkeit bzw. Verarbeitungsgeläufigkeit von Stimuli in einem erfahrungshaften Format bemerkbar machen.29 Anzunehmen ist außerdem eine besondere Sensibilität auch der emotionalen Funktionen in erfahrungshaften Rezeptionsepisoden. Emotionale Reaktionen aller Art dürften beim Rezipienten unter solchen Bedingungen wahrscheinlicher auftreten und möglicherweise intensiver ausfallen als im Zuge nichterfahrungshafter Medienrezeptionsprozesse, da die drei hauptsächlichen Wege der Aktualgenese von Emotionen bei der Medienrezeption – Emotionsansteckung, empathische Vermittlung von Emotionen und Emotionsinduktion durch Bewertungsprozesse (sog. Appraisalprozesse) – stark auf Prozessen der Personen- bzw. Umweltwahrnehmung beruhen und die Intensität des Emotionserlebens dabei mit der Nähe zum realen Erleben variieren dürfte (vgl. Scherer 1998).30 Schließlich dürfte sich die besondere Passung des menschlichen psychischen Apparates auf die Verarbeitung der physischen und sozialen Umwelt auch im motivationalen Bereich bemerkbar machen. Beispielsweise dürften evolvierte Motivationssysteme mit der adaptiven Funktion, die Aufmerksamkeit des Individuums auf bestimmte reproduktionsrelevante Aspekte der Umwelt zu richten und sich mit ihnen auseinanderzusetzen, besonders auf ihren ursprünglichen Funktionszusammenhang – die Umweltwahrnehmung nämlich – abgestimmt sein. In Bezug zu adaptiven Probleme stehende Objektbereiche wie das Denken, Fühlen und Handeln unserer Mitmenschen, aber auch Fragen des Überlebens, der Ernährung, Partnerwahl, Sexualität, Versorgung und Erziehung des Nachwuchses und Unterstützung des sozialen Umfelds insbesondere der genetischen Verwandten31 sollten demnach zwar auch eine gewisse Anziehungskraft entfalten, wenn sie in abstrakter, der Alltagserfah28 Vgl. zu dieser „Passung“ des menschlichen Erkenntnisapparats aus der Perspektive der evolutionären Erkenntnistheorie Vollmer 1990, S. 97. 29 Vgl. Tooby und Cosmides 2001, S. 24, und Dow 2006, die dabei explizit einen Bezug zu narrativen Kommunikationsformen herstellen. Vgl. auch ähnliche Konzeptionen im Kontext der psychologischen Zwei-Prozess-Theorien. So behauptet z.B. Epsteins Cognitive-Experiential-Self-Theorie die Existenz zweier Operationsmodi des menschlichen Informationsverarbeitungssystems: Der experientielle Operationsmodus als dasjenige System, das sich als biologische Anpassung auf die Umwelt beim Menschen entwickelt hat und das er mit anderen höheren Tieren gemeinsam hat, operiert automatisch, schnell, ohne Anstrengung, holistisch, assoziativ, konkret, emotional und mit minimalen Anforderungen an die kognitiven Ressourcen. Das rationale System arbeitet langsamer, bewusst, analytisch, mit logischen Schlussfolgerungen und auf Basis von Sprache, abstrahiert und stellt hohe Anforderungen an die kognitiven Ressourcen (vgl. zusammenfassend Epstein und Pacini 1999). 30 S. auch Frijdas Ausführungen zu seinem sog. law of apparent reality (vgl. Frijda 1988, S. 352). 31 Vgl. zur Klassifikation adaptiver Probleme z.B. Buss 2004, zum adaptiven Wert sozialer Informationen Barkow 1992, S. 629ff., und Pinker 1997, S. 540f.

Erfahrungshaftigkeit als Attraktivitätspotential narrativer Formen

189

rung enthobener Form (bspw. in wissenschaftlichen Abhandlungen, Faktensammlungen usw.) tangiert werden. Die genannten Motivationsprogramme dürften aber besonders sensibel auf entsprechende Hinweisreize ansprechen, wenn diese in einem der Wahrnehmung ähnlichen Format prozessiert werden, etwa im Rahmen erfahrungshafter Medienrezeptionsepisoden. Diese phylogenetisch bedingte Passung der kognitiven, emotionalen und motivationalen Funktionen des Menschen auf Aufgaben der Umweltund Personenwahrnehmung dürfte also, zusammenfassend, dazu führen, dass durch der Wahrnehmung ähnliche Prozesse – beispielsweise erfahrungshafte Medienrezeptionsepisoden – bestimmte phylogenetisch oder ontogenetisch erworbene, bewusste und unbewusste Bedürfnisse und Handlungsziele des Menschen objektiv und subjektiv effizienter realisiert werden können: Dies können Bedürfnisse nach Kontrolle und Sinn sein bzw. die eben angesprochenen objektbereichsbezogenen Motivationsprogramme, aber auch Bedürfnisse nach emotionalen Erlebnissen.32 Verständlicher, emotional berührender, stärker Aufmerksamkeit erregend und dadurch insgesamt attraktiver – so also sollten Rezipienten diesen Thesen zufolge erfahrunghafte Rezeptionsepisoden im Vergleich zu nicht oder weniger erfahrungshaften erleben. Dass damit Qualitäten angesprochen sind, die auch häufig für narrative Kommunikationsformate bzw. deren Rezeption in Anspruch genommen werden,33 könnte ein Indiz dafür sein, dass mit der Erfahrungshaftigkeit der Rezeption tatsächlich ein zentrales Charakteristikum der Rezeption narrativer Kommunikate angesprochen ist. Weitere Argumente in dieser Richtung sind die hohe Anschlussfähigkeit und Integrationskraft des Konzepts der Erfahrungshaftigkeit sowohl für sprach- und literaturwissenschaftliche Analysen narrativer Kommunikate, als auch für Modelle, Thesen und Befunde im Bereich der sprach- und medienpsychologischen Rezeptionsforschung. Was aber noch aussteht, sind empirische Studien, die nicht nur die Existenz der hier behaupteten erfahrungshaften Rezeptionsmodalität belegen, sondern auch deren Rolle bei der Rezeption narrativer Kommunikaten sowie die hier beschriebenen und weitere Implikationen im Hinblick auf kognitive, emotionale, evaluative und motivationale Wirkungen untersuchen. Voraussetzung für diese empirischen Untersuchungen aber ist zunächst die weitere theoretische Ausarbeitung des Arguments, d.h. die Verbindung der konzeptuellen Bausteine literaturwissenschaftlicher, linguistischer, evolutions- und kognitionspsychologischer sowie kommunikationswissenschaftlicher Provenienzen zu einer kohärenten Modellierung der erfahrungshaften Rezeptionsmodalität, der sie evozieren32 Vgl. zur Annahme eines evolvierten Bedürfnisses nach Sinn und Kontrolle Dörner et al. 1983, S. 62f., und Heine et al. 2006, S. 91. Für Annahmen eines differenziell ausgeprägten need for emotion bzw. need for affect vgl. Raman et al. 1995; Maio und Esses 2001. 33 Vgl. z.B. die Wirkungsunterstellungen in Herbst 2008.

190

Felix Frey

den Faktoren und ihrer Wirkungspotentiale.34 Im vorliegenden Beitrag konnte hierfür schon allein aus Platzgründen lediglich eine Skizze geliefert werden, die – anders als in der Optik der Fall – zugunsten eines großen Bildwinkels auf Tiefenschärfe verzichten musste.

Literaturverzeichnis Angus, Lynne E. / John McLeod (Hg.), The Handbook of Narrative and Psychotherapy. Practice, Theory and Research, Thousand Oaks, CA, et al.: Sage, 2006. Barkow, Jerome H., „Beneath new culture is old psychology. Gossip and social stratification“, in: The adapted mind. Evolutionary psychology and the generation of culture, hg. von Jerome H. Barkow, Leda Cosmides und John Tooby, New York, Oxford: Oxford UP, 1992, S. 627–637. Böcking, Saskia, Grenzen der Fiktion? Von Suspension of Disbelief zu einer Toleranztheorie für die Filmrezeption, Köln: von Halem, 2008. Bragg, Rick, „Weaving storytelling into breaking news. ‚A little bit of narrative, like sugar, just makes everything better‘“, in: Nieman Reports 54.3 (2000), S. 29f. Branigan, Edward, Narrative Comprehension and Film, London: Routledge, 1992. Bruner, Jerome S., Acts of meaning, Cambridge, MA: Harvard UP, 1990. Buller, David, Adapting minds. Evolutionary psychology and the persistent quest for human nature, Cambridge, MA: MIT Press, 2005. Buss, David M., Evolutionäre Psychologie. 2., aktualisierte Aufl., München: Pearson, 2004. Buss, David M. / Martie G. Haselton / Todd K. Shackelford / April L. Bleske / Jerome C. Wakefield, „Adaptations, exaptations, and spandrels“, in: American Psychologist 53.5 (1998), S. 533–548. Cervetti, Gina N. / Marco A. Bravo / Elfrieda H. Hiebert / P. David Pearson / Carolyn Jaynes, „Text genre and science content: Ease of reading, comprehension, and reader preferences“, in: Reading Psychology 30.6 (2009), S. 487–511. Coleridge, Samuel Taylor, Biographia literaria or biographical sketches of my literary life and opinions, hg. von George Watson, London, VT: Dent/Tuttle, 1967. Coulter, Cathy A., „Finding the narrative in narrative research“, in: Educational Researcher 38.8 (2009), S. 608–611. Dörner, Dietrich / Franz Reither / Thea Stäudel, „Emotion und problemlösendes Denken“, in: Emotion und Kognition, hg. von Heinz Mandl und Günter L. Huber, München et al.: Urban & Schwarzenberg, 1983, S. 1–84. Dow, James W., The evolution of knowledge systems: Narrative knowledge versus scientific knowledge (unveröffentlichtes Manuskript), Rochester: Oakland University, 2006. Echterhoff, Gerald / Jürgen Straub, „Narrative Psychologie. Facetten eines Forschungsprogramms. Erster Teil“, in: Handlung Kultur Interpretation 12.2 (2003), S. 317–346. Epstein, Seymour / Rosemary Pacini, „Some basic issues regarding dual-process theories from the perspective of cognitive-experiential self-theory“, in: Dual-process theories in social psychology, hg. von Shelly Chaiken und Yaacov Trope, New York: Guilford Press, 1999, S. 462–482. 34 Sowohl diese theoretische Ausarbeitung als auch die empirische Prüfung sind Gegenstand des Dissertationsvorhabens des Autors.

Erfahrungshaftigkeit als Attraktivitätspotential narrativer Formen

191

Fernald, L. Dodge, „Tales in a textbook. Learning in the traditional and narrative modes“, in: Teaching of Psychology 16.3 (1989), S. 121–124. Fludernik, Monika, Towards a ‚Natural‘ Narratology, London, New York: Routledge, 1996. Franklin, Jon, Writing for story. Craft secrets of dramatic nonfiction by a two-time Pulitzer Prize winner, New York: New American Library, 1987. Freeman, Mark, „Why narrative? Hermeneutics, historical understanding, and the significance of stories“, in: Journal of Narrative and Life History 7.1-4 (1997), S. 169–176. Frey, Felix, Erzählung und menschliches Handeln. Narrative Medienangebote und ihr Attraktivitäts- und Verständlichkeitspotential, Marburg: Tectum-Verlag, 2009. Frijda, Nico H., „The laws of emotion“, in: American Psychologist 43.5 (1988), S. 349–358. Früh, Werner, „Theoretische Grundlegung des dynamisch-transaktionalen Modells“, in: Medienwirkungen. Das dynamisch-transaktionale Modell. Theorie und empirische Forschung, hg. von Werner Früh, Opladen: VS Verlag für Sozialwissenschaften, 1991, S. 85–189. Georgakopoulou, Alexandra / Dionysis Goutsos, „Revisiting discourse boundaries: The narrative and non-narrative modes“, in: Text 20.1 (2000), S. 63–82. Glaser, Manuela / Bärbel Garsoffky / Stephan Schwan, „Narrative-based learning: Possible benefits and problems“, in: Communications 34 (2009), S. 429–447. Halkia, Krystallia / Dimitris Mantzouridis, „Students’ views and attitudes towards the communication code used in press articles about science“, in: International Journal of Science Education 27.12 (2005), S. 1395–1411. Hartmann, Tilo, Die Selektion unterhaltsamer Medienangebote am Beispiel von Computerspielen, Köln: von Halem, 2006. Heine, Steven J. / Travis Proulx / Kathleen D. Vohs, „The meaning maintenance model. On the coherence of social motivations“, in: Personality and Social Psychology Review 10.2 (2006), S. 88–110. Herbst, Dieter, Storytelling, Konstanz: UVK, 2008. Hernadi, Paul, „Why is literature: A coevolutionary perspective of imaginative worldmaking“, in: Poetics Today 23.1 (2002), S. 21–42. Heussen, Gregor Alexander, „Eine Geschichte eben. Erzählende Formen“, in: ABC des Fernsehens, hg. von Ruth Blaes und Gregor Alexander Heussen, Konstanz: UVK, 1997, S. 264–277. Johnson-Laird, Philip N., Mental models. Towards a cognitive science of language, inference, and consciousness, Cambridge et al.: Cambridge UP, 1983. Jungermann, Helmut / Hans-Rüdiger Pfister / Katrin Fischer, Die Psychologie der Entscheidung. Eine Einführung, Heidelberg et al.: Spektrum, 1998. Kamil, Michael L., Matches between reading instruction and reading task demands (Manuskript, vorgestellt auf der American Educational Research Association Conference, New Orleans, LA: 1994). Kamil, Michael L. / Diane Lane, „A classroom study of the efficacy of using information text for first grade reading instruction“, o.J., 12.2.2010: http://www.stanford. edu/~mkamil/ Aera97.htm. Kelly, Jean / Jan Knight / Lee Anne Peck / Guy Reel, „Straight/narrative? Writing style changes reader’s perceptions of story quality“, in: Newspaper Research Journal 24.4 (2003), S. 118–122.

192

Felix Frey

Kelter, Stephanie, „Mentale Modelle“, in: Psycholinguistik. Ein internationales Handbuch, hg. von Gert Rickheit, Theo Herrmann und Werner Deutsch, Berlin, New York: de Gruyter, 2003, S. 505–517. Köhler, Sebastian, „Story und History. Eine Kritik der narrativistischen Tendenz fernseh-aktueller Krisen- und Kriegsvermittlung“, in: War Visions. Bildkommunikation und Krieg, hg. von Thomas Knieper und Marion G. Müller, Köln: von Halem, 2005, S. 321–330. Kreiswirth, Martin, „Merely telling stories? Narrative and knowledge in the human sciences“, in: Poetics Today 21.2 (2000), S. 293–318. Labov, William / Joshua Waletzky, „Narrative analysis“, in: Essays on the verbal and visual arts, hg. von June Helm, Seattle: University of Washington Press, 1967, S. 12–44. Laland, Kevin N. / Gillian R. Brown, Sense and nonsense. Evolutionary perspectives on human behaviour, Oxford: Oxford UP, 2002. Lehmann, Volkmar, „Der narrative Redetyp und seine Analyse“, in: Textkohärenz und Narration. Untersuchungen russischer Texte des Realismus und der Moderne, hg. von Robert Hodel und Volkmar Lehmann, Berlin: de Gruyter, 2008, S. 179–226. Maio, Gregory A. / Victoria M. Esses, „The need for affect. Individual differences in the motivation to approach or avoid emotions“, in: Journal of Personality 69 (2001), S. 583–615. Mar, Raymond A. / Keith Oatley, „The function of fiction is the abstraction and simulation of social experience“, in: Perspectives on Psychological Science 3.3 (2008), S. 172– 192. Panksepp, Jaak / Jules B. Panksepp, „The seven sins of evolutionary psychology“, in: Evolution and Cognition 6.2 (2000), S. 108–131. Pappas, Christine, „Is narrative ‚primary‘? Some insights from kindergartners’ pretend readings of stories and information books“, in: Journal of Reading Behavior 25 (1993), S. 97–129. Paus-Hasebrink, Ingrid / Uwe Hasebrink, „Dimensionen, Modalitäten, Typen: Was ist was in der Rezeptionsforschung? Ein Sortierversuch als Conclusio“, in: Rezeptionsstrategien und Rezeptionsmodalitäten, hg. von Volker Gehrau, Helena Bilandzic und Jens Woelke, München: Fischer, 2005, S. 235–245. Pinker, Steven, How the mind works, New York et al.: Norton, 1997. Polkinghorne, Donald, Narrative knowing and the human sciences, New York, NY: State University of New York Press, 1988. Posner-Landsch, Marlene, Story Telling – Story Selling. Märchen und Märchenerzähler in der Wirtschaft, Köln: von Halem, 2007. Raiteri, Charles, Writing for broadcast news. A storytelling approach to crafting TV and radio news reports, Lanham, MD: Rowman & Littlefield, 2006. Raman, Niranjan V. / Prithviraj Chattopadhyay / Wayne D. Hoyer, „Do consumers seek emotional situations? The need for emotion scale“, in: Advances in Consumer Research 22 (1995), S. 537–542. Richardson, Robert C., Evolutionary psychology as maladapted psychology, Cambridge, MA: MIT Press, 2007. Ryan, Marie-Laure, „Narrative“, in: Routledge encyclopedia of narrative theory, hg. von David Herman, Manfred Jahn und Marie-Laure Ryan, London et al.: Routledge, 2005, S. 344–348.

Erfahrungshaftigkeit als Attraktivitätspotential narrativer Formen

193

–, „Toward a definition of narrative“, in: The Cambridge companion to narrative, von hg. David Herman, Cambridge: Cambridge UP, 2007, S. 22–35. Scalise Sugiyama, Michelle, „Food, foragers and folklore“, in: Evolution and Human Behavior 22 (2001), S. 221–240. Scarry, Elaine, „On vivacity: The difference between daydreaming and imagining-underauthorial-instruction“, in: Representations 52 (1995), S. 1–26. Scherer, Klaus R., „Emotionsprozesse im Medienkontext: Forschungsillustrationen und Zukunftsperspektiven“, in: Medienpsychologie 10.4 (1998), S. 276–293. Schütz, Alfred / Thomas Luckmann, Strukturen der Lebenswelt, Neuwied: Luchterhand, 1975. Schwan, Stephan, Filmverstehen und Alltagserfahrung. Grundzüge einer kognitiven Psychologie des Mediums Film, Wiesbaden: DUV, 2001. Schwan, Stephan / Friedrich W. Hesse, „Kognitionspsychologische Grundlagen“, in: Lehrbuch der Medienpsychologie, hg. von Roland Mangold, Peter Vorderer und Gary Bente, Göttingen: Hogrefe, 2004, S. 73–99. Schwender, Clemens, Medien und Emotionen. Evolutionspsychologische Bausteine einer Medientheorie, Wiesbaden: DUV, 2001. Simoudis, Georgios, Storytising. Geschichten als Instrument erfolgreicher Markenführung, GroßUmstadt: Sehnert, 2004. Steen, Francis F., „The paradox of narrative thinking“, in: Journal of Cultural and Evolutionary Psychology 3.1 (2005), S. 87–105. Stierle, Karlheinz, „Erfahrung und narrative Form. Bemerkungen zu ihrem Zusammenhang in Fiktion und Historiographie“, in: Theorie und Erzählung in der Geschichte, hg. von Jürgen Kocka und Thomas Nipperdey, München: DTV, 1979, S. 85–118. Tengelyi, László, Erfahrung und Ausdruck. Phänomenologie im Umbruch bei Husserl und seinen Nachfolgern, Dordrecht: Springer, 2007. Tooby, John / Leda Cosmides, „Does beauty build adapted minds? Toward an evolutionary theory of aesthetics, fiction and the arts“, in: SubStance 94/95 (2001), S. 6–27. –, „Conceptual foundations of evolutionary psychology“, in: The handbook of evolutionary psychology, hg. von David M. Buss, Hoboken, NJ: Wiley, 2005, S. 5–67. Toolan, Michael, Narrative. A critical linguistic introduction, 2. Aufl., London: Routledge, 2001. Vollmer, Gerhard, Evolutionäre Erkenntnistheorie. Angeborene Erkenntnisstrukturen im Kontext von Biologie, Psychologie, Linguistik, Philosophie und Wissenschaftstheorie, 5., durchgesehene Auflage, Stuttgart: Hirzel, 1990. Weiß, Ralph, Fern-Sehen im Alltag. Zur Sozialpsychologie der Medienrezeption, Wiesbaden: Westdeutscher Verlag, 2001. Wenzel, Peter, „Zu den übergreifenden Modellen des Erzähltextes“, in: Einführung in die Erzähltextanalyse. Kategorien, Modelle, Probleme, hg. von Peter Wenzel, Trier: WVT, 2004, S. 5–22. Wolf, Werner, „Das Problem der Narrativität in Literatur, bildender Kunst und Musik. Ein Beitrag zu einer intermedialen Erzähltheorie“, in: Erzähltheorie transgenerisch, intermedial, interdisziplinär, hg. von Vera und Ansgar Nünning, Trier: WVT, 2002, S. 23– 104.

194

Felix Frey

Zwaan, Rolf A., „The Immersed Experiencer. Toward an embodied theory of language comprehension“, in: Psychology of learning and motivation: Advances in research and theory, Bd. 44, hg. von Brian H. Ross, San Diego, CA, London: Elsevier, 2004, S. 35–62.

Durch Analyse zur Synthese

195

Durch Analyse zur Synthese Paradigmen und kulturelle Voraussetzungen der Synästhesieforschung Christiane Heibach

Das Verhältnis zwischen Natur- und Geisteswissenschaften war schon immer ein spannungsgeladenes, niemals aber eines, das nicht in irgendeiner Form Wechselwirkungen hervorgebracht hätte. Von der Adaption physikalischer Theorien in Literatur und Philosophie der Romantik, über die Auswirkungen der Erkenntnisse Darwins auf die Literatur des späten 19. Jahrhunderts, im 20. Jahrhundert schließlich die Erschütterung der vermeintlichen Objektivität empirischer Forschungsmethoden durch die Erkenntnis, dass Beobachtungsmedien und -settings die Untersuchungsergebnisse beeinflussen, bis hin zum „linguistic turn“, der die Wechselwirkung von naturwissenschaftlicher Theorienbildung und sprachlicher Verfasstheit reflektierte und ganze philosophische Gebäude hervorbrachte – dies sind nur einige sehr prominente Beispiele einer fruchtbaren Wechselwirkung von natur- und geisteswissenschaftlichen Perspektiven. Gleichzeitig zeigen diese Entwicklungen auch die Historizität in den Herangehensweisen, Fragestellungen und Untersuchungsgegenständen sowie die kulturelle Verfasstheit von Ordnungsmustern, nach denen Daten ausgewertet und interpretiert werden – ein Gegenstand zahlreicher Untersuchungen aus der Wissenschaftsgeschichte.1 Zu Beginn des 20. Jahrhunderts lässt sich ein neu auflebendes Interesse für die Verfasstheit des Menschen beobachten, das sich disziplinenübergreifend in den Wissenschaften manifestiert und gleichermaßen auch in der sozialen Lebenswelt sowie in der Kunst Niederschlag findet. Dieses Interesse ist geprägt von einem Bedürfnis der Überwindung klassischer Oppositionen, die nicht zuletzt durch die Philosophie fest im kulturellen Bewusstsein verankert waren: Insbesondere der Dualismus von Körper und Geist wird durch ganzheitliche Konzepte einer Konvergenz von Physischem, Psychischem und Geistigem zunehmend konterkariert. Dies gilt für die Entstehung neuer Wissenschaftszweige wie der Psychoanalyse genauso wie für die seit Ende des 19. Jahrhunderts weite Kreise der Gesellschaft erfassenden 1

Vgl. z.B. Daston und Galison 2007, vgl. auch Daston 2001 und natürlich, nach wie vor, Foucault 1990.

196

Christiane Heibach

esoterischen und okkulten Strömungen, die verschiedenen Ausformungen der Lebensreformbewegung, aber auch für die Entdeckung des Körpers und der sinnlichen Wahrnehmung in den Künsten. In diesem Klima der Suche nach synthetischen Welterklärungen siedelt sich auch der spezielle Bereich der Synästhesieforschung an. Insgesamt gibt es zwei Hochzeiten, in denen Synästhesie zum Thema wird: Die eine fand sich zu Beginn des 20. Jahrhunderts bis in die 1920er Jahre hinein, die zweite begann Ende der 1970er Jahre und dauert bis heute an. Aus wissenschaftshistorischer Sicht stellt sich die Frage, warum gerade dieses Forschungsfeld zu bestimmten Zeiten in den Fokus rückt und ob und inwiefern dies mit entsprechenden kulturellen Paradigmen und Entwicklungen zu erklären ist. Zudem bietet die Geschichte der Synästhesie-Forschung ein interessantes Fallbeispiel für die Veränderung von Untersuchungsparadigmen im Bereich der Naturwissenschaften2 – und damit zum einen für die Konvergenz von Kultur und Wissenschaft, zum anderen für die Historizität wissenschaftlicher Fragestellungen. Der Begriff „Synästhesie“ hat viele Implikationen und je nach Wissenschaftsgebiet unterschiedliche Bedeutung, hier seien nur die drei wichtigsten erwähnt: Zum einen kennt die Literaturwissenschaft die Synästhesie als ein wichtiges literarisches Stilmittel, das sich vor allem in Metaphern niederschlägt: „Ihr klingt des Himmels Bläue süßer noch“ – diese Zeile aus Mörikes Gedicht „Um Mitternacht“ mischt optische, akustische und gustatorische Sinnesempfindungen und verweist damit auf das Grundcharakteristikum der Synästhesie: die Verbindung von verschiedenen Wahrnehmungsmodalitäten, die im Falle der literarischen Sprache eine spezifisch poetische Gesamtatmosphäre erzeugen. Basis für derartige literarische Synthesen ist die zweite, der Wahrnehmungspsychologie bekannte Bedeutung von Synästhesie, das Prinzip der intermodalen Analogie – also der assoziativen Verbindung verschiedener Sinneswahrnehmungen, wie sie besonders prominent zwischen visuellen und akustischen Reizen besteht: ein „schreiendes“ Rot, ein „dunkler“ Ton – diese Beschreibungen sind uns auch aus dem Alltag geläufig. Synästhesie als kognitives Phänomen aber hat noch eine dritte Bedeutung, die als „genuine“ oder „starke“ Synästhesie bezeichnet wird (vgl. Cytowic 2002b, S. 7): Sie beschreibt das Phänomen einer unwillkürlichen Sinneswahrnehmung, die durch einen Reiz ausgelöst wird, der sich an einen anderen Sinn wendet. Synästhetiker nehmen zum Beispiel beim Hören eines Tones eine Farbe wahr – und zwar tatsächlich wahr, entweder als Projektion außerhalb ihrer selbst oder als Wahrnehmung auf einer Art innerem Monitor. Sie können diese Mechanismen kaum bewusst steuern, so 2

Die Synästhesieforschung bewegt sich von Anfang an im interdisziplinären Bereich von Psychologie und Physiologie, in der jetzigen Phase kommen noch die Neurowissenschaften hinzu – sie gehört in erster Linie zu den empirischen und experimentellen Wissenschaftsfeldern.

Durch Analyse zur Synthese

197

dass es sich – so inzwischen die nahezu einhellige Forschermeinung – um ein tatsächliches kognitives Phänomen handelt.3 Synästhesien sind nicht auf den auditiv-visuellen Bereich beschränkt, sondern können auch zwischen allen anderen Sinnesbereichen bestehen: Es gibt zum Beispiel gustatorischtaktile Synästhetiker, die Geschmäcker spüren und so als „spitz“, „rund“ oder „eckig“ charakterisieren. Synästhetiker sind heute für die Forschung so interessant, weil man sich durch die Analyse ihrer Art der Wahrnehmung Aufschluss über die Verarbeitung von Sinneswahrnehmungen im Gehirn erhofft. Bisher können Kognitionswissenschaftler zwar die einzelnen Gehirnzentren lokalisieren, in denen visuelle, akustische, taktile, gustatorische und olfaktorische Wahrnehmungsdaten verarbeitet werden. Doch was sich, so Gerhard Roth, nach wie vor als großes Rätsel erweist, sind die verschiedenen Verbindungen der für die kognitive Verarbeitung von Sinnesdaten zuständigen Gehirnareale untereinander. Zudem existieren Areale wie der temporale Cortex, in dem Daten verschiedener Sinneswahrnehmungen verarbeitet werden und somit die per se auf deren Synthese angelegt sind.4 Derartige Ergebnisse deuten darauf hin, dass, entgegen der in westlichen Kulturen bis heute vorherrschenden Auffassung von der strikten Trennung der Sinne und der Dominanz des visuellen Sinnes als (allenfalls noch gemeinsam mit dem akustischen) einzigen für die Erkenntnis relevanten,5 Sinnesdaten im Gehirn bei Weitem nicht so strikt voneinander getrennt behandelt werden. Sinnliche Wahrnehmung, so könnte man zugespitzt formulieren, erfolgt demnach niemals monosensuell, sondern immer mehrsensuell, ganz abgesehen davon, dass sie in engem Zusammenhang mit Gefühlen und Handlungsentscheidungen steht. Die Ignoranz der westlichen Erkenntnistheorien gegenüber der Komplexität der sinnlichen Wahrnehmung hat mehrere Ursachen, die sich auch auf die mediale und künstlerische Entwicklung der letzten beiden Jahrhunderte auswirkten und für die Herausbildung der Paradigmen der ersten Phase der Synästhesieforschung nicht unwesentlich sind. Ohne hier auf Details eingehen zu können, kann man folgende Gründe für diese Entwicklung angeben:

3

4 5

Cytowic entwickelte mehrere Kriterien, um die starke Synästhesie von der intermodalen Analogie zu differenzieren: Genuine Synästheten nehmen die zusätzlichen Sinneseindrücke unwillkürlich wahr, d.h. sie können sie nicht willentlich hervorrufen oder eliminieren; synästhetische Wahrnehmungen haben räumlichen Charakter und sind uniliteral (wer Farben bei akustischen Signalen sieht, hört meist nicht umgekehrt Töne bei Farbwahrnehmungen); die Zuordnungen z.B. der Farben zu Buchstaben oder Tönen bleiben über lange Zeiträume konstant; Synästhesien haben engen Bezug zur Erinnerungsfähigkeit; und sie sind aus Sicht des Empfindenden absolut real (vgl. Cytowic 2002b, S. 13–17). Vgl. Roth 2003, S. 146. Der temporale Cortex verarbeitet sowohl visuelle als auch akustische Daten. Vgl. zu einem informativen Überblick der philosophischen Behandlung der Sinne Jütte 2000.

198

Christiane Heibach

– Die sinnliche Wahrnehmung wurde schon seit der Antike mit der Natur des Menschen in Verbindung gebracht. Diese Bindung des Menschen an unhintergehbare biologische Präformierungen wird mit Descartes und später dann mit Kant (trotz dessen Erkenntnis, dass die sinnliche Wahrnehmung durchaus auf unsere Verstandesoperationen einwirkt) quasi inkriminiert, weil sie dem sich herausbildenden Konzept eines autonomen, naturunabhängigen und nach übergeordneten geistigen Kriterien denkenden und handelnden Menschen entgegensteht.6 Einer Abwertung der Bedeutung der sinnlichen Wahrnehmung für die Erkenntnisbildung des Menschen steht somit eine Aufwertung der inneren Informationsverarbeitungsprozesse gegenüber, die zum Beispiel in der Vernunft und der – für die Grundlegung der Autonomieästhetik in Klassik und Romantik eminent wichtigen – selbsttätigen Einbildungskraft verortet werden. Die Rolle der äußeren Sinne wird zwar nicht geleugnet, ihre Bedeutung aber doch wesentlich reduziert. – Zum Zweiten ist die Geschichte der menschlichen Kulturen auch eine der Sinneshierarchien (und damit verbunden eine der entsprechenden Wahl der kulturell relevanten Medien): Das Auge erweist sich für die westlichen Kulturen als der wichtigste Sinn, gefolgt vom Ohr. Weit abgeschlagen dahinter finden sich Taktilität, Geschmack und Geruch. Letztere als sogenannte „Nahsinne“ wurden, wie Mădălina Diaconu in ihrer großen Studie über das Tasten, Riechen und Schmecken feststellt, aufgrund der scheinbaren Subjektivität ihrer Wahrnehmungsmodalität als nicht theoriefähig angesehen und unterlagen daher keinen Prozessen der Standardisierung der Wahrnehmung, die seit der Renaissance zur Bedingung der Verständigung über die Welt geworden waren. Die Zentralperspektive in der Optik und die musikalische Theorienbildung erlauben es, dem Auge und dem Ohr einen objektivierten Gegenstandsbereich zuzuordnen, während Taktilität, Olfaktorik und Gustatorik weitgehend in den Bereich der Subjektivität und damit der wissenschaftlich nicht erfassbaren Wahrnehmungen verwiesen wurden. Zudem wurden sie aufgrund ihrer Nähe zu den biologischen Funktionen und ihrer grundlegenden Bedeutung für das reine Überleben als „niedere“ Sinne aus jeglicher Theorienbildung verbannt.7 – Mit dieser epistemologischen Entwicklung korrespondiert auch die Entstehung eines autonomen Kunstsystems: Die Wende vom 18. zum 19. Jahrhundert, als sich die Paradigmen für die Autonomie des Menschen durchsetzen, ist gleichzeitig die Zeit, in der die Trennung der Künste zur Basis für die Herausbildung einer Ästhetik als Kunsttheorie wird – ungeachtet der vor allem von den Frühromantikern immer wieder visionierten Verbindung der Künste, die mehr als Utopie, nicht jedoch als ernsthafte Realisierungsoption gesehen wurde. Statt dessen avanciert das 6

7

Diesen Dualismus von Natur und Vernunft entwickelt Kant vor allem in der Metaphysik der Sitten (1785) (vgl. Kant 1974). Vgl. zu Descartes auch Gebauer 1984, S. 236. Gernot Böhme kritisiert darüber hinaus an den klassischen Ästhetiken, dass sie „nicht eine Theorie sinnlicher Erfahrung, sondern der intellektuellen Beurteilung“ seien (Böhme 2001, S. 30). Vgl. Diaconu 2005, S. 33ff. Der Ignoranz der Philosophie gegenüber den „Nahsinnen“ steht die tatsächliche Relevanz dieser Sinne für die soziale Verfasstheit von Gesellschaften gegenüber. So schließen sich z.B. an Geschmack und Geruch ganze kulturelle Felder an: Genannt seien hier nur die Ausdifferenzierung von Essenskulturen sowie der Prozess der sukzessiven Eliminierung des Gestanks aus den Städten, die die neuzeitliche Städteplanung nicht unwesentlich beeinflusste. Vgl. zu Ersterem Paczensky und Dünnebier 1999, zu Letzterem Corbin 2005.

Durch Analyse zur Synthese

199

Buch zum Leitmedium für die Literatur, die Instrumentalmusik erhält ihre ästhetische Rechtfertigung und wird gegenüber der multimedialen Oper erheblich aufgewertet – die Trennung der Künste und ihre Bindung an bestimmte Medien sowie an die monosensuelle Wahrnehmung wird somit zur impliziten Grundlage der Autonomieästhetik (vgl. Heibach 2010, S. 84ff. sowie 118ff.).

I. Die Entwicklung der Synästhesieforschung bis zum Anfang des 20. Jahrhunderts Trotz der historisch dominanten Abwertung der äußeren Sinne gab es auch Gegenentwürfe, die in der sinnlichen Wahrnehmung eine wesentliche, wenn nicht sogar die einzige Basis für die menschliche Erkenntnis sahen. Am prominentesten entwickelten diese Idee der Empirismus und Sensualismus zu Beginn des 18. Jahrhunderts (vgl. Shaftesbury [1699] 1905; Condillac [1754] 1983). Johann Gottfried Herder fordert in der Folge auch die Grundlegung einer Ästhetik auf der Basis der Differenzierung der äußeren Sinne und schlägt eine „empirische“ Ästhetik vor, die nicht von abstrakten Begriffen wie dem Erhabenen oder dem Schönen ausgeht, sondern von der Sinnlichkeit der Künste. So werden die Malerei als Augen-, die Musik als Ohren- und Plastik als Tastkunst klassifiziert, während die Poesie als synästhetische Kunst gilt, die sich aus allen Sinnen speist.8 Im Zuge der Diskussion um die Bedeutung der sinnlichen Wahrnehmung für die Erkenntnis wurde auch immer wieder auf Berichte über verknüpfte Sinneswahrnehmungen Bezug genommen. So berichtet John Locke 1690 von einem blinden Patienten, der versuchte, sich über assoziative Verbindungen Licht und Farbe vorzustellen, und so die Farbe Purpur mit dem Ton einer Trompete gleichsetzte (vgl. Locke 1872, S. 27). Ob es sich dabei um eine echte Synästhesie handelte oder eine erlernte assoziative Verknüpfung, geht aus diesem Beispiel nicht hervor, aber die Tatsache, dass der Blinde eine Verbindung von Farbe und Ton herstellte, ohne Kenntnis von Farben zu haben, verweist auf ein vorhandenes kulturelles Verbindungsmuster zwischen beiden Feldern, auf das er sich stützen konnte. Davon zeugt auch eine lange Historie von Kunstexperimenten, die Farbe und Musik miteinander verflechten:9 1725 stellte Louis-Bertrand Castel z.B. das erste Farbenklavier vor und begründete so eine bis heute andauernde Tradition der Entwicklung von Instrumenten und Kompositionen, die Farbe und Ton koppeln sollen. Zu dieser Entwicklung trug unter anderem auch Charles Darwins Großvater Erasmus Darwin 1790 mit einer Farblichtkom8 9

Vgl. die ästhetische Konzeption der Zuordnung der Künste zu jeweils einem äußeren Sinn, die Herder im „Vierten kritischen Wäldchen“ entwickelt (Herder [1769] 1993). Vgl. zu einem detaillierten Überblick über die Geschichte der Farbe-Ton-Konvergenzen und ihrer theoretischen Prämissen Jewanski 2006.

200

Christiane Heibach

position bei (vgl. Marks 1997, S. 67). Hintergrund dieser künstlerischen Experimente sind um diese Zeit jedoch eher physikalische Untersuchungen zur Konvergenz von Licht und Tonfrequenz, weniger wahrnehmungstheoretische Erwägungen. Ab 1890 wird die Synästhesie als audition colorée, unter die allerdings auch andere, jedoch seltener untersuchte Synästhesieformen als das Farbenhören subsumiert werden (vgl. Mahling 1927, S. 309ff.; Marks 1997, S. 50ff.), zu einem ernsthaften Forschungsobjekt der Psychologie. In seiner Forschungssynopse von 1926 zählt Friedrich Mahling für die Zeit zwischen 1882 und 1900 rund 150 Studien zu diesem Thema – und zwar in erster Linie aus Frankreich, Deutschland, England, Italien und den USA.10 Zwischen 1900 und 1927 nimmt die Zahl nochmals kontinuierlich zu – die meisten Studien werden in den 1920er Jahren publiziert, darunter auch diejenigen des Musikpsychologen Georg Anschütz, der zwischen 1927 und 1936 vier FarbeTon-Kongresse veranstaltet, in denen die Ergebnisse seiner und anderer Untersuchungen zum Farbenhören vorgestellt werden. Gegenüber den Farbe-Ton-Verbindungen und -Experimenten des 18. Jahrhunderts, die eher Einzelerscheinungen waren, lässt sich im aufkommenden Forschungsfeld der Synästhesie Mitte des 19. Jahrhunderts ein erster Wechsel der Untersuchungsprämissen beobachten. Stellten im 18. Jahrhundert in den epistemologischen Diskussionen die Fragen nach den mentalen Repräsentationen und der Rolle der sinnlichen Wahrnehmung für die menschliche Erkenntnis die Untersuchungsgrundlage dar, so wurden die Farbe-Ton-Experimente durch die Suche nach dem physikalischen Charakter von Licht und Farbe angetrieben. Das psychologische Interesse an synästhetischen Phänomenen in der zweiten Hälfte des 19. Jahrhunderts verändert diesen Fokus signifikant: Synästhesie wird hier weniger als individuelles Phänomen, sondern mehr als eine Bestätigung einer psychisch-assoziativen Konvergenz zwischen Ton (insbesondere den Vokalen) und Farbe angesehen. Physikalisch hatte sich durch James Clerc Maxwells Forschungen der Unterschied zwischen Schallwellen und dem elektromagnetischen Charakter von Licht schon herausgestellt (vgl. Jewanski 2006, S. 167). Für die Ende des 19. Jahrhunderts beginnende psychologisch motivierte Synästhesieforschung jedoch schien die audition colorée ein Beweis für den engen Zusammenhang von Farbe und Ton aus anthropologischer Perspektive zu sein. Ungeachtet des unterschiedlichen physikalischen Charakters also wird auf der Ebene der menschlichen Psyche eine synthetische Verbindung zwischen beiden vorausgesetzt.11 Synästhesie, in der ersten Hälfte des 19. Jahr10 Vgl. die ausführliche Bibliographie in Mahling 1927, S. 399ff. 11 Mahling spricht diesen Zusammenhang explizit an und erklärt die Synthese der Verbindung von Ton und Farbe in der menschlichen Psyche zum eigentlichen Ziel der Synästhesieforschung (vgl. Mahling 1927, S. 304).

Durch Analyse zur Synthese

201

hunderts noch als pathologische Deviation klassifiziert, wird somit schnell zu einem Spezialfall einer angeblichen anthropologischen Konstante der inhärenten Verbindung von Farb- und Klangwahrnehmung.12 So werden Muster abgeleitet zwischen den Zuordnungen, die Synästhetiker und NichtSynästhetiker zu Tönen vornehmen, um die Allgemeingültigkeit z.B. der Einordnung von „hellen“ Vokalen wie „e“ oder „i“ und „dunklen“ Vokalen wie „o“ oder „u“ zu entsprechend hellen oder dunklen Farben zu belegen. Synästhesie wird damit zu einem psychologischen Musterbeispiel für das Funktionieren von Assoziationen und dem Versuch, diese zu erklären. Daneben allerdings gibt es noch eine zweite prominente Linie der Synästhesieforschung, die die physiologischen Grundlagen der Synästhesie durch Messungen und Beschreibungen zu beleuchten versucht.13 Sie kann als Vorläufer der heutigen Synästhesieforschung gelten, die sich vor allem für die Funktionsweise des Gehirns bei Wahrnehmungsprozessen interessiert und einen großen Bereich der zeitgenössischen Synästhesie-Forschung darstellt.

II. Die Farbe-Ton-Forschungen von Georg Anschütz als Synthese-Projekt Der Musikpsychologe Georg Anschütz versucht in den 1920er Jahren, eine Erweiterung der Perspektiven der Synästhesieforschung vorzunehmen. Weder sucht er nach einer allgemeinen „verborgenen Synthese“14 von Ton und Farbe, noch entwickelt er Theorien über die physiologischen Ursachen der Synästhesie. Statt dessen geht er vom individuellen Charakter synästhetischer Wahrnehmungen aus, beschreibt ausführlich die Wahrnehmungen seiner Probanden beim Hören verschiedener Musikstücke und versucht, in seiner Analyse zum einen deren musikalische Begabung, zum anderen die Rolle der Musik und ihrer jeweiligen Struktur bei der Entstehung der Farbempfindungen näher zu bestimmen. Zunächst unterscheidet er komplexe oder synthetische von analytischen Synästhesien: Bei Ersteren findet die Zuordnung von Farben zu ganzen Tonkomplexen statt, „beginnend beim Intervall und endend bei ganzen Musikstücken“, während bei Letzteren die Licht- und Farbempfindungen an 12 Marks berichtet von sehr viel später durchgeführten Untersuchungen, die eine solche Konvergenz auch interkulturell zu bestätigen versuchten: So veröffentlichte C. E. Osgood z.B. 1960 eine Untersuchung, in der Anglo-Amerikaner, Navajos und Mexikaner im Hinblick auf ihre visuellen Assoziationen zu bestimmten Tönen getestet wurden und in der erstaunliche Parallelen zwischen den Kulturen festzustellen waren (vgl. Osgood 1960; Marks 1997, S. 87). 13 Vgl. die Zusammenfassung der ersten Synästhesieforschungen in Mahling 1927, S. 317ff. 14 Mahling bezieht sich in seiner Forschungssynopse auf diesen Begriff von Goethe, der jenseits physikalischer Merkmale einen Zusammenhang zwischen Farbe und Ton unterstellte, ohne diesen weiter belegen zu können (vgl. Mahling 1927, S. 304).

202

Christiane Heibach

einzelne Töne bzw. Tonhöhen gebunden sind (Anschütz 1927b, S. 69).15 Synthetische Synästhesien treten vor allem, so Anschütz, bei musikalisch hochbegabten Synästhetikern auf, scheinen also auch von einem gewissen erworbenen Verständnis von Musik abzuhängen. Anschütz testet seine Probanden beim Hören verschiedener Tonbeispiele, wobei Richard Wagner eine durchaus bemerkenswert dominante Position einnimmt und dessen Musik zudem nach Anschütz’ Aufzeichnungen bei den Probanden besonders komplexe Synästhesien auszulösen scheint. Ob das entsprechende Wissen über Wagners Bestreben, komplexe audiovisuelle Sinneseindrücke durch das Zusammenspiel der Künste auf der Bühne zu erzeugen, für die Testpersonen bei der Auslösung der synästhetischen Empfindungen eine Rolle spielte, verbleibt allerdings im Reiche der Vermutungen. Anschütz setzt dies anscheinend implizit durch die Auswahl der Beispiele voraus, reflektiert diese Prämisse aber nicht weiter. Immerhin lässt die Beschreibung der „Photismen“, wie Anschütz die durch die Musik ausgelösten Farbempfindungen nennt, gerade bei den zahlreichen Wagnerbeispielen einen Bezug zur Handlung der Szenen erkennen. Der Proband Max Gehlen z.B. sieht beim „Waldweben“ aus „Siegfried“ viele Farben, besonders aber tritt das Grün hervor (vgl. Anschütz 1927b, S. 108); beim „Feuerzauber“ aus der „Walküre“ nimmt er blau-violette Keile vor rötlich-orangenem Hintergrund wahr (S. 105). Das Wissen über den Inhalt, aber auch über die musikalischen Strukturen steuert in Anschütz’ musiktheoretisch orientierter Interpretation der Ergebnisse die Veränderungen der Farb- und Formwahrnehmungen und beeinflusst damit die Art und Weise der synästhetischen Wahrnehmungen. Ein derart enger Bezug zur Musikwissenschaft lässt Anschütz selber einen Konnex mit der künstlerischen Entwicklung seiner Zeit herstellen. So bezieht er sich auf die Farb-Licht-Musiken von Aleksander Skrjabin und Alexander Lászlo, die ihn in seinem Bestreben bestärken, der Synästhesie auf die Spur zu kommen, auch wenn er sich durchaus darüber bewusst ist, dass die Quelle derartiger Experimente nicht notwendigerweise in einer synästhetischen Veranlagung der Künstler liegen muss (vgl. Anschütz 1927b, S. 74). Er stellt damit selbst einen Zusammenhang her, der darauf verweist, dass sich die Synästhesie-Forschung in Tendenzen einreiht, die vor allem durch den Versuch gekennzeichnet sind, Synthesen zwischen vormals strikt getrennten Bereichen herzustellen. Das gilt zum einen für Anschütz’ Bestre15 „Synopsie“ ist das von Anschütz verwendete Wort für die Verbindung von akustischen und visuellen Wahrnehmungen, wobei er zwischen Photismen (von akustischen Reizen ausgelöste visuelle Empfindungen) und Phonismen (von visuellen Reizen ausgelöste akustische Empfindungen) unterscheidet. Er greift damit eine Terminologie auf, die in einer der ersten systematischen Untersuchungen über Synästhesie von den Medizinern Eugen Bleuler und Karl Lehmann vorgeschlagen wurde (vgl. Mahling 1927, S. 311f.). Anschütz’ Hauptaugenmerk liegt auf den Photismen (vgl. Anschütz 1927a, S. 3).

Durch Analyse zur Synthese

203

ben, nicht nur physiologische und psychologische, sondern auch musiktheoretische Erklärungsmodelle für das Phänomen der Photismen zu bemühen (vgl. Anschütz 1927a, S. 5), zum anderen für die Versuche, die Trennung der Künste durch solche Experimente wie die Farblichtspiele zu überwinden. Futurismus, Dadaismus und Surrealismus entwickeln darüber hinaus jeweils weitere Strategien, um die Künste zusammenzuführen, damit eine Lanze für die mehrsensorielle Wahrnehmung zu brechen und die Sinnlichkeit als einen wesentlichen Faktor der Künste wieder in ihr Recht zu setzen. Vor diesem Hintergrund können Kandinskys frühere Betrachtungen in „Über das Geistige in der Kunst“ als eine theoretische Kristallisation dieser Synthesebestrebungen verstanden werden, die darüber hinaus auch inhaltliche Bezüge zur Synästhesie-Forschung aufweisen. Kandinsky plädiert für eine Synthese gleich auf mehreren Ebenen: Zum einen auf der konkreten Materialebene im Bereich der Verbindung der Künste, zum anderen aber auch in Überlegungen, die Ausdruck und Inhalt, Materie und Geist in der abstrakt-sinnlichen Darstellung zu verbinden suchen. Dabei adaptiert er die Assoziationstheorie der Synästhesieforschungen für sein Konzept der ästhetischen Wahrnehmung: Die Verbindung von Farbe und Ton erzeugt im Rezipienten seiner Auffassung nach „seelische Vibrationen“, durch die starke affektive Reaktionen hervorgerufen werden, die zu einem tieferen Verständnis des Kunstwerkes führen können.16 Am Beispiel seiner Bühnenkomposition „Der gelbe Klang“ unterscheidet Kandinsky drei Darstellungsmittel, die das Innere, Geistige des Kunstwerks versinnlichen sollen: „1. musikalischer Ton und seine Bewegung / 2. körperlich-seelischer Klang und seine Bewegung durch Menschen und Gegenstände ausgedrückt / 3. farbiger Ton und seine Bewegung“ (Kandinsky [1912] 1973, S. 61). Die Verbindung von Farbe, Bewegung und Ton erweist sich für ihn als wesentliches Mittel, um einerseits die inneren „Vibrationen“ des Künstlers auszudrücken und dann idealerweise identische Vibrationen im Rezipienten hervorzurufen. Dabei setzt er voraus, dass bestimmte Farben und Formen auch bestimmte Affekte und Assoziationen erzeugen, die kommunizier- und nachvollziehbar sind. Ein derartiges Konzept basiert auf der Annahme einer grundlegenden anthropologischen Konstanz von Farbe-Ton-Assoziationen, wie sie auch die eine der oben geschilderten Richtungen der Synästhesieforschung vertritt. Jenseits dieser Detailüberschneidung verbindet sich Kandinskys Konzept mit dem ganzheitlichen Weltmodell der Anthroposophie, indem er die 16 Vgl. Kandinsky [1912] 1973, S. 61. In diesem Zusammenhang soll darauf verwiesen werden, dass von Kandinsky vermutet wird, dass er selber Synästhetiker war. De facto allerdings gibt es selten genug Daten, um mit Sicherheit retrospektiv synästhetische Veranlagungen bei Künstlern beweisen zu können. Und selbst wenn dies möglich wäre, würde eine derartige Erkenntnis kaum zur Interpretation der Kunst beitragen (vgl. auch die berechtigte Kritik an derartigen Aussagen in Jewanski 2006, S. 202ff.).

204

Christiane Heibach

materielle Welt mit einer immateriellen, sinnlich nicht wahrnehmbaren zusammendenkt und die Kunstrezeption an die anthroposophischen Erkenntnisstufen anlehnt. In dieser Wendung kehrt Kandinsky die Geist-MaterieOpposition um zu einer Komplementärbeziehung, die Anschütz später aufgreift und auf seine wissenschaftliche Arbeit überträgt: Er sieht Anthroposophie und Okkultismus als ein zukünftiges Forschungsfeld für die Psychologie, da die Wahrnehmungsphänomene der Synästhesie große Ähnlichkeiten mit Formen übersinnlicher Wahrnehmung aufwiesen und zu deren Klärung beitragen könnten (vgl. Anschütz 1927b, S. 204f.). Diese Überschneidungen in zwei sehr unterschiedlichen Kontexten verweisen schon auf eine Tendenz, die sich im Spannungsfeld von trennender Analyse und verbindender Synthese ansiedelt. Im Unterschied zur Diltheyschen Zuordnung von analytisch-erklärend zu den Naturwissenschaften, synthetisch-interpretierend zu den Geisteswissenschaften (vgl. Dilthey [1910] 1980, S. 101ff.) werden bei Kandinsky und Anschütz Analyse und Synthese als zwei Seiten einer umfassenden Herangehensweise an die jeweiligen Phänomene verstanden. Anschütz verschreibt sich explizit dem Programm, durch Analyse zur Synthese zu kommen und „analysierendes Vergleichen, Zählen und Messen“ mit „summarisch-komplex abtastende[m] Beschreiben“ zu verbinden (Anschütz 1927c, S. V). Auch die jeweilige Referenz auf die Esoterik kann als Ausdruck des wachsenden Bedürfnisses nach synthetisch-verbindenden Weltmodellen gelesen werden, die die Wissenschaften nicht ablehnen, aber neue integrative Rahmungen suchen, vor denen Gegensätze miteinander versöhnt und verbunden werden können – zugunsten eines ganzheitlichen Menschenverständnisses und des Modells einer kosmologischen Harmonie. Steiners Modell der sieben Existenzformen des Menschen verbindet jeweils Leib, Seele und Geist in unterschiedlichen Kombinationen miteinander und sieht in der sinnlichen Wahrnehmung die Ausgangsbasis, auf der der Mensch die höheren Stufen der Erkenntnis des Immateriellen erklimmen kann – bis hin zur Verschmelzung mit dem harmonischen Kosmos als höchstem Ziel.17 Derartige Konvergenzen zwischen der Kunst, der Psychologie und der Esoterik könnten weiter ergänzt werden, insbesondere durch die philosophischen Entwürfe der gerade sich formierenden anthropologischen Richtungen der Philosophie, wie sie sich z.B. in Helmuth Plessners Werk „Die Einheit der Sinne“ von 1923 manifestieren. Plessners „Ästhesiologie des Geistes“ entfaltet sich auf der Basis der konstatierten „Verarmung der Philosophie an Inhalten des unmittelbaren Lebens“ durch die Spaltung in expe17 Vgl. Steiner 1920. Steiner versteht sich bei der Skizzierung seines Modells durchaus als Wissenschaftler und macht es sich zur Aufgabe, die, wie er schreibt, durch naturwissenschaftliche Beobachtung und Messung erfolgte „gewaltige[n] Verfeinerung der Mittel zur Sinnesbeobachtung“ (S. 29) nun mit dem großen Feld des Unbeobachtbaren zu koppeln. Dass er dabei ausgesprochen selektiv und spekulativ vorgeht, steht auf einem anderen Blatt.

Durch Analyse zur Synthese

205

rimentelle Naturwissenschaften und Philosophie des Geistes ohne Berücksichtigung des sinnlichen Empfindens (Plessner [1923] 2003, S. 14). Plessners Bemühungen gehen in die Richtung einer Philosophie der Synthesen – der Synthese von sinnlicher Wahrnehmung und Geist, aber auch der Überwindung der strikten Subjekt-Objekt-Differenzierung, die sich bei ihm unter anderem in der Unterscheidung von „Körper“ als vom Menschen analysierund beherrschbares Instrument einerseits und „Leib“ als empfundener, organischer Teil des Menschen andererseits, manifestiert (S. 267ff.). Alle hier nur in Ansätzen geschilderten Herangehensweisen, so unterschiedlich ihre Welten auch sind, stehen für eine Suche nach – so könnte man es nennen – einer Epistemologie der Verbindungen, statt, wie in der philosophischen und naturwissenschaftlichen Forschung damals vorherrschend, der analytischen Trennungen. Sie korrespondieren mit einer kulturellen Entwicklung, die sich auch über die Kunsttheorie und -praxis sowie die Wissenschaften hinaus in Tendenzen wie der Lebensreformbewegung kristallisiert. Die Synästhesieforschung, wie sie Anschütz zu etablieren versucht, zeigt, wie stark auch empirisch geprägte Wissenschaften in ihren Fragestellungen und methodischen Vorgehensweisen von derartigen Strömungen beeinflusst werden.

III. Die Synästhesie-Forschung der 1980er und 1990er Jahre Nach dieser Hochzeit in den 1920er und 1930er Jahren wird die Synästhesieforschung durch den Zweiten Weltkrieg wieder marginalisiert und findet auch danach zunächst keine weitere Beachtung. Mit dem Neurologen Richard Cytowic, der 1979 beginnt, erneut zur Synästhesie zu forschen, und dem britischen Psychologen Simon Baron-Cohen, der das Thema in den 1980er Jahren aufgreift, wird das Forschungsfeld wieder belebt (vgl. Cytowic 2002a; Baron-Cohen und Harrison 1997). Dabei entsteht diese erneute Aufmerksamkeit in einer Zeit, in der mit den elektronischen Medien auch die Entwicklung mehrmedialer Kunst wieder mehr in den Fokus der öffentlichen Aufmerksamkeit rückt. Der Zusammenhang zwischen der neueren Synästhesieforschung und der Konjunktur mehrmedialer Kunst manifestiert sich jedoch indirekter als z.B. noch bei Anschütz’ expliziten Referenzen, so dass ein Zusammenhang vor dem Hintergrund der historischen Verflechtungen in den 1920er Jahren hier erst einmal nur vermutet werden kann. Die Entwicklung der Medientheorie in den letzten Jahrzehnten jedoch stützt die Annahme einer vorhandenen Wechselwirkung, denn sie steht generell für eine neue Aufmerksamkeit gegenüber der sinnlichen Wahrnehmung, ihrer Bedeutung und Funktionsweise im Zeitalter der digitalen Medien. Hierzu hat Marshall McLuhans Medienanthropologie nicht unwesentlich beigetragen. Seine Interpretation von Medien als Erweiterungen des Körpers und die sei-

206

Christiane Heibach

ne historischen Untersuchungen leitende Verflechtung der Entwicklung neuer Medien bei gleichzeitiger Veränderung der epistemologischen Paradigmen einer Kultur, wie er sie in The Gutenberg Galaxy ([1962] 1968) und Understanding Media ([1964] 1994) in den frühen 1960er Jahren entwickelte, hat erst in den 1980er und 1990er Jahren, nachdem die Bedeutung der Digitalisierung als einem signifikanten Faktor für den gesellschaftlichen und kulturellen Wandel nicht mehr zu übersehen war, ihre volle Wirkung entfaltet. Nachdem die utopischen Visionen, wie die Vilém Flussers von der Auflösung des Körpers in einem Organismus vernetzter Gehirne (vgl. Flusser 1985, S. 125), und die aufgeregten Diskussionen um das „Schwinden der Sinne“18 mit der zunehmenden Etablierung und dem damit einhergehenden realistischeren Umgang mit den neuen Medien langsam abgeklungen waren, rückte im Zuge der wachsenden Bedeutung interaktiver und intermedialer Konstellationen die Frage nach der sinnlichen Wahrnehmung in den Vordergrund und wurde von den gleichzeitig entstehenden Kognitionswissenschaften mit ihren verbesserten Mess- und Visualisierungstechnologien neu gestellt. Im Unterschied zur frühen Synästhesie-Forschung jedoch treten nun andere Konvergenzen hervor, die sich eher aus Übertragungsprozessen denn aus Synthesetendenzen speisen. Nicht zuletzt haben die Kognitionswissenschaften eine ihrer Wurzeln in der Kybernetik, der Lehre von der „Regelung und Nachrichtenübertragung in Lebewesen und Maschine“, wie Norbert Wiener sein 1948 erschienenes Werk nannte (vgl. Wiener [1948] 1963). Zwar ist die hier induzierte Analogie zwischen der Funktionsweise des Gehirns und des Computers, die in den 1960er und 1970er Jahren mit den Forschungen zur künstlichen Intelligenz einen Höhepunkt fand, heute zugunsten komplexerer Gehirnmodelle wieder etwas abgeflaut, jedoch sind Neurobiologen wie Gerhard Roth und mit ihm der über Synästhesie forschende Psychiater Hinderk Emrich dem mit der Kybernetik entstandenen Konstruktivismus nach wie vor verpflichtet (vgl. Roth 2003, S. 16f.; Emrich et al. 2002, S. 30). Das Gehirn erhält so den Status eines geschlossenen Systems, das seine eigenen, teilweise delinearen und rückkoppelungsintensiven Prozesse eigenständig steuert, um daraus schließlich unsere Weltwahrnehmung zu konstruieren und nicht – wie lange von der Philosophie diskutiert – die Welt in Repräsentationen abzubilden. Bei dieser kognitionswissenschaftlichen Modellierung der Wahrnehmung spielen die Kapazitäten der Sinnesorgane einerseits, vor allem aber die modular ablaufenden Verarbeitungsprozesse im Gehirn andererseits eine entscheidende Rolle. Visuelle Daten z.B. werden diesen Erkenntnissen zufolge arbeitsteilig im Gehirn verarbeitet: Helligkeit und Kontrast in einer, Bewegung in einer anderen, Farbinformationen in einer dritten Gehirnregion. So werden, nach Roth, 18 So der Titel eines von Kamper und Wulf herausgegebenen Sammelbands von 1984.

Durch Analyse zur Synthese

207

im primären (und sekundären) visuellen Cortex Einzelmerkmale eines Objektes wie Kontrast, Kantenorientierung, genaue Größe und Bewegungsrichtung verarbeitet [...], jedoch noch nicht die Gestalthaftigkeit und Identität des Objektes und seine Einbettung in einen größeren Zusammenhang. Dies geschieht erst in den assoziativen Arealen, wo ein Objekt als Gesicht, Hand, Glas usw. identifiziert wird. Allerdings sind die Neurone in den visuellen assoziativen Arealen nicht in der Lage, Details des Gesehenen zu verarbeiten, sondern das können nur die Neurone in den primären Arealen. Erst die Zusammenarbeit primärer, sekundärer und assoziativer Areale ergibt ein vollständiges, d.h. detailhaftes und gestalt- und sinnhaftes Bild des Gesehenen. (Roth 2003, S. 216; Hervorhebung im Text)

An der Verarbeitung der visuellen Daten sind durch die Integration der assoziativen Areale, die eine enge Verbindung zum limbischen System, dem „Sitz“ des Gedächtnisses und der Gefühle, aufweisen. Somit sind auch Erinnerungen und Emotionen beteiligt, die die äußeren mit inneren Daten ergänzen und das bewusste Bild schließlich hervorbringen.19 Roth spricht von „massive[n] parallele[n] Rückprojektionen“ zwischen „höheren“ Gehirnzentren und sekundären sowie primären Arealen bei begrifflich-abstrakten Leistungen, so dass die Möglichkeit einer hierarchischen Organisation des Gehirns dadurch zumindest in Frage gestellt ist (Roth 2003, S. 222). Interessanterweise – und dies deutet auf einen weiteren Faktor kultureller Formierung naturwissenschaftlicher Fragestellungen hin, der durch die Dominanz des visuellen Sinnes in westlichen Kulturen induziert ist – weiß die Kognitionswissenschaft bisher am meisten über die Verarbeitung der visuellen Daten, während von den anderen Sinnen bei Weitem nicht so viel bekannt ist.20 Allerdings beansprucht die Verarbeitung visueller Daten ungefähr die Hälfte aller Aktivitäten des Cortex, so dass auch neurologisch von einer Prämierung des Visuellen die Rede sein kann – ob diese sich evolutionär als Notwendigkeit für das Überleben herausgebildet hat oder in Wechselwirkung mit einer zunehmenden kulturellen Dominanz des Visuellen entstanden ist, bleibt jedoch eine ungelöste Frage. Roth vertritt die These, dass die Entwicklung des menschlichen Gehirns zumindest teilweise un19 Vgl. Roth 2003, S. 221. Ein ähnliches Ergebnis erzielten Forscher bei der Untersuchung der visuellen Wahrnehmung von Affen, aufgrund der Ähnlichkeit ihres Gehirns mit dem Menschen beliebte „Ersatzversuchspersonen“: „But the findings to date already strongly suggest that visual awareness cannot be thought of as the end product of such a hierarchical series of processing stages. Instead it involves the entire visual pathway as well as the frontal parietal areas, which are involved in higher cognitive processing.“ (Logothetis 2006, S. 10). Logothetis schließt: „The picture of the brain that starts to emerge from these studies is of a system whose processes create states of consciousness in response not only to sensory inputs but also to internal signals representing expectations based on past experiences.“ (S. 11). Die enge Verflechtung von Sinneswahrnehmungen und Gedächtnisleistungen sind nach Roth unter anderen im assoziativen Cortex lokalisiert, der auch enger als andere Gehirnareale mit dem limbischen System verbunden ist, das für die Emotionserzeugung zuständig ist (vgl. Roth 2003, S. 221ff.). 20 Vgl. Roth 2003, S. 141, hier allerdings nur in Bezug auf die Erforschung des auditorischen Cortex bei Primaten.

208

Christiane Heibach

abhängig von der Erweiterung seiner Funktionen stattfand und primär anatomischen Notwendigkeiten folgte, sich nämlich an die sukzessiv zunehmende Größe der Säugetiere anpasste (vgl. Roth 2003, S. 82, Zitat S. 87) oder „unspezifische[n] Wachstumsprozesse[n]“ folgte: „Der Mensch hat also keineswegs einen besonderen Cortex bzw. präfrontalen Cortex, weil er diesen dringend benötigte. Vielmehr erhielt er ihn ‚umsonst‘ geliefert, weil – aus bisher ungekannten Gründen – sein Gehirn stark wuchs.“ (S. 87). Das Modell, das von Roth und Emrich, teilweise auch von Cytowic vertreten wird, nach dem das Gehirn arbeitsteilig und modular funktioniert, wird jeweils unterschiedlich interpretiert: Während Roth z.B. eine Wechselwirkung zwischen Verstand und Gefühl bei der Konstituierung von Bewusstsein annimmt und je nach zu bewältigender Problemlage mal das limbische (emotionale), mal das cortico-hippocampale („rationale“) System als dominant einschätzt (vgl. Roth 2003, S. 376), vertritt Cytowic die These, dass bisherige Modelle immer noch zu stark auf den traditionellen Dualismus von Ratio und Gefühl abheben und dass der Einfluss der Emotionen auf unser Bewusstsein kaum zu unterschätzen sei. Für Cytowic ist das Bewusstsein demnach „a type of emotion“ (Cytowic 2002a, S. 30), womit er gleichzeitig der Philosophie des Geistes den Kampf ansagt, die weitgehend Bewusstsein mit begrifflichem und implizit auch rationalem Denken gleichsetzt. Bei Synästhetikern ist das limbische System während der gesamten Wahrnehmungsprozesse überproportional beteiligt, woraus Cytowic schließt, dass diese solche Prozesse synchron bewusst wahrnehmen, die bei Nicht-Synästhetikern vorbewusst ablaufen. Demnach wären wir alle Synästhetiker und die Sinnesmodalitäten natürlicherweise inhärent miteinander verknüpft, nur sind wir uns dieser komplexen Prozesse nicht bewusst, sondern erkennen nur deren Ergebnisse, in denen Wahrnehmungen kategorial und analytisch voneinander getrennt werden. Für Cytowic liegt darin die Erklärung für ein Bewusstsein, das sich mitnichten nur aus sprachlich strukturierten Gedanken zusammensetzt, sondern ein komplexes Gebilde aus Unbewusstem, Vorbewusstem sowie aus emotionalen und rationalen Elementen darstellt – das Denken wäre demnach ein Resultat vorgängiger, uns nicht bewusster Interaktionsprozesse zwischen verschiedenen Gehirnarealen, die keine Hierarchisierung zwischen Gefühl und Verstand zulassen.

IV. Thesen über die Genese der Synästhesie Über den Ursprung der Synästhesie gibt es unterschiedliche Hypothesen, die sich aber gegenseitig auch nicht ausschließen. Es gibt genauso starke Indikatoren für die Vererbung der Fähigkeit zur Synästhesie wie für bestimmte frühkindliche Entwicklungsprozesse, die zur Synästhesie führen können. Vererbung scheint durch Beobachtung der Verwandtschaftsbeziehungen hin-

Durch Analyse zur Synthese

209

reichend als Grund für die Synästhesie belegt zu sein – insbesondere weitergegeben wird Synästhesie anscheinend von weiblichen Familienmitgliedern, wobei die Verteilung zwischen den Generationen unterschiedlich sein kann. Ungeklärt ist die Rolle der Sozialisierung bei der Fähigkeit zur Synästhesie: So gehen Forscher teilweise davon aus, dass Säuglinge per se synästhetisch veranlagt seien, da sie noch keine unterschiedlichen Sinneswahrnehmungen differenzieren können. Diese Koppelung von Sinneswahrnehmungen bliebe, so die These, bei Synästhetikern erhalten, während die meisten Menschen sie im Verlauf der weiteren Entwicklung, vor allem durch die Aneignung analytischer Fähigkeiten, „verlernten“. Ebenso wenig klar ist auch der Zusammenhang von frühkindlichen Erfahrungen und Synästhesie, wo möglicherweise Verknüpfungen erzeugt werden, die ein Leben lang halten.21 Teilweise aber kann sich Synästhesie auch erst später entwickeln, z.B. nach Verletzungen im Gehirn oder nach dem Verlust eines Sinnes, z.B. bei Erblindung, so dass hier eine Veränderung der Verbindungen im Gehirn durch äußere Einwirkung vermutet werden muss (vgl. Day 2006, S. 22f.). Die Bandbreite der Hypothesen spannt sich also von genetischen Faktoren zu einer Wechselwirkung von Veranlagung und kultureller Beeinflussung, die möglicherweise dadurch gestützt wird, dass die Dominanz der rein visuellen oder visuell-akustischen Synästhetiker ausgesprochen auffällig ist: Sean A. Day identifizierte unter 738 von ihm analysierten Synästhetikern 40 verschiedene Formen von Synästhesie, wobei die chromatisch-graphemische Synästhesie, also z.B. das Sehen farbiger Buchstaben, mit 33,46 % bei Weitem die häufigste war (vgl. Day 2006, S. 17–19). Neben der Dominanz visueller Synästhesien, die durchaus auch ein Resultat einer Sozialisation in einer weitgehend optischen Kultur sein könnte, genauso wie eines der dadurch geprägten selektiven Wahrnehmung der Wissenschaftler, ist auffällig, dass die chromatisch-graphemische Synästhesie nicht ohne den Erwerb der Kulturtechniken Lesen und Schreiben möglich ist. Sie kann sich demnach also erst verhältnismäßig spät manifestieren – einschränkend wäre allerdings anzumerken, dass viele dieser Synästhetiker auch über andere Synästhesien verfügen oder nicht nur Buchstaben, sondern z.B. auch Wochentage farbig sehen und ihnen emotionale Eigenschaften zuschreiben. Angesichts dieser verschiedenen Aspekte bleibt es jedoch nach wie vor eine offene Frage, inwieweit Synästhesie eine genetische und / oder erworbene Eigenschaft ist. Sie hängt eng mit der Frage nach der kulturellen Formierung unserer sinnlichen Wahrnehmung zusammen, wie Johann Gottfried Herder schon vermutete. Für ihn ist die Verknüpfung der Sinne eine Art „Urform“ des Wahrnehmens, die im Verlauf der kulturellen Entwicklung der Menschheit durch eine sukzessive Trennung der Sinne voneinander aufgehoben wird. Diese macht, so Herder, dann allerdings auch erst die analytischen Formen der 21 Vgl. zu einem Überblick über die verschiedenen Ansätze Gross 2002, v.a. S. 65–69.

210

Christiane Heibach

Erkenntnis und die Verständigung darüber möglich (vgl. Herder 1985, S. 744). Es liegt nahe zu vermuten, dass hier eine schwer aufzulösende Wechselwirkung zwischen genetisch-evolutionären Anlagen, wie sie durch die Existenz der diversen multimodal verarbeitenden Gehirnregionen nahe gelegt werden, einerseits, und kultureller Prägung durch die Aneignung von sozial dominanten Wahrnehmungs- und Erkenntnisformen andererseits vorliegt, die kaum mehr getrennt voneinander betrachtet werden können.

V. Zu den Wechselwirkungen zwischen Naturwissenschaften und kulturellen Phänomenen Die unterschiedlichen Erklärungsmodelle über die Genese der Synästhesie verdeutlichen die Schwierigkeit, vor der wir stehen, wenn wir uns in eine Entweder-Oder-Situation in dem Sinne hineinbegeben, dass wir Natur und Kultur als Opposition einander gegenüberstellen – eine Opposition, die sich auf verschiedenen Ebenen spiegelt und bis in die Modelle vom Gehirn reicht, wenn Ratio und Emotion unterschiedlichen Gehirnarealen zugeordnet werden, deren Wechselwirkung sich bis heute gesicherten Erkenntnissen entzieht. Nach wie vor dominiert in der neueren Kognitionsforschung das Modell der getrennten Sinneswahrnehmungen, deren jeweilige Verarbeitungsareale man im Gehirn zu lokalisieren versucht. Demgegenüber sind die Sinnesverbindungen und die multimodal verarbeitenden Areale in ihrer Funktionsweise noch ein großes Rätsel. Gleichzeitig zeigt sich, dass trotz aller avancierten Mess- und Beobachtungsmethoden unterschiedliche Interpretationsmodelle über die Funktionsweise des Gehirns existieren, was auf ein gerüttelt Maß an Unsicherheiten bei der Auslegung der Daten verweist. So zeigt gerade die in den letzten Jahren wieder heftig aufgeflammte Diskussion über die Konstituierung des Bewusstseins, des Willens und anderer humanistischer Kernbegriffe, wie viel Interpretationsspielraum trotz verbesserter Technologien auch in naturwissenschaftlichen Untersuchungen noch vorhanden ist, zumal die eingesetzten bildgebenden Verfahren gerade in den Kognitionswissenschaften einen hochartifiziellen Charakter haben und nicht so sehr „objektiven“ Abbildung gleichkommen, sondern vielmehr technische Konstruktionen mit entsprechenden Fokussierungen sind.22 In diesem Zusammenhang stellt sich auch die Frage, inwieweit die konstruktivistische Auffassung von Wahrnehmung tatsächlich die Interpretation der Mess- und Beobachtungsdaten prägt und so ein Verständnis von der Funktionsweise des Gehirns erzeugt, das unter anderen Prämissen möglicherweise ganz anders aussehen würde. 22 Vgl. z.B. die Schilderung der verschiedenen bildgebenden Verfahren in Emrich et al. 2002, S. 46f., sowie bei Roth 2003, S. 124ff., die zudem deutlich machen, dass jedes Verfahren nur einen Teilaspekt berücksichtigen kann.

Durch Analyse zur Synthese

211

Darüber hinaus macht die Schwierigkeit, synthetisierende Phänomene, wie z.B. das Zusammenspiel der Sinneswahrnehmungen und ihrer Verarbeitung im Gehirn, adäquat zu erklären deutlich, dass es möglicherweise über die analytisch vorgehenden Differenzierungen hinaus nun eines Modells von Syntheseprozessen bedarf. Gerade Synästhesie ist ein Phänomen, bei dem die Kognitionswissenschaften derzeit noch an ihre Grenzen stoßen, möglicherweise auch, weil sie von einer Trennung der Sinneswahrnehmungen ausgehen und diese im Gehirn aufzuspüren versuchen. In einer Zeit, in der Multimedialität ein Alltagsphänomen und damit multisensorielle Wahrnehmung umso mehr zu einem erklärungsbedürftigen Prozess wird, braucht man möglicherweise zusätzlich zu den analytischen Programmen auch synthetisierende, die nicht mehr trennen, sondern zusammen denken.23 Vor dem Hintergrund dieser interpretativen Prägungen und Spielräume der empirischen Wissenschaften empfiehlt sich entsprechende Vorsicht bei der Übertragung naturwissenschaftlicher Modelle auf kulturelle Phänomene. Die Wissenschaftsgeschichte hat in zahlreichen eingehenden Untersuchungen immer wieder auf den Wandel von Begrifflichkeiten, von wissenschaftlichen Paradigmen und Auslegungsmustern hingewiesen und sie in ihre spezifischen kulturellen Formationen eingeordnet. Wie Sigrid Weigel in ihrer Analyse der Entstehung der Evolutionstheorie und ihrer Wechselwirkung mit geisteswissenschaftlichen Untersuchungsfeldern deutlich herausarbeitet, lässt sich dabei eine Vielfalt möglicher Übertragungen von einem Bereich in einen anderen beobachten, wobei immer im Blick zu behalten ist, dass alle Erklärungsmodelle ihre Grenzen haben: So liegt für Weigel der erkenntnisfördernde Aspekt bei der Adaption evolutionstheoretischer Modelle auf kulturelle Phänomene vor allen Dingen darin, dass sie in erster Linie zur Analyse von hoch standardisierten kulturellen Situationen, Codes und Verhaltensformen eingesetzt werden können, hier allerdings durchaus auch – wie in der systemtheoretischen Modellierung von „Evolution“ – gravierende Bedeutungsveränderungen erfahren (vgl. Weigel 2006, S. 195, 203ff.).

VI. Fazit Wenn die Geisteswissenschaften sich also neuerdings wieder stärker nach naturwissenschaftlichen Modellen sehnen, um ihre eigene, durch die kulturwissenschaftlich motivierte Selbstreflexion in den letzten Jahrzehnten sukzessiv gesteigerte Unsicherheit über ihre Theorienbildung und die Unwägbarkeiten 23 Dies zeigt sich auch an neueren kulturphilosophischen Überlegungen, die sich so diffusen Phänomenen wie der Atmosphäre widmen, wie Gernot Böhme dies seit Jahren tut (vgl. Böhme 2001). Auch er stößt dabei an die Grenzen der Beschreibbarkeit und muss immer wieder auf die analytisch trennenden Kategorien der traditionellen Philosophie zurückgreifen.

212

Christiane Heibach

multiperspektivischer Betrachtung auf sichereren Boden zu stellen,24 so laufen sie Gefahr, die große Errungenschaft der beständigen Hinterfragung ihrer Forschungsgegenstände und Vorgehensweisen einer Chimäre der scheinbaren Sicherheit zu opfern. Gerade die Kognitionsforschung ist durchaus ein Kind ihrer Zeit und in Teilen geprägt von der Dominanz des Konstruktivismus als erkenntnistheoretisches Paradigma in den letzten Jahren. Sie hängt nicht zuletzt mit der Entwicklung der neuen Medien und der damit verbundenen Kybernetik zusammen und verweist so auf die Notwendigkeit des Bewusstseins darüber, dass auch naturwissenschaftliche Forschung auf Theorien aufbaut, die wiederum auf kulturell geprägten Interpretationsmustern beruhen. Gleiches gilt für die Synästhesieforschung zu Beginn des 20. Jahrhunderts: Auch sie basiert auf vorgängigen Denkmodellen und entwickelt sich entsprechend den kulturellen Bedürfnissen ihrer Zeit zu einer „Synthese-Wissenschaft“, jedoch ohne dass dieses Programm jemals wirklich eingelöst werden konnte. Derartige Prägungen bestimmen die Theorienbildung, aber auch die Fragestellungen, mit denen an die jeweiligen Phänomene herangegangen wird – ganz zu schweigen von den jeweils eingesetzten Mess- und Beobachtungsinstrumenten. Die Adaption naturwissenschaftlicher Theorien und Erkenntnisse auf kulturelle Prozesse und Phänomene mag in manchen Fällen tatsächlich fruchtbar sein, auch wenn notwendige Vorsicht geboten ist bei der möglichen Metamorphose von Begrifflichkeiten, die bei einer solchen Übertragung häufig auftreten. Auf eine Hinterfragung der Reichweite und der Grundannahmen naturwissenschaftlicher Erkenntnisse, Theorien und Modelle sollten aber gerade die Geisteswissenschaften nicht verzichten. Sie werden, um ihre Relevanz zu sichern, auch in Zukunft nicht umhin kommen, auf den Errungenschaften der letzten Jahrzehnte aufzubauen und den Methoden- und Theorienpluralismus zu verteidigen, wollen sie nicht Opfer einer zwanghaften Komplexitätsreduktion und einer damit verbundenen Verengung des Blicks, ja schlimmstenfalls einer Ideologisierung werden. Eher wird durch einen aufmerksamen, aber durchaus den jeweiligen unterschiedlichen Ausgangspositionen und Prämissen gegenüber Aufmerksamkeit zollenden Austausch zwischen Natur- und Geisteswissenschaften die Stärke der Letzteren manifest: die Möglichkeit einer kritischen Analyse von Grundprämissen durch die Stärkung des Bewusstseins über den historischen Charakter naturwissenschaftlicher Forschung auf den verschiedenen Gebieten. Auch wenn es kaum möglich ist, sich jenseits der eigenen Denkmuster zu stellen, so kann zumindest die Erkenntnis über die Geschichtlichkeit der Wissenschaften die gebotene Vorsicht im Umgang mit derzeitigen Tendenzen bieten, ebenso wie ein Perspektivenpluralismus eine einseitige Veren24 So zu beobachten beispielsweise in manchen Diskussionen der Sektion 3 „Kognition und Kommunikation“ auf dem Deutschen Germanistentag in Marburg 2007.

Durch Analyse zur Synthese

213

gung des Blicks verhindern kann – und diese Rolle des Advocatus diaboli sollten sich die Geistes- und Kulturwissenschaften nicht nehmen lassen.

Literaturverzeichnis Anschütz, Georg, „Untersuchungen zur Analyse musikalischer Photismen (Sonderfall Paul Dörken)“, in: Farbe-Ton-Forschungen, hg. von G. Anschütz, Bd. 1, Leipzig: Akademische Verlagsgesellschaft, 1927, S. 3–65 (= 1927a). –, „Untersuchungen über komplexe musikalische Synopsie (Sonderfälle Max Gehlsen, Hugo Meier und Dr. H. Hein)“, in: Farbe-Ton-Forschungen, hg. von G. Anschütz, Bd. 1, Leipzig: Akademische Verlagsgesellschaft, 1927, S. 67–209 (= 1927b). –, „Vorwort“, in: Farbe-Ton-Forschungen, hg. von G. Anschütz, Bd. 1, Leipzig: Akademische Verlagsgesellschaft, 1927, S. III–VII (= 1927c). Baron-Cohen, Simon / John E. Harrison (Hg.), Synaesthesia: classic and contemporary readings, Cambridge, MA: MIT Press, 1997. Böhme, Gernot, Aisthetik. Vorlesungen über Ästhetik als allgemeine Wahrnehmungslehre, München: Wilhelm Fink, 2001. Condillac, Etienne Bonnot de, Abhandlung über die Empfindungen [1754], Hamburg: Felix Meiner, 1983. Corbin, Alain, Pesthauch und Blütenduft. Eine Geschichte des Geruchs, Frankfurt/M.: Wagenfeld, 2005. Cytowic, Richard, Synesthesia. A Union of the Senses, Cambridge, MA: MIT-Press, 22002 (11989) (= 2002a). –, „Wahrnehmungssynästhesie“, in: Synästhesie. Interferenz – Transfer – Synthese der Sinne, hg. von Hans Adler und Ulrike Zeuch, Würzburg: Königshausen & Neumann, 2002, S. 7–23 (= 2002b). Daston, Lorraine, Wunder, Beweise und Tatsachen. Zur Geschichte der Rationalität, Frankfurt/ M.: Fischer, 2001. Daston, Lorraine / Peter Galison, Objektivität, Frankfurt/M.: Suhrkamp, 2007. Day, Sean S., „Was ist Synästhesie?“ in: Farbe – Licht – Musik. Synästhesie und Farblichtmusik, hg. von Jörg Jewanski und Natalia Sidler, Bern: Peter Lang, 2006, S. 15–30. Diaconu, Mădălina, Tasten, Riechen, Schmecken. Eine Ästhetik der anästhesierten Sinne, Würzburg: Königshausen & Neumann, 2005. Dilthey, Wilhelm, Der Aufbau der geschichtlichen Welt in den Geisteswissenschaften [1910], Frankfurt/M.: Suhrkamp, 1980, S. 101ff. Emrich, Hinderk / Udo Schneider / Markus Zeder, Welche Farbe hat der Montag? Synästhesie: Das Leben mit verknüpften Sinnen, Leipzig, Stuttgart: Hirzel, 2002. Flusser, Vilém, Ins Universum der technischen Bilder, Göttingen: European Photography, 1985. Foucault, Michel, Die Ordnung der Dinge. Eine Archäologie der Humanwissenschaften, Frankfurt/M.: Suhrkamp, 91990. Gebauer, Gunter, „Hand und Gewissheit“, in: Das Schwinden der Sinne, hg. von Dietmar Kamper und Christoph Wulf, Frankfurt/M.: Suhrkamp, 1984, S. 234–260. Gross, Sabine, „Literatur und Synästhesie: Überlegungen zum Verhältnis von Wahrnehmung, Sprache und Poetizität“, in: Synästhesie. Interferenz – Transfer – Synthese der Sinne,

214

Christiane Heibach

hg. von Hans Adler und Ulrike Zeuch, Würzburg: Königshausen & Neumann, 2002, S. 57–92. Heibach, Christiane, Multimediale Aufführungskunst. Medienästhetische Studien zur Entstehung einer neuen Kunstform, München: Wilhelm Fink, 2010. Herder, Johann Gottfried, „Abhandlung über den Ursprung der Sprache“, in: ders., Werke in zehn Bänden, Bd. 1: Frühe Schriften 1764–1772, hg. v. Ulrich Gaier, Frankfurt/M.: Deutscher Klassiker Verlag, 1985, S. 695–810. –, „Viertes Wäldchen“ [1769], in: ders., Werke in zehn Bänden, Bd. 2: Schriften zur Ästhetik und Literatur 1767–1781, hg. von Gunter E. Grimm, Frankfurt/M.: Deutscher Klassiker-Verlag, 1993, S. 247–442. Jewanski, Jörg, „Von der Farbe-Ton-Beziehung zur Farblichtmusik“, in: Farbe – Licht – Musik. Synästhesie und Farblichtmusik, hg. von J. Jewanski und Natalia Sidler, Bern: Peter Lang, 2006, S. 131–209. Jütte, Robert, Geschichte der Sinne. Von der Antike bis zum Cyberspace, München: C.H. Beck, 2000. Kamper, Dietmar / Christoph Wulf (Hg.), Das Schwinden der Sinne, Frankfurt/M.: Suhrkamp, 1984. Kandinsky, Wassili, Über das Geistige in der Kunst [1912], Bern: Benteli, 1973. Kant, Immanuel, Werkausgabe, hg. von Wilhelm Weischedel, Bd. 7: Kritik der praktischen Vernunft. Grundlegung zur Metaphysik der Sitten, Frankfurt/M.: Suhrkamp, 1974. Locke, John, Ein Versuch über den menschlichen Verstand, Bd. 3, übers. und erl. von J. H. von Kirchmann, Berlin: Heimann, 1872. Logothetis, Nikos K., „Vision: A Window into Consciousness“, in: Scientific American 16.3 (2006), S. 4–11. Mahling, Friedrich, „Das Problem der ‚Audition colorée‘. Eine historisch-kritische Untersuchung“, in: Archiv für die gesamte Psychologie 57 (1926), S. 165–301, wieder abgedruckt in: Farbe-Ton-Forschungen, hg. von Georg Anschütz, Bd. 1, Leipzig: Akademische Verlagsgesellschaft, 1927, S. 295–432. Marks, Lawrence E., „On Colored-hearing Synesthesia: Cross-modal Translations of Sensory Dimensions [Wiederabdruck von 1975]“, in: Synaesthesia. Classic and Contemporary Readings, hg. von Simon Baron-Cohen und John E. Harrison, Oxford, Cambridge, MA: Blackwell, 1997, S. 49–98. McLuhan, Marshall, Die Gutenberg-Galaxis. Das Ende des Buchzeitalters [The Gutenberg Galaxy, 1962], übers. von Max Nänny, Düsseldorf, Wien: Econ-Verlag, 1968. –, Die magischen Kanäle [Understanding Media, 1964], übers. von Meinrad Amann, Dresden, Basel: Verlag der Kunst, 1994. Osgood, C. E., „The Cross-Cultural Generality of Visual-Verbal Synesthetic Tendencies“, in: Behavioral Science 5 (1960), S. 146–169. Paczensky, Gert von / Anna Dünnebier, Kulturgeschichte des Essens und Trinkens, München: Orbis, 1999. Plessner, Helmuth, „Die Einheit der Sinne. Grundlinien einer Ästhesiologie des Geistes [1923]“, in: ders.: Anthropologie der Sinne, Frankfurt/M.: Suhrkamp, 2003, S. 7–315. Roth, Gerhard, Fühlen, Denken, Handeln. Wie das Gehirn unser Verhalten steuert, neue, vollständig überarbeitete Ausgabe, Frankfurt/M.: Suhrkamp, 2003. Shaftesbury, Untersuchung über die Tugend [1699], Leipzig: Felix Meiner, 1905. Steiner, Rudolf, Die Geheimwissenschaft im Umriss, Leipzig: Altmann, 1920.

Durch Analyse zur Synthese

215

Weigel, Sigrid, Genea-Logik. Generation, Tradition und Evolution zwischen Kultur- und Naturwissenschaften, München: Wilhelm Fink, 2006. Wiener, Norbert, Kybernetik. Regelung und Nachrichtenübertragung im Lebewesen und in der Maschine [1948], Düsseldorf, Wien: Econ-Verlag, 1963.

216

Jörg Thomas Richter

Phantoms in the Retroscape Remarks on Anglo-American Evolutionary Aesthetics around 1900 Jörg Thomas Richter

In the current emergence of evolutionary and cognitive approaches to art, concepts and terms notorious in the decades around 1900 have sprung to a remarkable afterlife. To give but a few examples: The idea that art functions as “cognitive play”, as “stimulus and training for a flexible mind” that “produc[es] options not confined by the here and now or the immediate and given” (Boyd 2009, pp. 85ff.) is more than a remote echo of positions that have been argued by Karl Groos and James Mark Baldwin a century earlier, discounting Friedrich Schiller’s even earlier take on the idea, which fed into Herbert Spencer’s theory of beauty. Baldwin, for instance, conceived aesthetic experience as a mode of cognitive “semblant experimentation.”1 Likewise, Steven Pinker’s idea that art emerged only as an evolutionary by-product has been well argued at the time. Even the title of the new discipline, “literary Darwinism”, can be traced back to the period. The earliest reference I found was in Alastair Mackenzie’s The Evolution of Literature (1911) where it is used to derogate the (already then impending?) substitution of anthropological theory for biology-based reasoning in literary studies. “If biology is to be put on the same plane as anthropology”, writes Mackenzie, “then scientific literary criticism becomes literary Darwinism, totally inadequate for the explanation of human activities.” (Mackenzie 1911, p. 392). Most strikingly, Edward O. Wilson’s attempt of a sociobiological consilience between the humanities and evolutionary biology must have been well entertained in the earlier period. This much is indicated, for instance, in Malcolm Guthrie’s 1882 rejection of the idea as an “act of mental despair” (Guthrie 1882, p. 18), or, in the same year, in the famous debate between Matthew Arnold and Thomas Henry 1

The work of Charles Darwin’s friend and collaborator John George Romanes, of Karl Groos, of James Mark Baldwin goes largely unreferenced, even though all of them were scientists of international renown in the earlier period who boldly sought to integrate animal ethology, experimental psychology, philosophy of mind to the explanation of aesthetic behaviour (cf. von Lange 1901, esp. chap. 15; Groos 1898; Groos 1901). For a short contemporary overview see the lemma “Play” in: Baldwin 1902a, pp. 303f.

Phantoms in the Retroscape

217

Huxley, a debate that has obnoxiously went on up to the famous “SnowLeavis Rumpus” about the Two Cultures in 1959 and that does still enjoy an eerie presence in recent arguments between so-called cultural constructivists and neo-naturalists.2 To some extent, the conceptual analogies between the periods create a peculiar epistemic retroscape, alive with a set of phantoms I will let loose only in the conclusion of my paper. A “retroscape”, if I may borrow a term from economic research here (cf. Brown and Sherry 2003), is an environment wherein old uses of a concept enjoy / suffer a phantomatic presence within a quite different, temporally removed epistemic environment. Given this temporal remove, it should be clear that my invocation of the retroscape does not necessarily imply a statement about the epistemic validity of the concepts in question. In the following essay I will abstain from any such commentary. Instead, it is worth noting that the re-emergent concepts do never quite match their earlier emanations. Despite apparent analogies, these conceptions can hardly hide the radically different epistemological configurations that divide the different times. In the century between the first evolutionary approaches to art and its current formation, entire thought-collectives and thought-styles have changed significantly.3 A number of then dominant concepts have become obsolete, like the influential Haeckelian monition that ontogeny recapitulates phylogeny. Lamarckian ideas of inheritance were variously ruled out and in again. Instead of a cognitive theory of the mind, philosophy of mind was important. And though the scientific study of genetics may have referred to Mendelian principles after 1900, it had not yet identified the underlying molecular processes. Nor had cybernetics been employed in biological modelling, nor was the technology available to study neuronal processes, nor were the disciplines as professionally established as they are today, and so on and on. What we observe then in the current methodological retroscape is the preservation of conceptual analogies rather than identities. This, however, does not mean that these analogies do not bear some consequences for current research. They retain a number of earlier denotations within current accounts: the fear of biogenetic determinism, the ethnocentric implications that haunt any talk about aesthetic universals, especially if set on a psycho-physiological plane, the over-pronounced projection of binary oppositions between cultural theorists and evolutionary theories.

2

3

Cf. Putt 1963. For brief surveys see Levin 1965; Porter 1996. A concise pre-history of the debate is provided in Jahoda 2002a. Though Snow first took his prime examples for the notorious illiteracy of humanities scholars in the natural sciences from thermodynamics, by 1963 he had already integrated molecular biology, seeing it as a field where “painters and sculptors could be instantaneously at home” (Snow 1998, p. 73). On thought-style and thought-collective, see Fleck 1980.

218

Jörg Thomas Richter

The following argument is based on yet another observation: even seemingly context-independent terms like play and cultural evolution were not employed for the same argumentative purpose in the earlier period. Evolutionary approaches to art and literature were devised not in the embrace but in the rejection and modification of biological evolution theory. In this essay I will focus on how earlier evolutionary and adaptationist art theories negotiated their position towards (often: non-) Darwinian biological theory. Preliminary as it is, my argument implies on a science-historical plane that literary Darwinism actually does have a century old tradition within the humanities – even if, at the turn of the century, it emerged as a reject. I hope to demonstrate that evolutionary criticism was neither entirely ignored by nor exorcised from the humanist academy (if there ever was such a monolithic institution). At the fin de siècle, it might have been well at the heart of it, be it in the guise of positivist, progressivist or eugenic thought (cf. the essays in Cuddy and Roche 2003). Given the wide impact evolutionary theory had in the last third of the nineteenth century, it hardly comes as a surprise that literary critics have widely responded to the explanation of life through Charles Darwin’s and Herbert Spencer’s dynamic bioeconomical model. Rather than carving out a deep fissure between literary criticism and biology, I wish to argue here that the theory of evolution has actually been firmly integrated within that specific field of the humanities. As Philip Sarrasin has provocatively put it in a recent book, Michel Foucault is an heir of Darwin (cf. Sarrasin 2009, p. 9).4 In order to work out this impact I proceed in three steps: first, I will more generally comment on the socio-evolutionary compromise that was proclaimed in the contemporary sciences of life, especially in evolutionary psychology and philosophy. I will then sketch some of the theories that provided an explanation of the role of art within evolutionary process, of how literature came into being as a human behaviour. Finally, before I conclude, I will turn to the literary theory of the time and its adaptations of evolutionary models to their specific field.

I. Socio-Evolutionary Compromise The period around 1900 is significant for the creation of today’s retroscape for a number of reasons. What was formed then, and what has re-emerged, if not persisted up to today in various critical undercurrents, is the socio-evolutionary comprise, i.e., the extension of evolutionary, not necessarily: Darwinian theory to all aspects of human life, including socio-cultural, moral, political and, of course, aesthetic dimensions. The adoption of scientific method 4

An earlier, though less elaborate, version of Sarrasin’s argument is Atterton 1994.

Phantoms in the Retroscape

219

in cultural reasoning was part and parcel of what Christopher Norris called the “Unity of Science movement” (cf. Norris 2006, p. 451). In addition, the period is significant, because already then the evolutionary approach to life was properly historicised. In approaching the fiftieth anniversary of Charles Darwin’s The Origin of Species as it was widely celebrated in 1909, first estimates were made on the effects Darwin had on the humanities at large and on literary criticism in particular. Given the diversity of evolutionary theories at the time, the socio-evolutionary compromise is perhaps best described by a minimal convergence in a positivist model of reality that interpreted every feature of human life in terms of a long, transformational process of (biological and / or social and / or cultural) transmissions with an open teleology. At least, this perhaps too minimal and general model could agree with the model the contemporary historians of the Darwinian impact on the humanities stressed at the time. Confronted with the contemporary turn to positivist scientific methodology, the humanities partially adopted an evolutionary “point of view” that demanded to re-conceptualise human culture within natural developmental process. Ideally, the nature-culture divide would eventually dissolve in a new comprehensive and scientifically oriented focus on life (cf. Fullerton 1909).5 The integration of an evolutionary position did not necessarily result in the acceptance of the biological format given by Darwin. To be sure, American evolutionary psychology was established as a branch of academic psychology already in the 1890s (cf. Stanley 1895).6 But even those psychologists who fell in with the approach conspicuously extended or modified the model. As John D. Greenwood has shown in a recent article, the response of early American psychologists to Darwinian evolutionary theory has been ambiguous at best, often resulting in the circumvention of the physiological and hereditary determinism implicit in the Darwinian model (cf. Greenwood 2008). Darwinian premises purportedly formed the groundwork of theories that actually sought quite extra-Darwinian aims. The psychologist George Fullerton, for instance, saw in the “modern view of the mind” a clear indicator of the new scientific status given to psychology. Under psychological lead, the scientific synthesis would draw together biological, anthropological, sociological and cultural enterprises. Biological findings, in other words, are taken as contributions to the more eminent, psychological and sociological field. Likewise, James Mark Baldwin, one of the founding 5

6

John Dewey characterises the period by “[t]he conquest of the sciences by the experimental method of inquiry; the injection of evolutionary ideas into the study of life and society; the application of the historic method to religions and morals as well as to institutions; the creation of the sciences of ‘origins’ and of the cultural development of mankind” (cf. Dewey 1910, p. v). Evolutionary psychology was re-invented in a modified form with Ghiselin 1973. Recently, Henri C. Plotkin (2004) has also rediscovered the earlier efforts in the field.

220

Jörg Thomas Richter

figures of experimental and developmental psychology in the U.S., proclaimed that “[t]he reign of physical science and of mechanical law over the scientific and philosophical mind is over now […]” (Baldwin 1909, p. 88). Like many others in the period, he combined the Darwinian model with findings from experimental psychology and philosophical inquiry to extend evolutionary theory from biology to psychology, from there to the social sciences, to ethics, logics and aesthetics. Though firmly set within the Darwinian paradigm, especially his theory of “organic selection” (today known as the Baldwin Effect), proposed an evolutionary mechanism that programmatically opened up room for theoretical rather than experimental psychology, for the analysis of “social heredity” rather than biological heredity. Indeed, what he aimed to shape were “the sciences of life and mind [emphasis; J. T. R.]” (Baldwin 1909, p. ix) by underscoring not only the consequential “life history” of single organisms within a population-based model of phylogeny (cf. Baldwin 1906, pp. 166f.), but also the power of their life-historically developed habits and adaptive behaviours to modify the course of their species’ evolution. Baldwin would insist on the evolutionary origin of human cognition, yet he maintained as well that, with increasing mental plasticity, individual organisms would relate interactively to their environment to a degree that eventually exempted human organisms from natural selection and made them subject to social selection (cf. Greenwood 2008, pp. 113ff.). On safe Darwinian ground, Baldwinian selection was in fact one way out of the hereditary determinism advanced by contemporary neo-Darwinists like August Weismann. Philosophically, other options were possible, too, without resorting to teleological design arguments or metaphysics. Thus, John Dewey certainly acknowledged Darwinian evolution as a welcome turn “from the wholesale essence […] back to the question of how special changes serve and defeat concrete purposes”. He was convinced that one needs to observe the “shifts from an intelligence that shaped things once for all to the particular intelligences which things are even now shaping; shifts from an ultimate goal of good to direct increments of justice and happiness that intelligent administrations of existent conditions will destroy or forego” (Dewey 1910, p. 15). But his broad affirmation of Darwin’s The Origin of Species actually attributes the significance of Darwin’s biological theory to the particular train of thought it set off in the human sciences. This much at least is indicated by Dewey’s cunning retranslation of the biological term species into Aristotle’s term είδος (p. 5): the dynamics within biological categories find their “real” import in the dynamics of mental, ideational life. Again, as in Baldwin, the study of biological evolution is supplanted by the focus on mental development. In their take on biological evolution theory, pragmatists certainly acknowledged the setting of mind in its environment. Like early evolutionary psychologists, they did not deny its

Phantoms in the Retroscape

221

evolutionary origins within a determinist structure, but, to the annoyance of a host of biological extensionists, they emphasised its instrumental potential as an interventionist force.7

II. From Surplus to Semblance: Physiological and Evolutionary Aesthetics The creative ambivalence of contemporary sociologists, psychologists and philosophers towards biological evolution is mirrored in the development of evolutionary aesthetic models. Though quite effective in explaining cultural transformational dynamics, these were not necessarily grounded in hereditarian theory nor were they at ease with neurophysiological reasoning. As already Nancy Aiken has observed, Grant Allen was one of the earlier figures who integrated art into an evolutionary as well as neurophysiological framework (cf. Aiken 1999, pp. 419f.). Though being more a man of letters than of science, Allen was well read in contemporary psychological and evolutionary literature. In his Physiological Aesthetics, dedicated to Herbert Spencer, he draws on the findings of physiological psychology to explain mental activity as an operation primarily within the nervous system. Based on this, he develops a theory where works of art effect pleasing sensations in the nervous system. Pleasure would indicate the “healthy state of the organism” (Allen 1877, p. 21). Pleasurable emotion marks the “consensus between the organs” (Allen 1880, p. 29) even in animal life. In such a healthy state, the individual would “gratif[y] his motor system” in free play. In addition, the proto-aesthetic capacities an animal needs for distinguishing between edible and inedible food also anticipate the more complex aesthetic functions needed in the selection of a healthy mate; and attractive mates were those that adopted the attributes and ornaments pertinent to their food. According to Allen, this basic form of aesthetic perception is controlled by inherited, innate cerebral structures that automatically respond to a given stimulus in regard of its nutritional value and worth for successful reproductive performance. In this vein, the beautiful could be defined as “the healthy, the normal, the strong, the perfect, and the parentally sound” (Allen 1880, p. 449).8 Art as human behaviour could possibly be traced back to these roots in the economy of natural and sexual selection. Nevertheless, Allen refers to chance as soon as he has to account for the increasing complexity of art aside from such reduced evolutionary function (of course, 7 8

On the pragmatist adaptation of Darwinian evolution see Wiener 1949; Hawkins 1997, pp. 104–124; and most recently, Popp 2007. Aside from Darwin’s Descent of Man, such an argument could refer to Herbert Spencer’s essay on “On Personal Beauty”, at least, these are the two prime references one finds in Allen’s work.

222

Jörg Thomas Richter

chance is a perfectly reasonable evolutionary “force”). Thus, the gratification of the motor system through play may have resulted in the scrawling of desirable things. Through the “fortuitous incident”, these first creative scrawls would be appreciated within the scrawler’s community for their similarity to desirable things encountered in the life world, that is, they would be appreciated by their likeness to nourishing food and healthy reproductive partners (cf. Allen 1877, p. 221). On the foundation of this model in both play as well as natural and sexual selection, yet only by virtue of their fortuitous cultural take-off moment, the primitive beginnings could develop along various stages: the phase of “personal decoration” (Allen 1880, p. 451) is succeeded by the advent of handicraft applied to weapons, then follows the decoration of the home on a third stage, until eventually art and painting is used in adorning the houses of religious and tribal leaders, which finally leads to the fixed ties between art and religion in Christianity. In short, what the springs of art as well as their evolutionary development demonstrate is a process of apanthropinization: a gradual regression or concentric widening of the aesthetic feeling around [sexual selection] which remains to the very last its natural centre. By the common consent of poets, painters, sculptors, and the world at large, the standard of beauty is still to be found in the features and figure of a lovely woman (Allen 1880, p. 451)

– of a dead, lovely women, as Edgar Allan Poe would immediately have objected. Literature, in this scheme of widened sexual appeal through the symbolic showing off of reproductive health likewise first celebrates the personal features of the hero in primitive narrative, before it differentiates into further genres like lyric and descriptive verse. Allen, though establishing an aesthetics that would meet the lush eroticism in neo-classicist painting, is content with providing a retrospective explanation of art. Others, like the psychologist Colin Scott of Clark University, explained art not just in regard to its evolutionary origins and neurophysiological determinations. His influential essay “Sex and Art” explicitly focuses on the regenerative potential of aesthetics within (a latently degenerative) cultural evolution. Like Allen, Scott was convinced that “the somatic resonance of art is sex” (Scott 1896, p. 219). Aesthetic motives and sensibilities are instituted in the operations of the evolved nervous system, in the neuronal mechanisms that underlie sexual sensibility. The stimulation of this neuronal complex “irradiates” in a way that finally involves the whole nervous system. Sexual erethism, as he calls it, constitutes a mechanism of associations and transfers through which the making of art enters evolution. Besides the physiological mechanism, he also refers to sexual selection, and even more emphatically, to peer selection among males. After combat, “women become the prize of the conquerors, and sexual gratification, while participants are still under the influence of the fight, in most instances ensues immediately” (Scott 1896, p. 182). The transformation of victory into

Phantoms in the Retroscape

223

courtship ritual is combined with the notion of art as a sheer evolutionary surplus: the ecstatic display of overflowing vital energy. In this manner, art turns out as a response to a variety of evolutionary and physiological impulses, amongst which the sexual impulse dominates. Unfortunately, the primitive function of art is obscured by the cultural amelioration of the original natural selection process. Scott laments that the fundamental evolutionary usefulness of art has been lost in the course of further cultural evolution. Again, then, culture is perceived as a rupture in bio-evolutionary continuity. Contrary to Allen, however, Scott seeks to balance the impending threat of degeneration that results from the de-naturalization of evolution. He enlarges upon the cultural political potential of his theory in a Whitmanesque psychological manifesto: “What we need at present is a modern phallicism, a religious and artistic spirit that goes out to meet the sexual instinct, and is able to find in it the centre of evolution, the heart and soul of the world, the holy of holies to all right feeling men [my emphasis, J. T. R].” (Scott 1896, p. 198). Such remarkable calls for phallic liberation did not go unchallenged. Though Hiram M. Stanley, one of the major figures in turn-of-the-century evolutionary psychology, believed that “the love-call of beasts and the lovenote of birds culminate in the love-song of man” (Stanley 1897, p. 1)9, he still rejected Allen’s and Scott’s direct combination between sexual selection and art. Stanley fully accepted the notion that art needs to be seen as “an organ in the body of human culture and life” (Stanley 1897, p. iii). Yet even if so, aesthetic feeling is first of all a sui generis mode of sensual activity that can neither be reduced to sexuality, nor to the Spencerian play-impulse and ecstatic evolutionary surplus. Contrary to that, he makes the case that aesthetic sensibility actually originates in the pleasurable self-reflection of the senses. Because they are pleasurable in themselves, these sensory short circuits became an independent utility selected for its own sake. In so far, literary art is a phenomenon removed from bioeconomical restraints, it is, in contrast, “a direct communication of pleasant aesthetic emotion artistically conveyed,” a “survival of primitive pleasures” (Stanley 1895, pp. 323ff.). At least to my view, the most subtle take on art from an evolutionary psychological perspective came from James Mark Baldwin who, in his various endeavours in the fields of philosophy, biology, sociology and aesthetics, made art the crowning element of his “genetic logic”. Baldwin’s developmental psychology is too elaborated to allow a fair summary in just a few

9

Stanley’s love-song tradition has been kept alive in evolutionary literary criticism, as Frederick Turner states in a similarly poetic turn of phrase: “perhaps what created us as human beings was an improved love song” (Turner 1999, p. 121).

224

Jörg Thomas Richter

words.10 What needs to be pointed out, however, is that he saw cognitive plasticity, the capacity to learn and to transmit the learned behaviour to offspring, rather than neuronal hardwiring as the most fundamental route to securing an organism’s adaptation to and survival in a change-prone environment. According to Baldwin, evolution does not only proceed by selection upon arbitrary genetic variation but is to some extent guided by nongenetic processes. It needs to be understood as a process that combines “congenital characters with acquired modifications” (Baldwin 1909, p. 18). The individual organism adapts to a changing environment by coming up with a behaviour that allows the individual to keep alive under circumstances which it may not have been biologically programmed for. Through processes of imitation, the newly acquired behaviour may be transmitted horizontally to other individuals as well as vertically to offspring. Individuals and groups of individuals who have the capacity of learning the new knack will be favoured by selection – until eventually a random mutation secures the knack in heredity. Since this will again set free the learning capacities to other tasks, learning comes to “guide” evolutionary change. In this framework, play would prepare the organism to face environmental challenges in a virtual experience. And like play, art, or more precisely, aesthetic experience, provides for a similar unconstrained “as-if ”-mode of hypothesis testing, that in nuce underlies both scientific and aesthetic knowledge. By extending the evolutionary functions of make-believe, bluff and play as well as by enlarging upon the behavioural system of “imitation”, the aesthetic mode of thinking here serves as a mode of “semblant experimentation” (Baldwin 1911, p. 170). On top of this, the virtual use and interpretation of real life knowledge and values fosters cultural innovation, “looking forward to the systematization and extension to which their serious methods and purposes pointed” (ibid.). The aesthetic exploration of an as-if-experience, of virtual reality, is useful not only for the transmission of values but also for hypothesis building. It is especially effective since it suspends both social and epistemic controls, allowing the artist or interpretive audience of the artist an experience in the free play of ideals. Baldwin eked out these findings by the then available methods of psychological experimentation (chiefly time-reaction-experiments he learned with Wilhelm Wundt in Leipzig), of longitudinal observations of child development (he experimented on his two daughters in his “home laboratory”), of studies in logic and philosophy of mind – and much of it resonates in current theory, as I have already indicated above. Apart from that, Baldwin pursues a larger aim, for aesthetic experience also produces a higher level of consciousness, an ultimate perfection in 10 For selected psychological readings of Baldwin see Broughton and Freeman-Moir 1982. For biological, cognitive science and evolutionary interpretations of Baldwin see Weber and Depew 2003.

Phantoms in the Retroscape

225

cognition that would culminate in pancalism, a sort of yet unattained cognitive utopia, where aesthetic judgement is the principal goal and category of thought. Once more then, even for the staunch Darwinian Baldwin, biological and cognitive evolution resolves in a mentalist rather than naturalist realism. Though I cannot extend this rough sketch of early evolutionary psychology in the limited space of this essay, it may suffice to make the point that in spite or because of the Darwinian convictions, evolutionary psychologists argued that consciousness cannot be explained by biological process alone. For Baldwin, “social accommodation sets the direction of further change, and physical heredity is determined by this factor” (Baldwin 1902, p. 120). In this respect aesthetics served as a particularly useful field in early Anglo-American psychology to test evolutionary hypotheses. It became a well established position in the field up to 1920, that “[t]he common art forms are merely the result of the general modes of action which are bound to be developed in the course of adaptation of an organism like ours to the natural forces of a planet like the earth” (Langfeld 1920, p. 277). If some of these positions keep recurring in current endeavours, like in the work of Steven Pinker and Michael Tomasello, they do so on the basis that culture and the arts need to be seen within an evolutionary biological and cognitive framework. A century earlier very similar theories took the opposite argumentative course. For both Spencerian and Baldwinian evolutionists, biology belonged to the factors that made culture work. The concept of play was cherished because it offered a way out of rather than back in the determinism often implicit in biological evolution theories. In this respect, Baldwin cautioned that the theory of evolution is responsible for much of this cheap apology for science – biology used in sociology, physics in psychology, the concept of energy in history, etc. Evolution has been mistaken for reduction, the highest genetic modes being ‘explained’ in terms of the lowest, and much of the explaining done by ‘explaining away’ most that is characteristic of the highest. And biological or organic evolution itself is a storehouse of mistaken analogies brought over in the moral sciences. (Baldwin 1902, p. 334)

III. “Environment stored in symbolic form”: Literary Criticism around 1900 Given the high standing evolutionary theory enjoyed around 1900, it is no surprise that literary critics too adopted evolutionary models, particularly so since a Naturalist poetics had already swept contemporary literature. Indeed, whoever would like to look for the continuities of evolutionary literary criticism is well advised to research the criticism of the Naturalist novel (cf. Schnackertz 1992; Michaelis 2004). Granted also the budding interest of con-

226

Jörg Thomas Richter

temporary evolutionary psychology in the arts and literature, including the reservations I mentioned, it is no wonder that literary scholarship embraced evolution while it was actually shying away from the biological, neo-Darwinist explanations of their field. Still, they responded to the demand of establishing literary scholarship on a positivist basis of which evolutionary theory had become a major part. Their takes on literary history, however, still pay more than just lip-service to contemporary Darwinism, holding tight to the then conventional lines of cultural evolution as depicted in the works of Herbert Spencer, or, most importantly, in the work of French positivist critics, in particular Hippolyte Taine and Ferdinand Brunetière.11 Especially Brunetière seems to have enjoyed some prominence within the community of American literary critics. At the time, the New York Times did not only review his books, but also reported from Brunetière’s Lenox Lyceum-Lectures, where, though speaking in French, he must have attracted remarkably large crowds.12 By following the new positivist trend in literary criticism, critics underscored the strength of their own methods by insisting on their distinction from bio-evolutionary theory. Broadly accepting the evolutionary point of view, in most cases they still argued that the species that evolved was not only man, but along with her, literary form. And the evolution of literary expression was their field. In this manner Brunetière pleaded for the application of evolutionary modelling to literary phenomena, notwithstanding that “[o]ther critics maintain that Darwin’s theory is merely a hypothesis, and hence cannot be regarded as a criterion. True! But it is by far the best hypothesis we have […].”13 This, one might say, was a strong claim for as well as against the invasion of even the Baldwinian “sciences of life” into the literary field (cf. Hoeges 1980, p. 196). Hutcheson Macaulay Posnett is perhaps the most important case in point, for he is one of the founding figures of comparative literature in modern English literary criticism (cf. Aldridge 1986, pp. 39ff.). He does not only proclaim that he follows an evolutionary theory design – again, in the line of Spencer, not Darwin –, when he made “the relation of the individual to the group” the central principle of literary growth (cf. Posnett 1886, p. 72). This basic relation is subsequently determined by “the gradual expan11 French positivist literary criticism had a non-trivial impact on the critical scene both in Great Britain and the U.S. in the 1890s, when, in the combined reception of Hippolyte Taine, Ferdinand Brunetière and Herbert Spencer, literary scholars began to pay attention to race, milieu and moment in their analyses of literary texts. 12 “Literary men, professors of colleges, and clergymen touched elbows with Columbia students and schoolgirls anxious to gauge their ability to understand the French language as spoken by one of its distinguished masters”, reported the New York Times (29 April 1897) from Brunetière’s third lecture there. See also “M. Brunetière on History,” in: The New York Times (24 April 1897); and “Essays by Brunetiere,” in: The New York Times (30 July 1898). 13 The quote is from the report of Brunetière’s fourth Lenox-Lyceum lecture, “Influence of Criticism,” in: The New York Times (30 April 1897).

Phantoms in the Retroscape

227

sion of social life from clan to city, from city to nation, from both of these to cosmopolitan humanity” (p. 86). Surprisingly, Posnett’s grand view on the literatures of the world entails the denial of any evolutionary psychological claims to literary universals, for each of the stages brings with it its own environmental, social particularities. These are analysed best from the positivist standpoints of comparative linguistics, comparative anthropology and religion (cf. Leerssen 1984, pp. 90f.). Indeed, by cautious irony, he vents that “[t]here are, indeed, other standpoints, profoundly interesting, from which the art and criticism of literature may also be explained – that of physical nature, that of animal life” (Possnett 1886, p. 86).14 Posnett’s turn to “scientific” literary study, his embrace of positivist method and social evolution led him disqualify as “Romantic” the idea of literary universals as something “innate in the human heart or intellect as a kind of literary conscience” (p. 43). Literary forms materialise only relative to particular social milieus, any deduction of context independent super-qualities like innate responses to art, aesthetic pleasure functions do not relate to chronologically, culturally and geographically diversified literatures.15 What the adepts of universalism did, was for Posnett but the back-projection of only recently evolved universal elements within world literature that cover up their roots in very particular environments. Just for the record, then, the back projection of current art conceptions still seems to be one of the troubles in evolution historical art theories (cf. Lorblanchet 2007). A follower of Posnett, the professor of English and Comparative Literature at Kentucky State University, Alastair Mackenzie, termed the emerging literary science “Literatology” in his book The Evolution of Literature. His field of research is “that branch of anthropology which is commonly known as literature” (Mackenzie 1911, p. 392). To say the least, this is an intriguing repositioning of literary scholarship in at least two concerns: first, because literature is relegated to the realm of human behaviour; second, because literature (not: the study of literature!) turns into a medium of literal anthropological observation. The historical ironies that Posnett allows to thrive in the chronotopical heterogeneity of literary evolution take an eirenic turn for Mackenzie: In the anthropological sense, literature is valuable because, granted its literal meaning, it would allow to bring together cultural and scientific reflection in a splendid synthesis. In fact, he drew heavily on contem14 The qualification of something as “interesting” was already then a marked pronouncement of disinterest. 15 “But it is not so easy to grasp the facts that ‘literature’, far from enshrining universal forms and ideas of beauty, owes both its creative and critical works to the development of social life; that familiar general or special conceptions suggested by the word drop off one by one as we retrace the steps of such development; and that all our subtle literary distinctions finally disappear in the songs of those isolated clans and tribes whose fusion produced the people and the language of future art and criticism.” (Posnett 1886, p. 8).

228

Jörg Thomas Richter

porary evolutionary psychology and anthropology as well as physiological aesthetics to explain the beginnings of art in “primitive” dance and songs. He assumed, for example, that “[m]ental traits are moulded by interaction with social and physical environment”, and that consequently the “development of mankind differs from that of lower organisms in being essentially intellectual, in being collective rather than individual, and in modifying rather than being modified by physical environment” (Mackenzie 1911, p. 25). Only on these grounds could he insist that literature had its own evolutionary laws. These need to be kept distinct from those which humankind initially followed in its development to a literature-capable species. In human culture, as he found, biological laws such as sexual selection do not operate directly and are modified by cultural forces. And though he still follows Posnett in his impressive, world-encompassing lay-out of argument – the literatures of Africa and Ocenia, Asia, America and Europe are discussed in their development from “primitive dance” to “democratic” world literature –, Mackenzie argues in passing that there is indeed a universal typology of the epic, the lyric and the dramatic mode. Mackenzie went further than that also in another respect. Like already Aldridge observed, he saw it fit to conclude his amazing world history of literature in a few neat formulas (cf. Aldridge 1986, p. 66). There are three distinct laws at work. First, the “law of literary progress” is expressed in the formula A = S + W: “[A]verage literary advance” is the sum of “self-consciousness” and “world-consciousness” within a given community. The second law is the “law of initiative”, expressed in the formula P = I + C, that is: a “progressive literary step” results from the sum of “individuality” a given artist may possess and the “community’s readiness for the new discovery”, and finally, there is a third literary law, the “law of responsiveness”, L = R ± O, meaning that literary forms are developed in relation to the new work’s responsiveness regarding their social context and in relation to its orientation in regard to preceding literary forms (cf. Mackenzie 1911, p. 415). I am not sure whether or not Mackenzie actually wanted to create the odd ironic effect that does result from the reduction of a 400-page, highly discursive history of world literature to three rather simple mathematic equations. Nevertheless, they brilliantly effect the epistemic provocation Mackenzie sought: the formulae are expressive of the quest for measurable literary units, even if Mackenzie failed to actually provide quantifiable indicators for each of the addends. The works of Posnett and Mackenzie are but two examples that demonstrate how, especially in the light of the new “sciences of life”, evolutionary findings were integrated in literary studies on a less than analogical plane. Apart from this, the relation between literary studies and anthropological as well as evolution biological studies also led to far less moderate, racial interpretations that capitalised on the ethnocentric reduction of art to a specifically Western type. Scholars such as Hendrik Clemens Muller argued that

Phantoms in the Retroscape

229

biological and evolutionary distinctions between groups (and between the sexes) evinced the superiority of the Aryan literatures over the “Semite” tradition (cf. Muller 1904, pp. 136, 154 n. 1). But again, it was not just a question of conceptual analogy that intricately bound together evolutionary theory and literary studies. For John Preston Hoskins, “[t]he general notion of genesis combined with a functional view of consciousness are gradually obliterating the boundary lines that divided the compartments in the older theories of knowledge” (Hoskins 1909, p. 407). Hoskins rejected the literary-biological analogy only in as far as it set up a parallel between animal life and cultural life, for – so the typical argument – in culture, other evolutionary forces are moderating and overpowering biological principles such as natural selection or sexual selection. As he argues, so long as the theory of literary development rests on biological analogy and expresses its ideas in a biological nomenclature the function performed by personality in literary variation cannot be set in its true genetic relation to the other factors involved. […] The individual consciousness is in reality the key to the whole situation. (Hoskins 190, p. 411)

According to him, a work of art is “the product of psychic activity and the outcome of the social relations existing between men” (p. 412), pointing out that literature is “environment stored in symbolic form” (p. 415). For Hoskins, like for Baldwin and his followers, the arts and literature provide a transmission system within and beyond the Darwinian paradigm where, similar to the meme concept fashionable today, ideas struggle for survival in processes of imitative selection (cf. Thomson 1911, pp. 172ff.), a struggle, however, that is always interposed by an external force: the personality of the artist who is subject to the mental dispositions he acquired through his biological, social and cultural development.

IV. Conclusions: Phantoms Let Loose Regarding the presence of some of the above theories of art and literature in today’s research, it seems of little help to me to just ignore them.16 This is the more so since this frequent argumentative strategy accounts for at least some 16 Joseph Carroll (2007, here: p. 637), states quite plainly: “Adaptationist literary study has emerged as a distinct movement only within the last 15 years.” Yes, as a “distinct movement”, but not as a theory. Herbert Sidney Langfeld (1920, p. 277) is already late in observing that “[t]he common art forms are merely the result of the general modes of action which are bound to be developed in the course of adaptation of an organism like ours to the natural forces of a planet like the earth”. This is not to say that Carroll does not acknowledge that a number of social Darwinists and naturalist artists have taken up Darwinian thought in the earlier period. Yet according to Carroll, nobody had actually then included evolutionary conceptions in literary criticism with the notable exception of Hippolyte Taine (cf. Carroll 2004, pp. 46, 123). In other accounts, earlier criticism is simply absent, as in Boyd 2005; or it is likely to be dismissed as a racist endeavour, as in Boyd 2009, p. 21.

230

Jörg Thomas Richter

of the humanities’ resistance to evolutionary literary scholarship. Sometimes it seems to entrap even the new evolutionary discipline itself, particularly in cases where its scholars claim with a sharp sense for provocation that “Western achievements do in fact represent the highest level yet attained by any culture” and thus, though on an entirely different epistemic base, approximate earlier Eurocentric ideas (Carroll 2004, p. 5).17 One might call this phantom of the retroscape the figure of the nasty vestige or unrealised self-recognition. But beyond the ability to recognise such slips of the tongue the retroscape has other figures too, for it is certainly more than “humbling to note that many ‘new’ ideas reflect propositions offered over a hundred years ago” (Aiken 1999, p. 425).18 Figure two is the phantom of contorted synthesis. As I have tried to show in my incomplete, admittedly preliminary and very reductive panorama of evolutionary aesthetic thought around 1900, this particular retroscapic figure has hypotheses that are vibrant in today’s evolutionary and cognitive aesthetics function in the guise of humanist checks against the biological rationalisation of life, against what biologists then termed The Control of Life without any Foucaultian tongue in cheek (cf. Thomson 1921). If these checks are now taken over by evolutionary and cognitive science, this is just among the least reasons to give up critical culturalist theory. It would perhaps loose the scientific import it acquired as a non-quantitative, often subjective, discursive and stubbornly non-scientific form of research and become, indeed, just another branch of anthropology or evolutionary science in the way Mackenzie has fantasised earlier on. In this respect, so I think, what the observation of the retroscape calls for is the further constructive (rather than deconstructive) reflection of the new sciences, a “cooperation in difference” (cf. Weigel 2004) between the various cultural and scientific modes of erudition in the study of human life. And though most certainly further figures will lurk in that closet, I choose but one more to close this paper: the ghost of schisms past. As has been frequently shown, evolutionary thought did not begin with Darwin. It had a lively history in the genealogical methods within natural philosophy already before biology seized upon it and developed its own branch of evolutionary theory – methodologically rich in quantitative analysis, experimental design etc. Like the time around 1900 demonstrates, this did not mean that the older branches turned suddenly into dry wood. Especially genealogical thought has bloomed, from literary influence studies in comparative literature up to Michel Foucault’s genealogy of knowledge. The evolution of literature as an evolution of forms and structures has been observed in the still alive formalist schools that followed Russian formalism. Psychological studies in culture, in as far as they relate to Sigmund Freud and 17 The sentence is quoted in a particularly provocative review essay by poet Deresiewicz (2009). 18 In a similar manner, Gustav Jahoda (2002b) complains about the historically under-informed use of the meme-concept.

Phantoms in the Retroscape

231

followers, have kept evolutionary perspectives within their fundamental theories. Social systems theory is another successful branch within sociology etc. This is to say that the idea of consilience is a rather utopian one, or even more precisely, a rather nostalgic and particularly devolutionary perspective on scholarly and scientific differentiation processes. The 1900s won’t come back. They are with us – like a couple of even earlier periods.

References Aiken, Nancy E., “Literature of Early ‘Scientific’ and ‘Evolution’ Aesthetics,” in: Biopoetics. Evolutionary Explorations in the Arts, ed. by Brett Cooke and Frederick Turner, Lexington: ICUS, 1999, pp. 417–431. Aldridge, A. Owen, The Emergence of World Literature: A Study of Asia and the West, Newark: University of Delaware Press, London, Toronto: Associated UPs, 1986. Allen, Grant, Physiological Aesthetics, London: King, 1877. –, “Aesthetic Evolution in Man,” in: Mind 5.20 (1880), pp. 445–464. Atterton, Peter, “Power’s Blind Struggle for Existence: Foucault, Geneaology and Darwinism,” in: History of the Human Sciences 7.4 (1994), pp. 1–20. Baldwin, James Mark (ed.), Dictionary of Philosophy and Psychology. vol. 2, New York, London: Macmillan, 1902 (= 1902a). –, Development and Evolution, Including Psychophysical Evolution, Evolution by Orthoplasy, and the Theory of Genetic Modes, New York, London: Macmillan, 1902 (= 1902b). –, Mental Development in the Child and the Race [1895], New York: Macmillan, 31906. –, Darwin and the Humanities, Baltimore: Review Publishing, 1909. –, Thoughts and Things: A Study of the Development and Meaning of Thought, or, Genetic Logic. vol. 3: Interest and Art, Being Real Logic. I. Genetic Epistemology, London: George Allan, 1911. Bowler, Peter J., Evolution: The History of an Idea, Berkeley, Los Angeles: University of California Press, 1983. –, The Eclipse of Darwinism: Anti-Darwinian Evolution Theories in the Decades around 1900, Baltimore, London: Johns Hopkins UP, 1993. Boyd, Brian, “Evolutionary Theories of Art,” in: The Literary Animal: Evolution and the Nature of Narrative, ed. by Jonathan Gottschall and David Sloan Wilson, Evanston: Northwestern UP, 2005, pp. 147–176. –, On the Origin of Stories: Evolution, Cognition and Fiction, Cambridge, London: The Belknap Press of Harvard UP, 2009. Broughton, J. M. / D. J. Freeman-Moir (eds.), The Cognitive Developmental Theory of James Mark Baldwin: Current Theory and Research in Genetic Epistemology, Norwood: Ablex, 1982. Brown, S. / J. E. Sherry (eds.), Time, Space, and the Market: Retroscapes Rising, New York: Sharpe, 2003. Carroll, Joseph, Literary Darwinism: Evolution, Human Nature, and Literature, New York, London: Routledge, 2004.

232

Jörg Thomas Richter

–, “Evolutionary Approaches to Literature and Drama,” in: The Oxford Handbook of Evolutionary Psychology, ed. by Louise Barrett and R. I. M. Dunbar, Oxford, New York: Oxford UP, 2007, pp. 637–648. Cuddy, L. A. / C. M. Roche (eds.), Evolution and Eugenics in American Literature and Culture: Essays on Ideological Conflict and Complicity, Lewisburg: Bucknell UP, London: Associated UPs, 2003. Deresiewicz, William, “Adaptation: On Literary Darwinism,” in: The Nation (9 June 2009), 10 February 2010: http://www.thenation.com/doc/20090608/deresiewicz/. Dewey, John, The Influence of Darwin on Philosophy, and Other Essays in Contemporary Thought, New York: Holt, 1910. Engels, Eve-Marie (ed.), Die Rezeption von Evolutionstheorien im 19. Jahrhundert, Frankfurt/ M.: Suhrkamp, 1995. “Essays by Brunetière,” in: The New York Times (30 July 1898), 14 June 2011: http://query.nytimes.com/mem/archive-free/pdf ?res=9E01EEDC1030E333A25753C3A9619C94699ED7CF. Fleck, Ludwik, Entstehung und Entwicklung einer wissenschaftlichen Tatsache [1935], Frankfurt/M.: Suhrkamp, 1980. Fullerton, George Stuart, “The Influence of Darwin on the Mental and Moral Sciences,” in: Proceedings of the American Philosophical Society 48.193 (1909), pp. xxv–xxxvii. Ghiselin, Michael T., “Darwin and Evolutionary Psychology: Darwin Initiates a Radically New Way of Studying Behaviour,” in: Science 9 (1973), pp. 964–968. Greenwood, John D., “Mechanism, Purpose and Progress: Darwin and Early American Psychology,” in: History of the Human Sciences 21.1 (2008), pp. 103–126. Groos, Karl, The Play of Animals, New York: Appleton, 1898. –, The Play of Man, New York: Appleton, 1901. Guthrie, Malcolm, On Mr. Spencer's Unification of Knowledge, London: Trübner, 1882. Hawkins, Mike, Social Darwinism in European and American Thought, 1860-1945: Nature as Model and Nature as Threat, Cambridge: Cambridge UP, 1997. Hoeges, Dirk, Literatur und Evolution: Studien zur französischen Literaturkritik im 19. Jahrhundert, Taine – Brunetière – Hennequin – Guyau. Beiträge zur neueren Literaturgeschichte 49, Heidelberg: Winter, 1980. Hoskins, John Preston, “Biological Analogy in Literary Criticism,” in: Modern Philology 6.4 (1909), pp. 407–434. “Influence of Criticism: Fourth of a Series of Lectures by M. Brunetière at the Lenox Lyceum,” in: The New York Times (30 April 1897), 14 June 2011: http://query.nytimes.com/mem/archive-free/pdf ?res=9906E0DC1230E333A25753C3A9629C94669ED7CF. Jahoda, Gustav, “Culture, Biology and Development across History,” in: Between Culture and Biology: Perspectives on Ontogenetic Development, ed. by Heidi Keller, Ype H. Portinga and Axel Schönrich, Cambridge: Cambridge UP, 2002, pp. 13–29 (= 2002a). –, “The Ghost in the Meme Machine,” in: History of the Human Sciences 15.2 (2002), pp. 55–68 (= 2002b). Lange, Konrad von, Das Wesen der Kunst: Grundzüge einer realistischen Kunstlehre, Berlin: Grote’sche Verlagsbuchhandlung, 1901. Langfeld, Herbert Sidney, The Aesthetic Attitude, New York: Harcourt, Brace and Howe, 1920.

Phantoms in the Retroscape

233

Leerssen, Joseph Th., Komparatistik in Großbritannien 1800-1950. Aachener Beiträge zur Komparatistik 7, Bonn: Bouvier, 1984. Levin, Harry, “Semantics of Culture,” in: Daedalus 94.1 (1965), pp. 1–13. Levit, G. S. / K. Meister / U. Hoßfeld, “Alternative Evolutionary Theories: A Historical Survey,” in: Journal of Bioeconomics 10.1 (2008), pp. 71–96. Lorblanchet, Michel, “The Origins of Art,” in: Diogenes 54.2 (2007), pp. 98–109. “M. Brunetière on History: The French Critic Delivers His Second Lecture on Contemporary Literature,” in: The New York Times (24 April 1897), 14 June 2011: http://query.nytimes.com/mem/archive-free/pdf ?res=9404E3D61339E433A25757C2A9629C94669ED7CF. Mackenzie, Alastair S., The Evolution of Literature, London: John Murray, 1911. Michaelis, Heike, Darwinismus und literarischer Diskurs in England am Beispiel von George Eliot und Thomas Hardy, Münster: LIT, 2004. Muller, Hendrik Clemens, Lectures on the Science of Literature, partly delivered in Edinburgh (Summer Meeting 1898), Haarlem: Vincent Loosjes, 1904. Norris, Christopher, “Science and Criticism: Beyond the Culture Wars,” in: Literary Theory and Criticism, ed. by Patricia Waugh, Oxford: Oxford UP, 2006, pp. 451–471. Plotkin, Henri C., Evolutionary Thought in Biology: A Brief History, Oxford: Blackwell, 2004. Popp, Jerome A., Evolution’s First Philosopher: John Dewey and the Continuity of Nature, Albany: State University of New York Press, 2007. Porter, Roy, “The Two Cultures Revisited,” in: boundary 2 23.2 (1996), pp. 1–17. Posnett, Hutcheson Macaulay, Comparative Literature, London: Kegan Paul, 1886. Putt, S. Gorley, “The Snow-Leavis Rumpus,” in: The Antioch Review 23.3 (1963), pp. 299–312. Sarrasin, Philip, Darwin und Foucault: Genealogie und Geschichte im Zeitalter der Biologie, Frankfurt/M.: Suhrkamp, 2009. Schnackertz, Hermann Josef, Darwinismus und literarischer Diskurs: Der Dialog mit der Evolutionsbiologie in der englischen und amerikanischen Literatur, München: Fink, 1992. Scott, Colin A., “Sex and Art,” in: The American Journal of Psychology 7.2 (1896), pp. 153– 226. Snow, C. P., The Two Cultures, ed. by Stefan Collini, Cambridge: Cambridge UP, 1998. Stanley, Hiram M., Studies in the Evolutionary Psychology of Feeling, London: Swan Sonnenschein, 1895. –, Essays on Literary Art, London: Swan Sonnenschein, 1897. Thomson, J. Arthur, Darwinism and Human Life: The South African Lectures for 1909, London: Melrose, New York: Henry Holt, 1911. –, The Control of Life, London, New York: Melrose, 1921. Turner, Frederick, “An Ecopoetics of Beauty and Meaning,” in: Biopoetics: Evolutionary Explorations in the Arts, ed. by Brett Cooke and F. Turner, Lexington, KY: ICUS, 1999, pp. 119–137. Weber, B. / D. J. Depew (eds.), Evolution and Learning: The Baldwin Effect Reconsidered, Cambridge: MIT Press, 2003. Weigel, Sigrid, “Evolution der Kultur oder Kulturgeschichte der Evolutionstheorie – Epistemische Probleme am Schnittpunkt der zwei Kulturen,” in: Bewahren und Verän-

234

Jörg Thomas Richter

dern im Kontext biologischer und kultureller Evolution. Nova Acta Leopoldina 90.338 (2004), pp. 142–168. Wiener, Philip P., Evolution and the Founders of Pragmatism, Cambridge: Harvard UP, 1949. Wilson, Edward O., Consilience: The Unity of Knowledge, New York: Knopf, 1998.

Genetische Methode oder „Instinktschöpfung“ wider die Schmerzen der „Höherentwicklung

Genetische Methode oder „Instinktschöpfung“ wider die Schmerzen der „Höherentwicklung des Organismus“? Evolutionäre Kulturtheorie in völkerpsychologischer Absicht bei Wundt, Schmarsow und Worringer Norman Kasper

Die von unterschiedlichen disziplinären Standorten um 1900 entwickelten analytischen Parameter für die Indikation kultur- und kunstpsychologischer Entwicklungsmuster eint, trotz aller Unterschiede, ein Konsens über zentrale Annahmen, der für einen fruchtbaren Rezeptions- und Diskussionshorizont sorgt. Kunstwissenschaftlich und ästhetiktheoretisch orientierte Völkerpsychologie als auch gemeinschaftspsychologisch orientierte Kunstwissenschaft kommen einerseits darüber ein, dass Aussagen über Stellenwert, Charakter und Entstehungsbedingungen künstlerischer Artefakte nur innerhalb eines entwicklungsgeschichtlichen, d.h. entwicklungspsychologisch fundierten Theorierahmens möglich sind; andererseits können die Kunstprodukte selbst als Indikatoren für den an der Evolutionstheorie Darwins geschulten Entwicklungsgedanken funktionalisiert werden.1 Mit der Frage nach der Genese künstlerischer Tätigkeit und Produkte verbindet Völkerpsychologie und psychologisch orientierte Kunstwissenschaft die Thematisierung phylogenetischer Aspekte, deren argumentative Dignität sich wiederum vor dem Richterstuhl entwicklungsgeschichtlicher und kulturanthropologischer Plausibilität verantworten muss. Zudem bilden die Deutungen des wachsenden Datenmaterials von Seiten der prähistorischen Archäologie und einer kulturgeschichtlich orientierten Ethnologie eine Referenzgröße, die bei der Schärfung des eigenen Profils nicht unerheblich ist. Damit ist nicht nur ein gegenseitiges Bedingungsgefüge umrissen, das evolutionskulturelle Theoriebildung in völker- und kunstpsychologischer Absicht mit je eigener Schwerpunktsetzung zu formulieren erlaubt, auch das Primat eines produktionsästhetischen Fokus 1

Die „Historisierung der Natur im Zeichen Darwins läuft […] im Zeitalter des Historismus auf eine Naturalisierung und Enthistorisierung der Geschichte hinaus“ (Schnädelbach 1984, S. 37). Als Träger dieser naturalisierten Kunstgeschichte fungiert der „Stil“, dessen Wandlungen sich durch die Annahme von „Kausalgesetzen“ in Abfolgen einteilen lassen (vgl. dazu Zeitler 1984, S. 296–299).

236

Norman Kasper

bei gleichzeitigem integrativem oder kontrastivem Rekurs auf zeitgenössische einfühlungsästhetische Wirkungsmodelle wirkt verbindend. Bei der Wahl der Analyseobjekte herrscht ebenfalls weitgehende Einigkeit; als ideales Demonstrationsobjekt gilt die Entwicklung der sich von ihrem Schmuckstatus emanzipierenden Ornamentkunst. Doch hier enden die Gemeinsamkeiten. Denn während Wilhelm Wundt (1832–1920) in seiner Völkerpsychologie die „Entwicklungsgeschichte der Kunst“ als „äußere Form“ begreift, „in der sich uns das Wesen und die Entwicklung der Phantasie darstellt“ (Wundt 1905, S. 89), will der Kunsthistoriker August Schmarsow (1853– 1936) nicht nur die Völkerpsychologie lediglich als Hilfswissenschaft einer sich methodologisch-methodisch konsolidierenden und psychologisch formierenden Kunstwissenschaft nutzen. Er lehnt darüber hinaus Wundts Phantasiebegriff als Leitfaden ab. Stattdessen stellt er den auf Heinrich von Humboldt, Konrad Fiedler und Wundts frühere Arbeiten verweisenden Terminus der Ausdrucksbewegung in den Mittelpunkt seiner Überlegungen (vgl. Schmarsow 1907). Wilhelm Worringer (1881–1965) schließlich fundiert seine berühmten stilpsychologischen Ausführungen zu den sich in entwicklungsgeschichtlicher Perspektive mal verbindenden, mal entgegensetzenden menschlichen Abstraktions- und Einfühlungsbedürfnissen im Topos eines evolutionspsychologisch deduzierten Kunstwollens, das Anleihen bei dem Ausdrucksparadigma macht (vgl. Worringer 2007). Phantasie, Ausdrucksbewegung, Kunstwollen – in der Wahl und Anverwandlung der als maßgeblich erachteten produktionsästhetisch-psychologischen Vermögensbestimmungen bei der Rekonstruktion entwicklungsgeschichtlicher Zusammenhänge oder Brüche verbergen sich unterschiedliche Zugriffe auf das evolutionstheoretische Traditionsreservoir, die alle darauf abzielen, Entwicklungsgesetze oder zumindest Entwicklungstendenzen zu formulieren. Die Zusammenschau von Wundts, Schmarsows und Worringers evolutionspsychologisch orientierten Kunst- und Kulturtheorien, die im Folgenden geboten werden soll, möchte diese Entwicklungsmuster und deren Begründungen in vergleichender Perspektive aufzeigen.

I. Immanente Entwicklung – gemeinschaftspsychologische Deutung: Die Phantasie im Ornament bei Wilhelm Wundt I.1 Wundts einfühlungsästhetischer Phantasiebegriff Wundts umfangreiche Einlassungen zur Phantasie in der Kunst stehen im Zusammenhang mit dem Versuch der Völkerpsychologie, „diejenigen psychischen Vorgänge“ zu untersuchen, „die der allgemeinen Entwicklung menschlicher Gemeinschaften und der Entstehung gemeinsamer geistiger Erzeugnisse von allgemeingültigem Werthe zu Grunde liegen“ (Wundt 1900,

Genetische Methode oder „Instinktschöpfung“

237

S. 6). Insofern kann Wundt das Verdienst zugesprochen werden, „die erste kognitivistische Entwicklungshypothese der Kunst durchgeführt zu haben“ (Drüe 1983, S. 84). Mit Blick auf die bildenden Künste muss es darum gehen, die „Kunstobjekte nur als die äußeren Merkmale“ aufzufassen, „in denen sich das innere Leben der Phantasie nach außen kundgibt“ (Wundt 1905, S. 96) und Aufschlüsse über Religion und Mythos ermöglicht.2 Dabei interessiert maßgeblich eine an der experimentellen Analyse des individuellen Bewusstseins und dessen Entwicklung angelehnte gemeinschaftsgeschichtliche Genealogisierung der Phantasieprodukte, der die Völkerpsychologie am Leitfaden der Kunst auf die Spuren kommen will. Phantasie meint bei Wundt die „bei den Sinneswahrnehmungen und Erinnerungsvorgängen wirksamen assimilativen und apperzeptiven Prozesse mit den an sie gebundenen Gefühlsregungen“. Künstlerische Phantasie nun bezeichnet kein besonderes, sich „von den überall wiederkehrenden elementaren psychischen Vorgänge[n]“ (Wundt 1905, S. 283) unterscheidendes seelisches Vermögen.3 Statt einer qualitativen Auszeichnung gehe es neben einem Intensitätszuwachs bei der künstlerischen Phantasie darum, dass sich deren Erzeugnisse zu Wahrnehmungsgegenständen entwickeln, oder – wie Wundt sagt – dass durch den „Übergang der ästhetischen Apperzeption in die aktive Form künstlerischen Wollens die Produkte der Phantasie objektiviert“ (ebd.) werden. Entscheidend ist, dass Wundt bei seinen Bemühungen um die Bestimmung der Phantasie die Produktionsästhetik durch wirkungsästhetische Prämissen bestimmt sieht, die – so zeigt ein Blick auf seine Gewährsmänner Theodor Lipps und Johannes Volkelt – den Begriff der Einfühlung ins Zentrum ihrer Argumentation rücken (vgl. Wundt 1905, S. 41, 113, 219).4 So knüpft Wundts Analyse der „Raumphantasie“ (S. 19–45) u.a. an Lipps’ „Raumästhetik“ (vgl. Lipps 1903, S. 224–292; Lipps 1897) an. Nach Lipps wird im „ästhetischen Objekt […] das Sinnliche jederzeit ‚Symbol‘ eines seelischen Inhalts; es ist belebt oder beseelt“ (Lipps 1903, S. 96). Im Anschluss daran versteht Wundt unter Einfühlung eine „doppelseitige Gefühlsassimilation“, da „die an den objektiven Eindruck gebundenen Assoziationsmoti2 3

4

Vgl. zur Rolle der Phantasie als Grundlage der entwicklungsgeschichtlichen Analyse von Religion und Mythos, allerdings ohne auf die Rolle der Kunst einzugehen, Allesch 2006. Johannes Volkelt kritisiert Wundts Phantasiebegriff mit dem Hinweis darauf, dass sich künstlerische und außerkünstlerische Phantasieaktivitäten nicht unterscheiden ließen: Das, „wodurch sich die künstlerische Phantasie von allen anderen seelischen Erscheinungen abhebt“ – bei Volkelt der in vermögenspsychologischer Tradition stehende „Grad der Bestimmtheit des Vorstellungsinhaltes“ (Volkelt 1914, S. 103; vgl. auch S. 54, 58f.) –, komme bei Wundt nicht zur Geltung. Freilich ist Wundt auch Gewährmann in eigener Sache. Er geht den bisher lediglich als Eindrucksempfindungen bezeichneten ästhetischen Elementargefühlen – darin ganz „Ästhetiker von unten“ im Sinne Gustav Theodor Fechners und in der Tradition von Hermann von Helmholtz und Hermann Lotze – experimentell nach (vgl. Wundt 1903, S. 123–209). Die einfühlungsästhetische Theoriebildung kann hier anknüpfen.

238

Norman Kasper

ve untrennbar mit jenen subjektiven Motiven verschmelzen, die von der unmittelbaren Rückwirkung des Eindrucks auf den eigenen Körper“ und dessen Gefühlshaushalt stammen. Eben jene Verbindung von unmittelbar sinnlicher Formerfahrung als Formbelebung mit einer sich aus dem Erinnerungsfundus speisenden, gleichwohl an die Form gebundenen Assoziation ist es, die es produktionsästhetisch zu reformulieren gilt. Doch dies stellt Wundt vor einige Schwierigkeiten, da die Einfühlungs- als Wirkungsästhetik kaum Aufschluss über die „schaffende[…] Phantasie“ (Wundt 1905, S. 219)5 gibt. Zudem versteht sie sich als systematische Ästhetik, welche in diachroner Perspektive, die eine anvisierte Entwicklungsgeschichte der Phantasie einnehmen muss, unergiebig ist. Da Künstlerbiographien über produktionsästhetische Prämissen genauso wenig aufschlussreich sind wie kulturgeschichtliche Tableaus, muss es darum gehen, bei den Kunstwerken selbst anzusetzen und die Einfühlungspsychologie durch eine an der Formalästhetik orientierte Kunstpsychologie zu ergänzen.6 Genau dies unternimmt Wundt, wenn er Aussagen über künstlerische Entwicklungstendenzen auf den Standpunkt der Immanenz verpflichtet: Die „Quellen, die der Kunst aus ihrer eigenen Entwicklung zufließen“ (Wundt 1905, S. 221), interessieren. Praktische Relevanz erhält Wundts Verfahren etwa bei der Klärung der Frage, welcher psychologische Aufschluss sich aus der geometrischen Stilisierung der Formen ergibt. So lässt sich die Umwandlung von Tierdarstellungen in rein geometrische Linienverhältnisse, wie sie entwicklungsgeschichtlich beobachtet werden kann, von formalästhetischem Standpunkt aus als Verschiebung vom Organischen zum Unorganischen beschreiben. Psychologisch ist dies jedoch nicht statthaft, wie Wundts Ausführungen zur „Belebung der Formen“ zeigen: Die Tierform, die zu einem regelmäßigen geometrischen Gebilde geworden ist, hat damit für die Anschauung nicht aufgehört ein organisches Gebilde in dem Sinne zu sein, daß sie trotz ihrer Regelmäßigkeit lebendig erscheint […] Die Wirkung solcher Ornamente beruht […] gerade darauf, daß sie die geometrische Regelmäßigkeit mit 5

6

Wundt kritisiert Fechners in dessen Vorschule der Ästhetik eine experimentelle Gefühlsanalyse leitende Entgegensetzung von Gefallen und Missfallen wie auch Lipps’ und Volkelts argumentativen Rückzug auf den „Standpunkt des Genießenden und Beschauenden“ (Wundt 1905, S. 219). Später lehnt Panofsky jene – allerdings dem Kunstwollen zugeordnete – „apperzeptionspsychologische Deutung“ ab, die glaubt, aus den sich beim „kunstgenießenden Beschauer [...]“ einstellenden Zuständen Rückschlüsse auf „die im Kunstwerk sich aussprechende Tendenz“ ziehen zu können. Gleich Wundt bezieht sich Panofsky auf Lipps’ Ästhetik (vgl. Panofsky 1985, S. 31, 33f., 41f.). Wundts Verhältnis zur formalistischen Ästhetik, die reine Form- und Farbwerte als „schön“ analysiert, wird von den Zeitgenossen als ambivalent betrachtet. So stimmt Johannes Volkelt Wundt zwar zu, dass die ästhetischen Elementargefühle sich niemals rein geltend machen lassen, somit schon immer von Assoziationen überlagert werden, jedoch, so die Kritik, sehe Wundt in seinen Grundzügen der physiologischen Psychologie bereits „in jenen des eigentümlich Ästhetischen entbehrenden abstrakten Eindrücken selbst schon ästhetische Gefühle“ (Volkelt 1905, S. 436f., Anm.) und ignoriere somit die assoziativen Valenzen.

Genetische Methode oder „Instinktschöpfung“

239

dem organischen Charakter des Eindrucks und auf diese Weise ein formales und ein inhaltliches Moment ästhetischen Gefallens in sich vereinigen. (Wundt 1905, S. 291)

Dass die Auflösungen von Tierdarstellungen in Schlangen-, Wellen- und Mäanderlinien, in „bilateral symmetrische Ornamente“ (ebd.) und dergleichen mehr von psychologischem Standpunkt aus durchaus zu lebendigen, mithin organischen Formenanschauungen führen können, macht Lipps im zweiten Band seiner Ästhetik geltend. Dort widmet er ein ganzes Kapitel unterschiedlichen einfachen Formen und deren einfühlungsästhetischen Anmutungsvalenzen (vgl. Lipps 1906, S. 252–398). Zu dem gesellen sich bei Wundt assoziative Faktoren, die neben den in die Formen projizierten Empfindungszuständen auch immer wieder tatsächliche Vorstellungen – an bestimmte Tiere etwa – hervorrufen. Deutlich wird hierbei zum einen, dass sich die Entwicklungsgeschichte der Phantasie innerhalb der Ornamentik für Wundt als ein Oszillieren zwischen objektrelational-formalästhetischen Kriterien und deren einfühlungspsychologischer Fundierung zeigt.7 Zum anderen jedoch ist dieses Oszillieren das Spielfeld der Assoziationen, die die geometrischen Gebilde hin zu Vorstellungs- und Erinnerungsbildern, mithin zum Gegenständlichen konkretisieren wollen. I.2 Genetische Methode und Ornament Die ur- und frühgeschichtliche Ornamentkunst ist nach Wundt ein besonders dankbares Demonstrationsfeld für eine Entwicklungsgeschichte der Phantasie. Dies gilt zum einen, da genug Anschauungsmaterial für eine genaue Charakterisierung der einzelnen Entwicklungsstadien vorliegt; zum anderen, aufgrund der gemeinschaftspsychologisch aussagekräftigen, kaum individuell motivierten Überformung dieser Entwicklungstendenzen. Die „Zierkunst“ folgt genealogisch betrachtet der „Augenblickskunst“ und der „Erinnerungskunst“. Bereits in der „Augenblickskunst“, zu der Wundt etwa in den Sand eingefurchte „Merkzeichen“ als auch aus dem „Spieltrieb[…]“ abgeleitete Formen im gleichen Untergrund zählt, ist jene Janusköpfigkeit angelegt, die die „Zierkunst“ prägen wird: Auf der einen Seite nämlich wird das Augenblicksbild mit zunehmender Übung allmählich treuer, dem Gegenstand ähnlicher. Auf der andern führt die spielende Wiederholung der Formen an sich schon, besonders aber ihre Verwendung als Merkzeichen, als Symbole einer primitiven Bilderschrift, zu einer fortschreitenden Vereinfa7

In der Synthese von bildgrammatischer und psychophysiologischer Argumentation geht Wundt deutlich über die ältere formale Ästhetik (Johann Friedrich Herbart, Robert Zimmermann) hinaus. Muss sich diese den Vorwurf gefallen lassen, nicht deutlich genug herauszuarbeiten, „daß es sich bei den [formalen – N. K.] Strukturen um Beziehungen handelt, die sich im künstlerischen Erleben konstituieren und außerhalb dieses Erlebens nichts sind“ (Nachtsheim 1984, S. 72), so zeigt sich in Wundts einfühlungsästhetisch akzentuierter Phantasiegeschichte deutlich das Bemühen, der Wirkungsästhetik der Form in systematischer und historischer Hinsicht gerecht zu werden.

240

Norman Kasper

chung und damit zu neuen, oft überraschenden Formen, die in ihrer Regelmäßigkeit erfreuen und wiederum zu weiteren Umgestaltungen herausfordern. (Wundt 1905, S. 100)

Das Prinzip ist klar: Von der Augenblicks- und der Erinnerungskunst, über die Zier- und Nachahmungs- bis hin zur Idealkunst lassen sich Stufen psychologischer Entwicklung nachzeichnen, die sich über die Differenzierung und Regression bestimmter formaler Merkmale konstituieren. Dabei ist die nächsthöhere Entwicklungsform in der vorausgehenden angelegt. Im Wechselspiel von realisierter Differenzierung präferierter Merkmale und regressiver Behandlung anderer, entwickelt sich die bildende Kunst nach Wundt im produktiven Spannungsfeld von nachahmender Aneignung eines Naturvorbildes und geometrischer Stilisierung. Genau darin zeigt sich auch Wundts genetische Methode: dass jegliche motivische Entwicklung als Variation des bereits bestehenden Formenreservoirs gewertet wird. Formale Neuerungen sind somit immer das Ergebnis entwicklungspsychologischer Bedingungsverhältnisse, die sich aus dem Wechselspiel von Herstellungs- und Nachahmungsmotiven ergeben. Während sich die Herstellungsmotive aus den praktisch-technischen Verfertigungsbedingungen ergeben, können Nachahmungsmotive dann geltend gemacht werden, wenn das „Material des Gefäßes zugleich als ein Material nachahmender Kunst benutzt wird“ (Wundt 1905, S. 172). Damit steht fest, dass ein „reines“, nicht auf Herstellungs- oder Nachahmungsbedingungen verpflichtetes Ornament, das sich als „geometrisches Ornament“ am meisten von allen Nachahmungstendenzen zu emanzipieren scheint, tatsächlich das „Erzeugnis einer langen Entwicklung ist“, „bei der die bildende Phantasie durch äußere Einwirkungen erregt und durch die Wechselwirkung, in die jene zum Teil weit voneinander abliegenden Einwirkungen miteinander traten [Herstellungs- und Nachahmungsmotive – N. K.], zu diesen eigenartigen neuen Schöpfungen geführt wurde“ (Wundt 1905, S. 183). So kann sich aus einer intendierten Schlangendarstellung in wirkungsästhetischer Perspektive „ein reines Formmotiv“ (S. 184) entwickeln.8 Auf diese Weise entsteht in der Ornamentik die geschlängelte Linie. 8

Dass für Wundt die reine Form nicht nur ein formales, sondern auch ein geistiges Entwicklungsprodukt ist, wird an seiner negativen Einschätzung von Kants Ornamentkonzeption auf der Grundlage der Einteilung von Schönheiten in rein und anhängend deutlich. „[Un]historisch […]“ und „unpsychologisch[…]“ sei Kants Herleitung, so Wundt. Kants Bestimmung des Ornaments fußt auf der Annahme, dass ihm kein Begriff beikomme und es demnach von (abbildlichen) Darstellungen, die einem Gegenstand anhängen, getrennt werden müsse. Wundt hält Kant vor, er verwechsle die „Eigenart der ästhetischen Wirkung“ mit den „Eigenschaften des ästhetisch wirksamen Objekts“. Jedes Kunstwerk, auch das ornamentale, bringe entweder eine „Lebenshaltung zur Anschauung“ (Wundt 1905, S. 223f.) oder füge sich zumindest zweckhaft in ein Gesamtensemble ein, mithin könne es nicht als frei bezeichnet werden (vgl. Kant 1983, S. 310, § 16, B 49). Wundts Auseinandersetzung mit Kant muss vor der Folie der formalistischen Ästhetik des 19. Jahrhunderts betrachtet werden. Denn diese schließt insofern

Genetische Methode oder „Instinktschöpfung“

241

Aus der Verbindung gewundener und gerader Linien ergibt sich schließlich das „Mäanderschema“ (S. 185). An unterschiedlichen Alligatorendarstellungen weist Wundt nach, dass eine stilisierende Vereinfachung der Nachahmungsobjekte zu einer radikalen Geometrisierung führt, der letztlich formmotivische Geltung zukommt; obwohl in entwicklungsgeschichtlicher Perspektive freilich klar ist, wovon Schritt für Schritt abstrahiert wurde: zunächst von den unwesentlichen Alligatorenmerkmalen, später auch von denen, die für eine Erkennbarkeit des Darstellungsgegenstandes sorgen. Darüber hinaus macht Wundt auch ganz praktische Veränderungsgründe aus, die, gleich der Differenzierungs- und Regressionshypothese, Anleihen bei der Evolutionstheorie machen. „[Z]ufällig entstandene Deformationen“, so Wundt, können durch „absichtliche Häufungen und regelmäßigere Verteilung“ (S. 176) zu neuen Formen führen. Wenn etwa bei der Herstellung keramischer Ornamente geschludert wird und Fingerabdrücke an Stellen entstehen, wo diese gar nicht vorgesehen sind, so können in den Folgegestaltungen die Fingerabdrücke regelmäßig angeordnet werden und zu einer eigenständigen Formerscheinung mutieren. Solche Formmutationen können gegenüber ihrer Ausgangsformation eine höhere Wertschätzung erfahren und diese schließlich verdrängen. Gemessen an Wundts komplexem Phantasiebegriff, bleibt dessen Anwendung auf eine Erklärung der Ornamententwicklung eigentümlich konventionell. Letztendlich sind es neben Herstellungsbedingungen vor allen Dingen Nachahmungsmotive, die Wundt geltend macht. Weniger jene sich aus einem Zusammenspiel apperzeptions-, assoziations-, formal- und einfühlungsästhetischer Faktoren heraus konstituierende Psychologie der Ornamentik ist es, die erklärungsrelevant wird, als vielmehr die bereits von Gottfried Semper hervorgehobenen künstlerisch-technischen Herstellungsbedingungen und eine konstante, weitestgehend entwicklungsresistente Nachahmungsbemühung, die alle Kunststufen mehr oder weniger auszeichnet. Bereits Alois Riegl kritisierte jene Semper-Ausleger, die das Kunstwerk zum Produkt perfektionierter technischer Fertigkeiten degradieren wollen, und geht stattdessen von einem eigenständigen Kunstwollen aus (vgl. Riegl an das Konzept freier Schönheiten an, als sie Allgemeine Aesthetik als Formwissenschaft (1865) – so der Titel von Robert Zimmermanns epochemachendem zweitem Aesthetik-Band – betreibt und damit einem der Form oder dem ästhetischen Objekt anhängenden Inhalt grundsätzlich skeptisch gegenübersteht. Eine zeitgenössische Historisierung der formalistischen Ästhetik beginnend bei Kant liefert Volkelt 1905, S. 428–439 (vgl. zum ästhetischen Formalismus gleichfalls in der Nachfolge Kants im 19. Jahrhundert Mallgrave und Ikonomoú 1994, S. 5– 17; die Unterschiede von Kants Geschmacks- und Zimmermanns Formästhetik betont hingegen Nachtsheim 1984, S. 68f.; vgl. zur Verbindung von formaler Ästhetik und formaler sowie relationaler Logik von Zimmermann bis Heinrich Wölfflin grundlegend Wiesing 1997, S. 27–141). Indem Wundt die reine Form entwicklungspsychologisch deutet, tritt zu der formalen Analyse die geschichtliche. Auf diesem Weg werden Formbildungsprozesse kunstpsychologisch historisiert.

242

Norman Kasper

1987, S. 8f.; Riegl 1923, S. VI–X). Wenn Wundt jedoch die „Herstellungsmotive keramischer Ornamente“ maßgeblich auf die „Einflüsse der Flechtkunst“ (Wundt 1905, S. 173–178) zurückführt, so variiert er den für Semper zentralen Topos, die Struktur der Ornamentik sei der Verfahrensweise der Textilherstellung entlehnt.9 Zudem verweist die Zentralstellung der Nachahmung – ob nun von bereits bestehenden Mustern, Naturvorbildern oder Erinnertem – auf die problematische Entwicklungstypologie von der Augenblicks- zur Idealkunst. Auch wenn man in Rechnung stellt, dass dies nur heuristische Idealtypen seien, die mannigfaltige Übergänge und Rückbezüge einbegriffen, weist doch die Nachahmung gerade nicht auf das hin, was sich von Kunststufe zu Kunststufe entwickelt hat, sondern auf das, was trotz aller Entwicklung weitestgehend konstant geblieben ist. Nicht eigentlich eine Entwicklung der Phantasie ergibt sich hieraus; vielmehr werden die zyklisch wiederkehrenden Variationsmuster der Nachahmungsbemühungen sichtbar, zwischen Stilisierung und Naturvorbild changierend.10 Wundt kommt hierbei in der Perspektive einer historischen Formalanalytik mit dem Riegl der Stilfragen überein. Auf der Grundlage rein formal-motivischer Abhängigkeitsbeziehungen gelang es dem österreichischen Kunsthistoriker, die geographisch und zeitlich voneinander entfernt liegenden Ornamenttypen als eigenständige, miteinander verbundene und auseinander entwickelte Kunstform zu würdigen (vgl. Riegl 1923; Iversen 1993, S. 50–68).11 In produktionsästhetischer Perspektive hingegen fällt der Vergleich Riegl-Wundt zwie9

Vgl. zur Geburt der Ornamentik aus der Zweckfunktion und den Herstellungsbedingungen der Textilkunst bei Gottfried Semper Kroll 1987, S. 47–51. 10 Dies arbeitet auch Kroll heraus, der darauf hinweist, dass sich bei Wundt kaum die Phantasiean der Kunstentwicklung ablesen lässt, wie seine eigenen völkerpsychologischen Vorgaben geltend machen. Krolls Unterteilung in eine „schöpferische[…] Eigenmacht der menschlichen Phantasie“, die sich im Gegensatz zur Entstehung des Ornaments aus der Nachahmung heraus befinde, wird jedoch Wundts Phantasiekonzept nicht gerecht. Indem Wundt bei einer Bestimmung des Phantasiebegriffes von der sinnesphysiologisch fundierten Wahrnehmungspsychologie ausgeht, erteilt er gerade jeglicher romantisch-genialischer Schöpfungsrhetorik eine Absage, die Phantasie zu einseitig als geistiges Vermögen definiert (vgl. Kroll 1987, S. 91). Der Zwiespalt zwischen der postulierten Entwicklung der Phantasie und dem auf die Nachahmungsdimension fokussierten Formenvergleich – darin ist Kroll zuzustimmen – bleibt jedoch bestehen. Vgl. auch Drües Hinweis auf die unzureichende Vermittlung von „Kunstrezeption“ und „Kunsterzeugung“ in Wundts Phantasiekonzeption (Drüe 1980, S. 163). 11 Wie einflussreich und wirkungsmächtig Riegls Würdigung des Ornaments als Kunstform sui generis ist, wird mit Blick auf die Ästhetik der Moderne und Postmoderne deutlich. Vgl. dazu die aufschlussreichen Beiträge des Sammelbandes Ornament und Abstraktion (hg. von Markus Brüderlein, 2001). Die Mittelstellung des Ornaments zwischen Schmuck- und eigenständiger Darstellungsform lässt es zur vielgestaltigen Chiffre kulturphilosophischer Reflexion werden. Besonders die Ornamenttheorie des 20. Jahrhunderts in der Nachfolge Riegls arbeitet einer eigenständigen Ausdruckwertigkeit des Ornamentalen zu, ohne dabei den älteren Schmuckund Beiwerkscharakter im Rahmen metaphorologischer Neuakzentuierungen zu vernachlässigen. Darin zeigt sich nicht zuletzt die ornamentale Resistenz gegenüber vereinheitlichenden Zugriffsgeboten und methodisch sanktionierten Deutungsmonopolen (vgl. Raulet und Schmidt 2001; Frank und Hartung 2001).

Genetische Methode oder „Instinktschöpfung“

243

spältig aus. Zwar macht Riegl gleich Wundt das Nachahmungsbedürfnis für die Entstehung geometrischer Formen verantwortlich – etwa das Kunstwollen, „das Abbild eines Naturwesens in todtem Material [zu] schaffen“ (Riegl 1923, S. 20). Jedoch misst der Österreicher zum einen den produktionstechnischen Herstellungsbedingungen bei der Erklärung von Stiländerungen keine schöpferische Rolle zu. Zum anderen stellt sein Konzept des Kunstwollens einen originären Beitrag zur Produktionsästhetik dar. Weder bleibt es – wie Wundts Phantasieverständnis – auf die Integration wirkungsästhetischer Begründungsmuster, noch – dies zeigt die Riegl-Rezeption des frühen 20. Jahrhunderts – auf die Nachahmungsdimension angewiesen. Vielmehr ist in Riegls Kunstwollen eine triebhafte Dimension angelegt12, die spätere Bestimmungen des Kunstvoluntarismus ausbauen werden und auch in den Begriff der Ausdrucksbewegung, den Schmarsow in Auseinandersetzung mit Wundt stark macht, eingehen.

II. „Naturgesetzlich geregelte Gebärdung“: Schmarsows Naturalisierung der Ornamentik II.1 Von der Phantasie zur Ausdrucksbewegung August Schmarsows ausführliche Würdigung von Wundts kunstpsychologisch orientierter Entwicklungsgeschichte der Phantasie ist ambivalent. Zum einen stelle sie einen Fortschritt gegenüber den Bemühungen der kunstarchäologisch orientierten Völkerkunde und der ethnographischen Kulturanalyse dar, zum anderen teile sie mit diesen jedoch zentrale Grundannahmen. Gegenüber den Arbeiten von Ernst Grosse und Yrjö Hirn gehe Wundt nicht von einer autonomieästhetischen Bestimmung der Kunst aus, die in entwicklungs- und entstehungsgeschichtlicher Perspektive unbrauchbar sei, da sie keinen Maßstab bilden könne. Jedoch, so Schmarsows Vorwurf, halte Wundt an den ebenso unbrauchbaren Beschreibungskategorien der rationalistischen Nachahmungsästhetik fest, wie es auch bei Theodor Koch-Grünberg und Karl von den Steinen beobachtet werden kann (vgl. Schmarsow 1907, S. 309–313, 327).13 Hauptkritikpunkt ist zweifelsohne das Wundts Nachahmungsverständnis zuarbeitende Phantasiekonzept. Vom Standpunkt einer psychologischen Ästhetik, den Schmarsow für eine dezidiert kunstwissenschaftliche Analysefundierung fruchtbar machen will, ist seine Kritik ver12 Riegls Bestimmung des Kunstwollens als „ästhetische[r] Drang, die Naturdinge unter Steigerung oder Zurückdrängung der isolierenden oder der verbindenden Merkmale in Kunstwerken reproduziert zu sehen“, verbindet voluntaristische, triebbasierte und mimetische Tendenzen miteinander (vgl. Riegl 1996, S. 60; vgl. ausführlich zum Kunstwollen Kap. III.1). 13 Schmarsow bezieht sich hier im Einzelnen auf: Grosse 1894, von den Steinen 1894, Hirn 1904, Koch-Grünberg 1905.

244

Norman Kasper

ständlich: Nicht nur, dass der Phantasiebegriff in völkerpsychologischem Gewand trotz aller Immanenzgebote schlussendlich die Formen der Kunst als Formen mythologischer und religiöser Inhalte interpretiere und in dem Maße auf inhaltliche Aussagen fixiert sei, wie er sich dem „poetischen Vorstellungsinhalt“ und der „symbolischen Bedeutung“ (Schmarsow 1907, S. 324), mithin mehr der Idee als der Erscheinung widme. Darüber hinaus sei die Phantasietätigkeit, wie Wundt sie expliziert, vielmehr selbst erklärungsbedürftig, als dass sie die Grundlage für Erklärungen bilden könnte (vgl. S. 469). Wir hatten bereits auf die schwierige Synthese von emotions- und einfühlungsästhetischen sowie assoziationspsychologischen Konstituierungsbedingungen des Wahrnehmungs- und Erinnerungsvorganges hingewiesen, die es in eine Theorie des künstlerischen Schaffens umzubauen galt. Diese Probleme nimmt Schmarsow zum Anlass, dem bereits bei der Sprachursprungsanalyse bewährten Konzept der Ausdrucksbewegung den Vorzug zu geben, wie Wundt es erprobt hatte. Damit werden noch zwei weitere einflussreiche kunstideengeschichtliche Strömungen des 18. und 19. Jahrhunderts als unbrauchbar abgelehnt. Mit der Rede von der Ausdrucksbewegung verbindet sich zum einen die Absage an ein eurozentristisches, der rationalistischen Nachahmungstheorie verpflichtetes Verständnis der Ästhetik als Lehre vom Schönen – eine Absage, die auch für Worringers Entdeckung der geheimen Gotik unter Berufung auf Konrad Fiedlers Gegensatz von Ästhetik und Kunstphilosophie maßgeblich ist (vgl. Worringer 1912, S. 5–10).14 Zum anderen geht es Schmarsow um eine Abkehr vom Kunstmaterialismus einiger Semper-Ausleger. Wohl in Unkenntnis der Ausführungen Riegls (vgl. Schmarsow 1907, S. 332), muss sich Wundt zu eben jenen zählen lassen. Unter Ausdrucksbewegung versteht Wundt nun all jene Äußerungen, die nicht der Mitteilung von Vorstellungen dienen, sondern einer unmittelbaren Gefühls- und Affektentladung. Er greift im ersten Band seiner Völkerpsychologie nach ausführlicher theoretischer und historischer Fundierung, u.a. am Beispiel der Gebärdensprache, auf das Erklärungsmuster der Aus14 Worringer schreibt Fiedler das Verdienst zu, die Trennung von „Aesthetik“ und „objektiver Kunsttheorie“ (Worringer 1912, S. 6) befördert zu haben. In der Tat zielt Fiedlers Aufwertung der Kunstphilosophie auf die Zurückdrängung einer Ästhetik der klassisch-kallistischen Nachahmung ab, wie sie Worringer im Anschluss an Abstraktion und Einfühlung im Topos der geheimen Gotik intendiert. Da Fiedler die Ästhetik im Rückgriff auf Kants Kritik der Urteilskraft mit der Analyse von Gefühlen und Geschmacksurteilen belastet sieht, geht es ihm zudem um die Rückgewinnung einer erkenntnistheoretisch, nicht nur subjekt- und affektrelational relevanten Rolle der Kunstanalyse, die er als Kunstphilosophie verstanden wissen will. Eine solche Kunstphilosophie nimmt ihren Ausgang bei der Transzendentalästhetik der Kritik der reinen Vernunft. Im Gegensatz zu einer subjektbezogenen Akzentuierung der sinnlichen Wahrnehmung, des ästhetischen Urteils und der Empfindungen wie auch zu einer Fokussierung auf „schöne“ Objekteigenschaften geht es Fiedler um eine Aufklärung über das leibsinnliche Erkenntnispotential der bildenden Kunst (vgl. Fiedler 1991; Worringer 2007, S. 90–107).

Genetische Methode oder „Instinktschöpfung“

245

drucksbewegung zurück, um zu zeigen, dass die körperliche Gebärde dem Ausdruck einer „Gemütsbewegung“ diene und „zunächst und ursprünglich Affektäußerung“ sei. Vorstellungsäußerung wird sie nur insofern, als dass der Affekt gleichsam als Nebenprodukt auch „gefühlsstarke Vorstellungen“ (Wundt 1900, S. 239) enthalte. Nicht Hinweis, Mitteilung oder Nachahmung eines „schönen“ Naturvorbildes stehen am Anfang der Äußerungskette, so Schmarsow, Wundt folgend, sondern Affektentladungen (vgl. Schmarsow 1907, S. 319–323, 469–471). Diese basieren auf der menschlichen Triebstruktur und lassen sich damit nur bedingt der Kontrolle des intentionalen Bewusstseins unterstellen.15 Im Gegensatz zur bewusstseinspsychologischen Fundierung der Phantasie ist die Ausdrucksbewegung als „psychophysische Lebensäußerung“ (Wundt 1900, S. 31) zu verstehen. Bereits Konrad Fiedler gründete seine Theorie der Ausdrucksbewegung als eigenständige, welterschaffende Grammatik auf Wundts Konzept (vgl. Majetschak 1997b, S. 114)16: Indem Fiedler die Annahme einer dem Wirklichkeitsbewusstsein vorgängigen und beständigen Welt als naive Auffassung ablehnt, rücken zum einen jene die Wirklichkeit konstituierenden mentalen Prozesse der Vorstellungskombinatorik in den Mittelpunkt, zum anderen die Anschauung, welche als von dem begrifflichen Denken geschiedene Ausdrucksbewegung erkenntnistheoretische Eigenständigkeit erlangt.17 Trotz terminologischer Übereinstimmung, der Ablehnung naiver Nachahmungspostulate und einer Vorliebe für psychophysiologische Synthesen sind die Differenzen zwischen Fiedler und Wundt unübersehbar: Fiedler geht es weder um Affektentladung noch um eine Deutung des Ausdruckswertes als eines Symptoms psychischer Zustände, sondern allein um die Anschauung, die nicht an der Erscheinung von etwas der Sichtbarkeit Vorgängigem stabilisiert wird und gerade dadurch ontologische Dignität erhalten soll (vgl. Wiesing 1997, S. 154–160). Entscheidend ist, dass Schmarsow den Wundt’schen Faden der Ausdrucksbewegung nicht über Fiedler aufnimmt, sondern mehr in derjenigen Akzentuierung, die auch für die Kulturtheorie des Expressionismus maßgeblich ist: Kunst als oft unkontrollierbarer triebbasierter und darum „authentischer“ Selbstausdruck. In diesem Sinne wird das Ausdrucksparadigma auch für Schmarsows Kunstursprungsdiagnostik relevant, denn „der Niederschlag geregelter Ausdrucksbewegungen in sichtbaren Zeichen ist der gemeinsame Anfangsgrund aller Ornamentik“ (Schmarsow 15 Wundt bezeichnet „Triebhandlungen als die ursprünglichen thierischen und menschlichen Handlungen überhaupt, und demnach auch als die ursprüngliche Art der Ausdrucksbewegung“ (Wundt 1900, S. 37). 16 Mehr noch als Humboldts ähnelt Fiedlers Sprachverständnis demjenigen Wundts. Majetschak verweist auf Fiedlers ausführliche Exzerpte zu Wundts Grundzügen der physiologischen Psychologie [1874] (vgl. Majetschak 1997a, S. 12). 17 Vgl. zur Ausdrucksbewegung als durch die Kunst fortgesetzte Prozessierung der Anschauung bei Fiedler Boehm 1999, S. LXIII–LXVI.

246

Norman Kasper

1910, S. 348). Damit kann eine bisher vernachlässigte Dimension in Schmarsows Ornament-Verständnis konturiert werden, die sich an sein berühmtes Diktum, alle Ornamentik sei keine eigenständige Kunst, sondern „Wertbezeichnung“18, anschließen lässt. Eben weil das Ornament als Ausdrucksbewegung nach Schmarsow lediglich einen vollkommeneren Wert anzeigt, kann es nicht an jenen seiner relativen Wertigkeit widersprechenden Nachahmungsvorgaben, wie sie „die gedankenlose Übertragung der klassisch-objektivistischen Ästhetik aus der griechisch-römischen Archäologie auf die Kunst des Mittelalters und der primitiven Völker“ (Schmarsow 1910, S. 213) formuliert, gemessen werden. II.2 Geburt des Ornaments aus dem Affekt Schmarsows Rede von der Entstehung des Ornaments aus dem Ausdrucksbedürfnis des Menschen heraus entlässt die Gegenständlichkeit und den Gegenstandsbezug eines künstlerischen Objektes nahezu vollkommen aus dem Motivkatalog, der sich seinen Entstehungsbedingungen zugrunde legen lässt. Die „Ausdrucksbetätigung“ bedarf nicht einer „Anwandlung der Abbildelust“ oder „mitgebrachter Anschauungsbilder“, „als ob dergleichen Anwärter einer sichtbaren Erscheinungswelt schon inwendig sozusagen an der Schwelle warteten“: Denn es sind oft im Grunde rein motorische Regungen und dunkle augenlose Gefühle, die unter solchen verfeinernden und ihre Tiefenrichtung nach vorwärts verschlingenden Handbewegungen zutage treten, an die Oberfläche gelangen und sich notgedrungen ihrer ursprünglichen Natur entfremden müssen, um nur das Licht zu gewinnen. (Schmarsow 1922, S. 94; vgl. Schmarsow 1911)19

Die Betonung der nahezu monadischen Fenster- bzw. Augenlosigkeit der Gefühle mit dem Hinweis auf nervenphysiologische Aspekte zeigt, wie marginal die Rolle jener die Ausdrucksbewegung begleitenden Vorstellungsbilder von Schmarsow eingeschätzt wird. Doch nicht nur die Kritik an der Festle18 „Ornamentik ist eine gemeinsame Vorstufe aller freien Künste. Sie ist selbst noch keine Kunst im höchsten Sinne, denn sie stellt keine Werte dar, sondern begleitet diese nur hervorhebend, vermittelnd, umspielt sie mit ihren Reizen, um die Aufmerksamkeit anzuziehen und zum Verweilen einzuladen, auch einmal zu nötigen, oder hilft sie gar selbst einkleiden, in die rechte Form bringen, die solchem Wert erst die leichte Aufnahme sichert […] Jedes Ornament ist eine Wertbezeichnung.“ (Schmarsow 1922, S. 491). Vgl. ausführlich zu Schmarsows Wertbezeichnungstheorem, das er in mehreren Aufsätzen diskutiert, Kroll 1987, S. 128–130. 19 Geometrisierte Tierdarstellungen, die die Bewegungsformen der Gliedmaßen von deren gewöhnlicher Verwendung entfernen, deutet Schmarsow als gestaltete animalische Ausdrucksbewegungen: „Dieser Bewegungszug aber ist kein gewöhnliches Tun und Treiben sonstiger Tiere nur, die ihre Werkzeuge zur Fortbewegung, zum Fang der Beute oder zum Widerstreit gegen den Feind benutzen, sondern es ist eine höchst charakteristische Gebärde, die nicht zu praktischem Erfolg, zu Leibes Notdurft und Nahrung in Wirklichkeit gebraucht wird, sondern eben nur als Ausdrucksbewegung um ihrer selbst willen erscheint, so daß der Beschauer gar nicht umhin kann, sie als solche aufzufassen und zu verstehen.“ (Schmarsow 1911, S. 163, Hervorhebung im Original; vgl. auch S. 157f., 169, 179).

Genetische Methode oder „Instinktschöpfung“

247

gung der Kunstgenese auf eine Art Außenweltabbildlichkeit verweist auf das Ungenügen an Wundts Phantasiebegriff. Weder lassen sich die ins Medium entäußerten Ausdrucksbewegungen als reine Umsetzungsoperation verstehen, die abbildend auf die ihnen zugrunde liegenden affektiven und motorischen Ursprünge schließen lassen, indem sie – wie Wundt postuliert – gleichsam als Indikator psychischer Vorstellungsvisualität fungieren, noch werde die Entstehungsgeschichte der Phantasie selbst thematisiert. Schmarsow deutet die als abgeschwächte Greifbewegung auf etwas hinweisende Gebärde als Ende haptisch-sinnlicher Erfahrung, in der sich der Verzicht auf einen unmittelbaren Kontakt mit den Dingen der Welt zeige: „Diese Resignation des Tastverfahrens bezeichnet deshalb […] die Anfangsgrenze der ausschließlich optischen Auffassung, des Fernbildes der Außenwelt.“ (Schmarsow 1907, S. 319). Eben jener Umschlagpunkt von der haptischen in die optische Welterfahrung ist in kunstpsychologischer und – wie Worringers Arbeiten zeigen – auch in kulturanthropologischer Perspektive für eine geschichtliche Analyse der künstlerischen Auseinandersetzung des Menschen mit der Welt entscheidend. Von Herders Plastik über Alois Riegls Spätrömische Kunstindustrie bis hin zu Heinrich Wölfflins Kunstgeschichtlichen Grundbegriffen – um nur einige Arbeiten zu nennen – bildet das Begriffspaar haptisch / taktil – optisch / malerisch und deren freilich unterschiedlich motivierte synthetische oder ausschließende Gruppierung ein wichtiges Mittel kunstgeschichtlicher Epochenbildung und / oder methodisch reflektierter Gegenstandscharakterisierung am Leitfaden ästhetiktheoretischen und physiologischen Wissens.20 Nach Wundt ist es jedoch für die Entwicklung der Phantasie in der Kunst unerheblich, dass die Entfaltung der menschlichen Sinnlichkeit vom Tastsinn zu den höheren Sinnesvermögen voranschreitet: Erst da, so Wundt, „wo die psychologische Organisation des Menschen längst ihr dauerndes Gepräge empfangen hat“ (Wundt 1905, S. 90), da also, wo das habitualisierte Sinnenzusammenspiel voll funktionsfähig ist, könne auch der 20 Herders sich auf Ergebnisse des französischen und englischen Sensualismus stützende Invektiven gegen die erkenntnistheoretische Irrelevanz des Gesichtssinns ohne Führung durch den Tastsinn können als Geburtsstunde der kunstwissenschaftlichen Typologien des Haptischen und Optischen gelten (vgl. Herder 1892, S. 1–10). Vgl. zur Herders Konzeption des Plastischen im Kontext der körperlichen Sinnlichkeits- und phänomenologischen Leiblichkeitsdiskussion in der zweiten Hälfte des 18. Jahrhunderts und um 1900: Braungart 1995, S. 53–107, 123–148. Riegl chronologisiert die Entwicklung der bildenden Kunst des Altertums: Von ihren haptischen Anfängen (tastbare Festigkeit, Nahsicht) über eine haptisch-optische Phase (entfernte Nahsicht, beginnende Auflösung haptischer Konturen) bis hin zu ihrem rein optischen Abschluss (Fernsicht, optische Farbigkeit) macht er eine Reduktion von Plastizität aus (vgl. Riegl 1987, S. 32–36). Wölfflins Unterteilung in malerischen und linearen Stil variiert ebenfalls den Optik-Haptik-Dualismus. Hier als historisch wandelbare „Anschauungskategorien“ verstanden und dem jeweiligen gleichnamigen Stil zugeordnet, verläuft die Entgegensetzung ebenfalls über synthetische Mittelstufen von der Plastizität der Form zur malerischen impressio-Kunst der Malerei, wobei Wölfflin auch Zeichnung, Plastik und Architektur nach diesem Schema ordnet (vgl. Wölfflin 1957, S. 31–90).

248

Norman Kasper

Beginn der Phantasieentwicklung angesetzt und damit auch die Kunst auf diesbezügliche Entwicklungstendenzen befragt werden. Somit erübrigt sich für Wundt auch die Frage nach künstlerischen taktilen Urformen und darauf aufbauenden Typologien zu Zwecken kunstgeschichtlicher Systematik genauso, wie er eine reine Ornamentik ablehnt. Auch wenn Schmarsow die Implikationen von Wundts Phantasiekonzept ablehnt, so bezeichnet er zum einen die Lipps’sche Raumästhetik, auf der Wundts Raumphantasie basiert, als auch für Kunstwissenschaft relevant – ohne sie freilich produktionsästhetisch überlasten zu wollen (vgl. Schmarsow 1907, S. 325).21 Zum anderen lässt er Wundts genetische Methode gelten, nur müsse diese sich der Entwicklungsgeschichte der Ausdrucksbewegung annehmen: von den mimischen und gestischen Äußerungen bis zur Hochkunst. Auch innerhalb des künstlerischen Höhenkamms, wo die fortschreitende, immer mehr an Perfektion gewinnende Medialisierung zu einer „Ermäßigung der Affekte“ im Rahmen ihrer „geduldige[n] Übertragung in den Stoff“ führe, gleichsam „noch im erstarrten Niederschlag“ (S. 338), zeige sich Kunst als affektive Ausdrucksbewegung. Nicht nur mit Blick auf den Expressionismus erwies sich diese Deutung als brauchbar, wie Georg Simmels kunstgeschichtliche Einlassungen zeigen.22 Für Schmarsow gilt: Das „ursprüngliche Gefühl“ (S. 339) geht jeder möglichen Bezugnahme auf die Dinge der Außenwelt voran und auch da, wo die schöpferische Auseinandersetzung des Menschen mit der Welt Dinge der Außenwelt zeigt, bedient es sich dieser lediglich, um Affekte entladen zu können. Anschaulich verdeutlicht er die Koinzidenz von beginnender künstlerischer Weltaneignung und Ausdrucksbewegung an einem Beispiel, das der Kunstproduktion der Ur- oder Naturvölker entlehnt ist. [W]o das fleckige Fell des Jaguars in seiner farbigen Wirkung wiedergegeben wird, so ungeschickt es noch gelingen mag; wo die glühenden Augen des Raubtiers, die sich bei unerwarteter Begegnung im Dunkeln, mit Todesangst zugleich, in die Seele des Menschen gebohrt haben, hier in der Skizze wie riesengroße Glotzaugen aus dem Kopfe hervorstehen; wo die Schlange sich ringelt, in einer einzigen, ganz einfachen Bewegungslinie hingekritzelt: – da ist bildende Kunst im Keime, denn da ist Ausdrucksbewegung und Affektäußerung in eins. (S. 338)

Indem das Nachahmungsparadigma wegfällt, muss die Frage, ob der Auseinandersetzung mit der Welt künstlerische Legitimität zukommt, anhand an21 Eine einfühlungsästhetische Begründung entwicklungsgeschichtlicher Zusammenhänge macht Schmarsow nur am Rande, das heißt ohne systematische Funktionsstellung, geltend (vgl. Schmarsow 1910, S. 332f.; vgl. auch Nachtsheim 1984, S. 125f.). 22 Simmel ist der Ausdrucksbewegung im Barock auf der Spur: In lebensphilosophischer Akzentuierung spricht er ganz selbstverständlich vom „Wesen der Rembrandtschen Ausdrucksbewegung“, das er in der Umkehrung des „‚fruchtbaren Momentes‘“ ausmacht: Fehlende Prägnanz, Bewegtheit, unklassische Formlosigkeit, Affekt, unmittelbare Gegenwart und Lebensintensität, „ein kontinuierliches und kontinuierlich formwechselndes Strömen“ seien für Rembrandts Porträtmalerei charakteristisch (Simmel 2003, S. 315, vgl. auch S. 313–317).

Genetische Methode oder „Instinktschöpfung“

249

derer Kriterien erfolgen. Bei Schmarsow ist es der Notwendigkeitscharakter der Ausdrucksbewegung, dem nicht nur bei der Entstehung der bildenden Künste, sondern generell bei der Klassifizierung dessen, was bildende Kunst sei, Bedeutung zukommt. Notwendigkeitscharakter tragen die Ausdrucksbewegungen der Jaguar- und Schlangendarstellungen insofern, als sie Produkte der unmittelbaren „Todesangst“ sind. Jene existentielle Angst ist mit Blick auf ihren Darstellungsmodus nicht verhandelbar: Da, wo die Schlange als „Bewegungslinie hingekritzelt“ oder wo der Augenkontakt mit dem Raubtier die Furcht bekräftigt, ist jegliche auf mimetische Kohärenz drängende Reflexion (wie auch freilich jede Lust am Vergleichen) suspendiert, und die Angst spricht sich durch die Darstellung aus. Die Ausdrucksbewegung wird zu einer authentischen, alternativlosen und auf Entladung drängenden Gebärde der Angst; gerade darin besteht ihr Notwendigkeitswert. Schmarsow läuft bereits hier Gefahr, die geforderte künstlerische Entwicklungsgeschichte der Ausdrucksbewegung zu einer Fixierung anthropologischer Universalien zu verkürzen. Angst oder Trauer, Liebe oder Freude gilt es als unveräußerliche, ursprüngliche Gefühle und innere Erlebnisse in der Kunst auszumachen. Einher geht die Verpflichtung der Ausdrucksbewegung auf Notwendigkeitswerte im Sinne affektiv-seelischer Dispositionen mit der Begründung der menschlichen Natur als Notwendigkeitswert an sich, der sich in das Kunstwerk einschreibt. Deutlich wird dies wiederum an den entstehungsgeschichtlichen Einlassungen zur Ornamentkunst. Schmarsow kritisiert Wundts Rückführung des Ornaments auf eine ihm vorgängige Wirklichkeit, die als „Urbild“ im „Naturding“ bereit liege und lediglich instantiiert werde. Damit setze Wundt, so Schmarsows Kritik am Stufenschema, „für die Genesis der Ornamentik die Präexistenz der darstellenden Kunst voraus (Malerei, Zeichnung u. s.w.)“ (Schmarsow 1907, S. 473). Als „primäre[r] Reiz“ könne vielmehr ein inneres, nicht mit „nachahmlichen Naturgegenständen“ verbundenes „Erlebnis psychischer Art […] die Reaktion auslösen, die in Form von Ausdrucksbewegungen hervordrängt“ (S. 473f.). Reiz versteht Schmarsow hier als psychophysiologische Informationskette: Der innerliche Reiz kann „etwa auf chemischem Wege, in einem Organ“ entstehen und nun – unkontrollierbar – auf Entäußerung drängen. Dass sich die Ornamentkunst tatsächlich als Wirkung körpereigener Reiz-Reaktions-Schemata verstehen lässt, verdeutlicht Schmarsows Vergleich von Mensch und Ornament im Topos des Rhythmisch-Regelmäßigen: „Die Abhängigkeit der Ausdrucksbewegung von der leiblichen Organisation und damit die Anlage für rhythmischen Verlauf und gleichmäßige Wiederkehr“ verweise auf eine „naturgesetzlich geregelte Gebärdung“ (S. 474) ornamentaler Kunst. Wundt hatte im ersten Band seiner Völkerpsychologie Ausdrucksbewegungen als „psychophysische Functionen“ (Wundt 1900, S. 84)23 23 Wundt bezieht sich hier auf die deutsche Übersetzung von Spencers Principles of Psychology (1870–1872) (vgl. Spencer 1886, 610ff.).

250

Norman Kasper

verstanden und Herbert Spencers allerdings nicht sehr positiv gewertete Auffassung diskutiert, dass Empfindungen, Vorstellungen, Gefühle und Affekte nichts anderes seien als „Begleiterscheinung[en] irgend einer Molecularbewegung innerhalb des Nervensystems, die eine auf den übrigen Körper ausstrahlende nervöse Entladung“ (S. 69) förderten. Schmarsow geht nun gleichsam mit Wundt über Wundt hinaus, wenn er die Ornamentkunst in der psychophysiologischen Organisation des Menschen fundiert und damit den leiblichen Konstitutions- den Rang transzendentaler Entstehungsbedingungen verleiht. Weniger entwicklungsgeschichtlich nachweisbare formale Ausdifferenzierungsprozesse spielen die Hauptrolle, sondern jene durch die conditio humana formulierten Gebärdungs- und Entladungsnotwendigkeiten.

III. Wollen oder Ausdruck: Worringers stilpsychologisches Abstraktionskonzept III.1 Mythopoetisches Triebwollen und Abstraktion als Geburt Im gleichen Jahr, 1907, in dem Schmarsow die Auseinandersetzung mit Wundt, seinem Leipziger Kollegen, in der Zeitschrift für Ästhetik und Allgemeine Kunstwissenschaft veröffentlichte, verteidigte Wilhelm Worringer seine Dissertation mit dem Titel Abstraktion und Einfühlung. Ein Beitrag zur Stilpsychologie in Bern. In dieser Schrift wird die genetische Methode endgültig verabschiedet und durch eine evolutionsbiologische und evolutionspsychologische Argumentation der Polarisierung ersetzt, die jenen bereits bei Schmarsow beobachteten Notwendigkeitscharakter des künstlerischen Ausdrucks radikalisiert. Grundsätzlich lassen sich bei Worringer zwei Abstraktionsbegriffe aufzeigen, die unterschiedliche Anleihen bei Riegls, Wundts und Schmarsows produktionsästhetischem Argumentationsreservoir machen. Zum einen geht es um die Konzeption der geometrisch-kristallinen Abstraktion, zum anderen um die Vorstellung einer expressiven Abstraktion.24 Verweist erstere unter selbstbewusster Kontextualisierung auf eine Neuakzentuierung von Riegls Kunstwollen, so steht die expressive Abstraktion unter deutlichem Einfluss des Ausdrucksparadigmas wie auch der Einfühlungsästhetik. Zunächst zur geometrisch-kristallinen Abstraktion. Schmarsow lehnt das in den Jahren nach 1900 sehr beliebte Konzept des Kunstwollens in seiner einflussreichen Fassung durch Riegl als unpsychologisch und unphilosophisch ab (vgl. Schmarsow 1907, S. 484)25, auch wenn 24 So die typologische Unterteilung von Öhlschläger 2005, S. 27f. 25 Schmarsows Vorwurf einer fehlenden psychologischen Fundierung des Kunstwollens überrascht insofern, als dass im Rahmen einer ersten historiographischen Betrachtung dieses Konzeptes durch Panofsky eben jene von Schmarsow in Abrede gestellte psychologische Begriffsdimension als wichtiges, allerdings nicht sehr positiv bewertetes Charakteristikum des Kunstwollens gewertet wird. Daraus ergibt sich für Panofsky die Notwendigkeit begriffssemantischer Ände-

Genetische Methode oder „Instinktschöpfung“

251

er – gleich Worringer – die damit benannte Grundtendenz kunstwissenschaftlichen Selbstverständnisses durchaus teilt. Nach Riegl können Herstellungsbedingungen sowie Material- und Technikfragen bei der Entstehung von Kunst keine schöpferische Rolle zugestanden werden. Schöpferisch sei vielmehr der sich in das Material entäußernde Wille des Künstlers, der mit diesem ringe und so Form werde. Hier knüpft Worringer an. Jedoch gibt er der voluntaristischen Akzentuierung der Kunstproduktion eine triebtheoretisch-evolutionsbiologische Dimension, indem er die ornamentale Form der „geometrischen Abstraktion“ als „Instinktschöpfung“ deutet, die an die „Voraussetzung unseres Organismus“ (Worringer 2007, S. 98) rückgebunden bleibt. Worringer formuliert zunächst in der Distanz suggerierenden 3. Person Singular Konjunktiv abstraktionstheoretische Spekulationen, die er der Denkweise eines „überzeugte[n] Evolutionist[en]“ (S. 97) zuordnet: Der Abstraktionsdrang, wie er sich in der Ornamentik eines Volkes als absolutes Kunstwollen am reinsten zeige, könne demnach als eine „Instinktschöpfung“ des Menschen, mithin als eine Reaktion auf die Differenzierung der organisierten Materie aufgefasst werden. Da dem Bauprogramm des Menschen noch die Bildungsgesetze der anorganischen Natur inhärierten, zeitigten die durch eine „Höherentwicklung des Organismus“ verursachten „Schmerzen des Gebärens“ eine „Rückwärtssehnsucht“, die zum abstraktkristallin-anorganischen Ornament tendiere. In Anschauung dieser „abstrakten Gesetzmäßigkeit“, der „einfachsten Formel“, des „letzten Bildungsgesetzes“ könne sich der Mensch von seiner „Differenzierung“ (S. 97f.)26 ausruhen. Was Worringer an dieser Argumentation reizt, ist der – nun den Leser durch die 1. Person Plural mit einbeziehende – Notwendigkeitswert des Abstrakt-Geometrischen, den „wir aus den Voraussetzungen unseres Organismus heraus fühlen“ (S. 98). Abstraktions- und Einfühlungsbedürfnis rühren von einem unterschiedlichen Verhältnis des Menschen zur Welt der Erscheinungen her. Nach Worringer sind beide Weltverhaltungsarten Modi des menschlichen Selbstentäußerungsbedürfnisses, die sich ihrer Intensität und Entstehung nach unterscheiden lassen. Während sich im Einfühlungsdrang die ruhige Vertrautheit des Menschen mit den Erscheinungen der Außenwelt zeige, seine Begegnung mit dem „Organisch-Lebenswahre[n]“ (Worringer 2007, S. 91), fuße der ursprünglichere Abstraktionsdrang auf den Ausschließungsbemühungen alles Organischen. Die psychischen Voraussetzungen des Abrungen. Vgl. generell zu einer Kritik am Kunstwollen, auch an dessen Anverwandlung durch Worringer und einer neukantianisch-antipsychologischen Umakzentuierung Panofsky 1985, S. 29–43. Schmarsow wandte sich bereits in seinen Grundbegriffen der Kunstwissenschaft (1905) gegen Riegls teleologische Fundierung des Kunstwollens, jedoch ohne den Begriff selbst abzulehnen (vgl. Schmarsow 1998, S. 5). 26 Lang sieht die Entstehung des Kunstschaffens bei Worringer dort begründet, „wo evolutionsbiologisch der Mensch sich vom Tier schied“ (Lang 2002, S. 91).

252

Norman Kasper

straktionsdranges sind in einem bestimmten Weltgefühl zu suchen: Der Wunsch nach einem Weglassen und nach einer konzentrierten Reduktion auf das Wesentliche ist die „Folge einer großen inneren Beunruhigung des Menschen durch die Erscheinung der Außenwelt.“ Als Impulse künstlerischen Schaffens firmieren somit eine „geistige Raumscheu“ und „Angstgefühl[e]“ (S. 82). Bereits Schmarsow fundierte die Affekte der Ausdrucksbewegung in der Angst des Menschen angesichts des Todes. Bei Worringer geht es nun um eine Art geistiger Ur-Angst angesichts des Menschseins in einer Welt der Erscheinungen. Schmarsow wies auf die von Wundt übergangene entscheidende Bedeutung des Übergangs von einer haptischen zu einer optischen Welterfahrung hin, die Worringer argumentativ fruchtbar macht. Als sich der Mensch auf einer niederen Entwicklungsstufe befand, so Worringer, war er in seiner ständigen Angst, angesichts der Fülle der wechselnden Erscheinungen, auf den Tastsinn angewiesen, um das „Ding an sich“ im Raum bestätigen zu können. Beim Übergang von der haptischen zur optischen Welterfahrung nun – der Mensch wird „Zweifüßler“ – bleiben Spuren jenes Unsicherheitsgefühls zurück. Neben dem primitiven gibt vor allem der orientalische Mensch ein Zeugnis von der Reaktion auf die „unergründlich[e] Verworrenheit aller Lebenserscheinungen“ (Worringer 2007, S. 82): indem er versucht, „das einzelne Ding der Außenwelt aus seiner Willkürlichkeit und scheinbaren Zufälligkeit herauszunehmen, es durch Annäherung an abstrakte Formen zu verewigen und auf die Weise einen Ruhepunkt in der Erscheinungen Flucht zu finden“ (S. 83). Besonders dem sich einem „absoluten Werte“ (ebd., Hervorhebung im Original) annähernden abstrakt-geometrischen Ornament gelinge die Erlösung vom Erscheinungsraum durch die Fixierung der Außenweltobjekte in der Fläche. Dabei geht es Worringer nicht um eine sinnliche Haptik, sondern um eine „ins Geistige hinein verlagerte Begegnung mit dem Stofflichen“ (Öhlschläger 2005, S. 44). Der Instinkt für das abstrakt-kristalline „Ding an sich“ vermittelt sich durch jene evolutionsbiologisch begründete Regressionssehnsucht, die den Menschen in den Zustand vor jeglicher schmerzlicher Differenzierung – gleichsam mit der anorganischen Materie auf Augenhöhe – zurückführt und ihn so zum Geburtshelfer ontologisch verbürgter Objektstrukturen macht, die der Fülle der Erscheinungswelt trotzen. Die von Schmarsow als unvereinbar gegenübergestellten Modelle einer rationalistischen Nachahmungsästhetik und einer psychologischen Ästhetik der Ausdrucksbewegung werden so von Worringer synthetisiert. Schmarsow lehnte bei der Bewertung künstlerischer Produkte die Orientierung am Nachahmungsgedanken ab, da hier intellektuellen und nicht affektiven Valenzen das Begründungsmoment zukomme. Worringer ersetzt nun jene über die ratio vermittelten geometrischen Urbilder der aufklärerischen Repräsentationsästhetik durch eine biologistische Triebgeburt, die das flüchtige Ding der Außenwelt – gleich geometrischer Abstraktionskunst durch den

Genetische Methode oder „Instinktschöpfung“

253

Verstand – in seinem Wesen, nicht in seiner Erscheinungswirklichkeit bestätigt.27 Auf die gleiche Weise „wie Faust zu den Müttern hinabstieg“ (Worringer 1912, S. 15), so Worringers mythopoetische Triebpsychologie, anerkennt der Mensch durch seinen Instinkt die sinnlichen und intellektuellen Schranken und steigt zu jenen Notwendigkeitswerten hinab, die das geistige Angstverhältnis zur Welt der Erscheinungen mildern, indem sie den Ausgang aus der platonischen Höhle in der Bändigung der Dinge in der Fläche ermöglichen. III.2 Ausdrucksbewegung und reine Abstraktion Worringer will von einer „autochthonen, aus der inneren Organisation des Menschen herausfließenden Entstehung der geometrischen Form“ ausgehen; eine Einstellung, die er durch „die Suggestion darwinistischer Gedanken“ (Worringer 1914, S. 222f.) und deren interdisziplinärer Sogwirkung im wissenschaftlichen mainstream bedroht sieht. Doch nicht nur sein Konzept des geometrisch-kristallin-abstrakten Kunstwollens ist an eine Instantiierung durch eine körperliche Triebgeistigkeit gebunden. Auch die expressive Abstraktion, die an das Ausdrucksparadigma anknüpft, begründet sich über ein leibliches Entäußerungsbedürfnis.28 Im Gegensatz zum ägyptischen und vor allen Dingen zum orientalischen Menschen, lässt der nordische jede Notwendigkeitswerte bedingende instinktive Abstraktionssicherheit vermissen und verfügt auch nicht, wie der klassische, über ein ruhiges Einverständnis mit der Erscheinungswelt, das ihm eine einfühlende Selbstentäußerung erlauben würde (vgl. Worringer 2007, S. 150–161, 127f.).29 Die Einsicht, dass „gleichsam nur das Material zur Abstraktion gegeben“ sei, „nicht aber die Abstraktion selbst“, verbindet Worringer mit der Beobachtung einer auf „anorganischer Grundlage […] gesteigerte[n] Bewegung“ (S. 152) ornamentaler Linienführung. In der ihr zugeschriebenen Expressivität führt diese Bewegung zu einem an die „Einfühlung“ gebundenen ungeheuren „Vitalgefühl“ (Worringer 1912, S. 31), das eigentlich nur der organischen Welt zukommt und insofern innerhalb des anorganischen Umfeldes überrascht. In dieser unversöhnlichen und un27 Jutta Müller-Tamm verdeutlicht die Parallelen und Unterschiede von logisch-philosophischem und ästhetischem Abstraktionsbegriff anhand der Pole Kant (essentialistische Abstraktion als Reduktion) und Worringer (konstruktivistisch-biologistische Abstraktion als Geburt) (vgl. Müller-Tamm 2007). 28 Hilmar Frank weist darauf hin, dass die Vorgeschichte der expressiven Abstraktion bisher ungeschrieben ist. Die unzweifelhafte Bedeutung, die die „Ausdrucksbewegung“ in terminologischer und wissensgeschichtlicher Hinsicht bei einer derartigen Aufklärung spielen könnte, wird von ihm nicht diskutiert. Seine Gewährsmänner Carl Friedrich von Rumohr und Oskar Panizza geben dafür allerdings auch keinen Anlass (vgl. Frank 2002, S. 76). 29 Worringer sieht die Einteilung in Menschheitstypen nur von einem heuristischen Standpunkt aus gerechtfertigt. Diese Typen seien lediglich „irreale Konstruktionen einer großzügigen Beweisführung“ (Worringer 1912, S. 13).

254

Norman Kasper

vermittelten Verbindung von Ausdruck und Abstraktion zeigt sich nach Worringer die „geheime Gotik der frühen nordischen Ornamentik“ (S. 27– 35). Dass die Linie einer „erhabene[n] Hysterie“ durch „Rauschsucht“ (S. 50)30 „in wirren Zuckungen verendet oder unbefriedigt im Leeren abbricht oder sinnlos in sich selbst verläuft“ (S. 32), wie Worringer in unermüdlicher Fabulierlust verdeutlicht, lasse auf den Ausdruck seelischer Not schließen. Auch wenn Worringer hier weiterhin von Kunstwollen spricht, lässt sich doch das, was er meint, angemessener als eine über die Einfühlungsästhetik begründete Ausdrucksbewegung verstehen. Die Expressivität der Linie, der „Eigenausdruck“, ist nämlich nichts anderes als die im Rahmen einer psychologischen Einfühlung dem anorganischen Liniengewirr zugeschriebene eigene Vitalität. Dieses Vitalgefühl gehe zum Beispiel beim Zeichnen von Rundkurven als Glücksgefühl in die Linien ein, so dass die ruhige Mühelosigkeit der Entstehung wirkungsästhetisch bestätigt wird. Das gleiche zeige sich – nun ins Gegenteil gekehrt – bei nicht „organisch temperierten Kurven“, die zackig, eckig und fahrig von ungeheurer „Ausdruckswucht“ zeugten und bei deren Anschauung sich ebenfalls die seelisch-produktionsästhetischen Prämissen nachvollziehen lassen: „Denn auch hier schreiben wir die bei der Apperzeption der Linie nachgefühlten Entstehungsvorgänge ihr als Ausdruck zu.“ (Worringer 1912, S. 34). Dieser Ausdruck ist damit – gleich einfühlungsästhetisch-harmonischen Projektionsdenkens – eine Zuschreibung des Subjektes.31 Worringers Entwurf einer expressiven Abstraktion verweist somit deutlich auf die bereits diskutierten Positionen Wundts und Schmarsows. Wundt war bereits darauf gestoßen, dass geometrisierte Naturdarstellungen, denen eigentlich nur mehr formmotivische Geltung zukommt, im Rahmen der Anschauung eine organische Wirkung entfalten können. Demnach lässt sich zwar bei einer formimmanenten Entwicklungsgeschichte der Ornamentik jene von Worringer kritisierte Abfolge vom Organischen (Nachahmung) zum Anorganischen (geometrische Stilisierung) beobachten, 30 Vgl. zur geschlechtsspezifischen Codierung einer Metaphorologie des Pathologischen ausgehend von Worringer Hufnagel 2002 (vgl. dazu auch Öhlschläger 2005, S. 57ff.). 31 Müller-Tamm analysiert Worringer im Gefolge von Georg Simmels Projektionsdenken. Dabei kann sie zum einen nachweisen, dass die von Worringer forcierte geistesgeschichtliche und stilpsychologische Entgegensetzung von Abstraktion und Einfühlung keinen Unterschied in der Wirkungsästhetik zu formulieren erlaubt. In dem Maße, wie auch der abstrakte Pol einfühlungsästhetisch fundiert ist, verliert sich der antithetische Charakter, gilt Abstraktion als Einfühlung. Damit einher geht das, was Müller-Tamm als „epistemologische[…] Enteignung“ bezeichnet. Demnach übernimmt das Abstraktionskonzept die einfühlungsästhetische Position, ästhetisches Verhalten sei eine vom Subjekt in das Kunstobjekt projizierte Empfindung, indem die Geburt des abstrakt-kristallinen Ornaments in die subjektive Triebstruktur des Menschen verlegt wird. Allerdings unterscheidet Müller-Tamm nicht konsequent zwischen expressiver und geometrisch-kristalliner Abstraktion. Explizit von Worringer reflektiert wird die einfühlungsästhetische Konkretisierung der Abstraktion nur in deren expressiver Variante (vgl. Müller-Tamm 2005, S. 264-287).

Genetische Methode oder „Instinktschöpfung“

255

doch unter einfühlungsästhetischem Fokus wirkt das Anorganische organisch (vgl. Wundt 1905, S. 291).32 Genau hier knüpft Worringer an, wenn er die Wirkung der nordischen Ornamentik als Verbindung von anorganischer Abstraktion und organischem Ausdruck, von gesteigerter Bewegung auf anorganischer Grundlage deutet. Die Stilpsychologie bekommt so in den Griff, was der Völkerpsychologie versagt war: die Erklärung und Begründung von produktionsästhetischen auf der Grundlage wirkungsästhetischer Prämissen. Deutliche Parallelen weist Worringers Konzept eines expressiven Kunstwollens auch zu Schmarsows Ausdrucksbewegung auf. Gleich Schmarsow geht es Worringer um „motorische Regungen und dunkle augenlose Gefühle“ (Schmarsow 1922, S. 94), die als „inneres Ausdrucksbedürfnis“ (Worringer 2007, S. 152) – der Terminus Ausdrucksbewegung findet sich bei Worringer nicht – das Ornament konstituieren. Auch bei Schmarsow soll das Expressive in historischer, entwicklungsgeschichtlicher und gemeinschaftspsychologischer Perspektive Aufschluss geben. Dies jedoch ohne dass ihm der stilpsychologische Status der Akzentuierung eines Weltgefühls zukäme, oder wie es Worringer formuliert, sich am Faden seiner Entwicklungsgeschichte gar „Kunstwissenschaft als Menschheitspsychologie“ (Worringer 1912, S. 10) betreiben ließe, die der Religions- und Mythengeschichte ebenbürtig wäre. Worringer überbetont gleichsam die künstlerische Ausdrucksdimension, wenn er jenes durch das Ausdrucksbedürfnis Realisierte vollkommen in seiner Triebhaftigkeit aufgehen sieht33 – und jenem Triebmoment gleichzeitig eine beispiellose historische Signifikanz zusprechen will. Schmarsow hingegen – hierin ganz Kunstwissenschaftler in der Tradition Riegls – erwartet sich von der Analyse der Ausdrucksbewegung keine über das Kunstwerk und dessen Historisierung hinausgehenden mentalitätspsychologischen Aufschlüsse im Sinne von Worringers heuristischen Anthropologien (der Orientale, der Grieche, der Primitive usw.). Gleichwohl – wir hatten darauf hingewiesen – ist auch Schmarsows Argumentation nicht frei von einer Fundierung der Ausdrucksbewegung im Rückgriff auf vermeintliche anthropologische Universalien. 32 Vgl. insgesamt dazu Kap. I.1. 33 Vgl. dazu etwas spöttisch Kemp 2002, S. 16f. Kemps wertnormative Hierarchisierung von negativ bewertetem ausdruckstheoretischem (Worringer) und zustimmend diskutiertem strukturalistischem (Schmarsow, vgl. S. 18–20) Ansatz ist jedoch problematisch. Dies nicht nur, wie Kemp selbst einräumt, da Schmarsow vom struktural-formalen Argumentieren zu einem eher ausdruckstheoretisch fundierten wechselt – und dies nicht allein in dem von Kemp herangezogenen Aufsatz. Problematisch ist vielmehr, dass Kemps behauptete Anschlussfähigkeit der „Ausdrucksbewegung“ an den Expressionismus die lange und durchaus „unmodische“ Vorgeschichte dieses Paradigmas, etwa bei Wundt, nicht erwähnt und somit den Eindruck erweckt, Schmarsow und mehr noch Worringer würden hier lediglich dem kunstpopulistischen Zeitgeist Tribut zollen.

256

Norman Kasper

IV. Stil- als Völkerpsychologie? Zusammenfassung Die untergründige Verbindung von Völker- und Stilpsychologie lässt sich in einem unleugbaren Überbietungsgestus ausmachen, mit der Worringer den Ergebnissen der Gemeinschaftspsychologie des 19. und frühen 20. Jahrhunderts entgegentritt (vgl. Öhlschläger 2005, S. 24f.; Böhringer 2002, S. 39–41). Damit verbunden ist das Primat eines deduktiven Erkenntnisgewinns. Worringers Kunstwollen wie auch sein Ausdrucksbedürfnis übernehmen die von der induktiven Feldforschung bereitgestellten Kategorien, ohne selbst induktiv zu begründen. Sowohl Abstraktion und Einfühlung wie auch die Formprobleme der Gotik beginnen mit theoretischen Setzungen, die im Folgenden jeweils mehr illustriert als bewiesen werden. Entscheidend für die Theorie ist die Verbindung von triebpsychologischer und mythopoetischer Argumentation. Diese erlaubt es, die Geistesgeschichte des Ornaments biologisch zu fundieren, ohne dabei den Entwicklungsbegriff Darwins und das Diktat der Naturwissenschaften, die bisher die genetische Methode als Erklärungsmuster ornamentaler Abhängigkeitsreihen förderten, mittragen zu müssen (vgl. Worringer 1914, S. 222f.). Darüber hinaus wendet sich der blind-bewusstseinslose Trieb gegen jene Schmerzen einer „Höherentwicklung des Organismus“ (Worringer 2007, S. 97), wie sie durch Darwins Evolutionstheorie und eine sich daraus ergebende Kränkung dem Menschen angetan wurden. Als aufgeklärtes Tier gleichsam vom „Ding an sich“ dezentriert, schafft er dieses aus sich selbst heraus (geometrisch-kristalline Abstraktion) oder verfällt in wahnhafte Wut (expressive Abstraktion). Freilich ist hier der Bruch mit der Völkerpsychologie Wundt’schen Zuschnitts vollzogen, auf die sich Schmarsow noch einlassen wollte. Schmarsow empfiehlt, das, was Wundt als Stufenschema der Phantasie entwirft, als ausdruckstheoretisch akzentuierte „Kunstpsychologie“ (Schmarsow 1907, S. 305) für die eigene Wissenschaft fruchtbar zu machen. Der Nutzen für die Kunstwissenschaft steht einer potentiellen Verwertung durch andere Disziplinen (Ethnologie, Archäologie) jedoch nicht im Weg. Dies kann man von Worringers Stilpsychologie nicht sagen, da hier Untersuchungsobjekte lediglich den Charakter einer originellen methodischen Selbstbestätigung geistesgeschichtlicher Großraumperiodisierungen auf Grundlage einer recht streng formulierten Antithetik bekommen. Doch nicht nur mit Blick auf die stilpsychologischen Arbeiten in der Nachfolge Worringers, wie Karl Schefflers Der Geist der Gotik (1917) oder Oswald Spenglers Der Untergang des Abendlandes (1918/1922), lässt sich die wandelfähige Verbindung von Formpsychologie und Geistesgeschichte nachweisen, sondern in erster Linie auch innerhalb seines eigenen Werks. So etwa, wenn Worringer in Abstraktion und Einfühlung die ägyptische Pyramide als Bestätigung des Abstraktionsdranges interpretiert, während er 20 Jahre später zu einem völlig anderen Ergebnis kommt. Die Pyramide gilt ihm nun als Beispiel trieblos-sachlicher Rationali-

Genetische Methode oder „Instinktschöpfung“

257

tät und einer vom Irrationalen unbeeinflussten, etwas gesichtslosen „Fähigkeit zur Konventionsbildung“. Der zwanglose Vergleich von ägyptischen Monumentalbauten mit moderner dänischer Sommerhausarchitektur und einem Modell des Berliner Flughafens Tempelhof soll für die Verbindung (neu-)sachlicher Rationalitätsstandards und mentalitätssoziologischer Parallelen über die Jahrtausende hinweg einstehen (vgl. Worringer 2007, S. 138f.; Worringer 1927, S. 25–30). Wofür die Pyramide nun steht, muss man wohl selbst entscheiden. Damit erweist sich Worringer zweifelsohne derjenigen Klasse von „Kunstphilosophen“ zugehörig, die sich nicht nur bei der Suche nach dem Beginn ornamentaler Kunst – wie Schmarsow spottet – „leicht in Abstraktionen verlieren“ (Schmarsow 1910, S. 192). Dennoch ist es keineswegs so, dass Worringers Arbeiten lediglich von Künstlern, Schriftstellern und Intellektuellen im Umfeld des Expressionismus begeistert aufgenommen wurden.34 Innerhalb der wissenschaftlich-disziplinären Ornamentforschung etwa beruft sich Frederik Adama van Scheltema auf Worringers Konzept einer expressiven Abstraktion. Von dezidiert kunstarchäologischer Seite bekräftigt er den latent gotischen Charakter germanischer Tierornamentik, wie Worringer ihn in den Formproblemen der Gotik entwarf. Ihn gilt es nun im Geiste Riegl’scher Stilfragen und ganz so wie es Schmarsow in den Anfangsgründen jeder Ornamentik skizzierte, bis in das „prähistorische Altertum“ zurückzuverfolgen. Das Ornament einer die Wurzeln der Gotik bis in die Vorgeschichte verlängernden „Kunst der abstrakten oder auch der absoluten Form“ (van Scheltema 1921, S. 446) entfaltet sich jedoch nicht als Triebgeburt, sondern im Rahmen der der Stein-, Bronze- und Eisenzeit zugeordneten Trias kristallinisch – vegetabilisch – animalisch / abstrakt. Hierbei hat das Kristallinische als Vorstufe des Organisch-Vegetabilischen mit Worringers Konzeption des Kristallinischen nichts zu tun, sondern bezeichnet lediglich eine den Bau des Gefäßes, auf das es angebracht ist, verdeutlichende Funktion der Ornamentik. Entscheidend ist: Die absolute Form bildet bei van Scheltema den Endpunkt der Entwicklung, nicht deren Beginn. Lässt die Sukzession der Stile Anklänge an Wundt und Riegl erkennen35, so ist doch die Begründung, die van Scheltema für den Wechsel von einer inhaltszu einer formalästhetischen Ornamentbestimmung liefert, ganz im Sinne Worringers. Jener sich bereits zu Beginn der Bronzezeit anbahnende, in der 34 Vgl. zur Aufnahme von Worringer im künstlerisch-intellektuellen Feld Bushart 1990, S. 18–25. Vgl. auch mit Blick auf die Entwicklung konstruktiver Konzepte im 20. Jahrhundert, ausgehend von Worringer, Masheck 1995. 35 „Innerhalb dieser drei Perioden der nordischen Entwicklung selber sind immer Entwicklungsphasen zu unterscheiden in dem Sinn, daß die späteren Phasen ein quantitatives Wachstum der in der ersten Phase neu erworbenen Grundformen aufweisen und zugleich eine qualitative Veränderung, die sich in einer zunehmenden Differenzierung und Selbstentfaltung der Teile äußert.“ (van Scheltema 1921, S. 447).

258

Norman Kasper

Eisenzeit dann vollumfänglich realisierende Wechsel, so die dezidiert stilpsychologische Argumentation, lasse auf einen entscheidenden Wandel im Verhältnis von Mensch und Welt sowie Mensch und Tod schließen. Der vom Gegenstand losgelösten und gegenüber diesem immer gleichgültiger werdenden Form, die – in einfühlungsästhetischer Hinsicht – an „Leben“ dazu gewinnt, entspricht in glaubenssoziologischer Perspektive der Wandel von der Leichenbestattung zur Leichenverbrennung: [A]uch hier offenbart sich die Überzeugung, daß die Quelle der geistigen Kräfte nicht mehr identisch und nicht mehr unlösbar verknüpft ist mit dem natürlich gegebenen Körper. Die Emanzipation des Ornaments als geistige Form vom natürlichen Körper des Trägers bedeutet den Glauben an die Selbständigkeit des Geistes in Beziehung zum Körper, den Glauben an die Selbständigkeit der Seele. (van Scheltema 1921, S. 451f.)

Der Sieg der Seele über die gegenständlichen Fesseln des Körpers zeigt sich so in der Freisetzung der Form von ihrer bezeichnenden Gegenständlichkeit. Doch nicht nur Worringer kommt hier zu seinem Recht. Die Unterteilung in eine an den Körper gebundene Organseele und eine von diesem ablösbare Geistseele (Psyche), die van Scheltema auf die beginnende bronzezeitliche Abstraktion der Ornamentkunst bezieht, findet sich bei Wundt ausgearbeitet (vgl. Allesch 2006, S. 159f.). Sieht man in der Stilpsychologie demnach eine entwicklungs- und geistesgeschichtliche Konkretisierung völkerpsychologischer Annahmen, so lassen sich verbindende Argumentationsmuster deutlich machen, die auf einen interdisziplinären, wechselseitigen Beglaubigungshorizont angewiesen sind.

Literaturverzeichnis Allesch, Christian G., „Das Forschungsfeld ,Mythus‘ bei Wilhelm Wundt“, in: Wilhelm Wundts anderes Erbe. Ein Missverständnis löst sich auf, hg. von Gerd Jüttemann, Göttingen: Vandenhoeck & Ruprecht, 2006, S. 156–166. Boehm, Gottfried, „Einleitung“, in: Konrad Fiedler. Schriften zur Kunst I. Text nach der Münchner Ausgabe 1913/14, mit weiteren Texten aus Zeitschriften und dem Nachlass, einer einleitenden Abhandlung und einer Bibliographie hg. von Gottfried Boehm, München: Fink, 21991, S. XLV–XCVII. Böhringer, Hannes, „,Der Limes zwischen uns‘. Worringers Geschichtsphilosophie“, in: Wilhelm Worringers Kunstgeschichte, hg. von H. Böhringer und Beate Söntgen, München: Fink, 2002, S. 35–43. Braungart, Georg, Leibhafter Sinn. Der andere Diskurs der Moderne, Tübingen: Niemeyer, 1995. Brüderlein, Markus / Fondation Beyeler (Hg.), Ornament und Abstraktion. Kunst der Kulturen, Moderne und Gegenwart im Dialog, Ostfildern: DuMont, 2001. Bushart, Magdalena, Der Geist der Gotik und die expressionistische Kunst, München: Schreiber, 1990.

Genetische Methode oder „Instinktschöpfung“

259

Drüe, Hermann, „Wilhelm Wundt als Ästhetiker“, in: Fortschritte der Kunstpsychologie, hg. von Manfred Hahn und Martin Schuster, Frankfurt/M. et al.: Lang, 1980, S. 145– 173. –, „Die psychologische Ästhetik im Deutschen Kaiserreich“, in: Ideengeschichte und Kunstwissenschaft. Philosophie und bildende Kunst im Kaiserreich, hg. von Ekkehard Mai, Stephan Waetzoldt und Gerd Wolandt, Berlin: Gebr. Mann, 1983 (= Kunst, Kultur und Politik im Deutschen Kaiserreich, Bd. 3), S. 71–98. Fiedler, Konrad, „Kunsttheorie und Aesthetik“, in: Schriften zur Kunst II. Text nach der Münchner Ausgabe 1913/14, mit weiteren Texten aus Zeitschriften und dem Nachlass, einer einleitenden Abhandlung und einer Bibliographie hg. von Gottfried Boehm, München: Fink, 21991, S. 9–24. Frank, Hilmar, „Die missverstandene Antithese. Zur logischen Struktur von Abstraktion und Einfühlung“, in: Wilhelm Worringers Kunstgeschichte, hg. von Hannes Böhringer und Beate Söntgen, München: Fink, 2002, S. 67–80. Frank, Isabella / Freia Hartung (Hg.), Die Rhetorik des Ornaments, München: Fink, 2001. Grosse, Ernst, Die Anfänge der Kunst, Freiburg/Br.: Mohr, 1894. Herder, Johann Gottfried, „Plastik. Einige Wahrnehmungen über Form und Gestalt aus Pygmalions bildendem Traume [1778]“, in: Sämtliche Werke. Bd. 8, hg. von Bernhard Suphan, Berlin: Weidmann, 1892, S. 1–87. Hirn, Yrjö, Der Ursprung der Kunst. Eine Untersuchung ihrer psychischen und sozialen Ursachen, Leipzig: Barth, 1904. Hufnagel, Cordula, „Die hysterische Linie der Gotik“, in: Wilhelm Worringers Kunstgeschichte, hg. von Hannes Böhringer und Beate Söntgen, München: Fink, 2002, S. 45– 54. Iversen, Margeret, Alois Riegl: Art History and Theory, Cambridge, MA, London: MIT, 1993. Kant, Immanuel, „Kritik der Urteilskraft“, in: Werke in 6 Bänden. Bd. 5, hg. von Wilhelm Weischedel, Darmstadt: Wissenschaftliche Buchgesellschaft, 1983, S. 237–620. Kemp, Wolfgang, „Der Über-Stil: Zu Worringers Gotik“, in: Wilhelm Worringers Kunstgeschichte, hg. von Hannes Böhringer und Beate Söntgen, München: Fink, 2002, S. 9– 21. Koch-Grünberg, Theodor, Die Anfänge der Kunst im Urwald. Indianer-Handzeichnungen auf seinen Reisen in Brasilien gesammelt, Berlin: Wasmuth, 1905. Kroll, Frank-Lothar, Das Ornament in der Kunsttheorie des 19. Jahrhunderts, Hildesheim et al.: Olms, 1987 (= Studien zur Kunstgeschichte, Bd. 42). Lang, Siegfried K., „Wilhelm Worringers Abstraktion und Einfühlung. Entstehung und Bedeutung“, in: Wilhelm Worringers Kunstgeschichte, hg. von Hannes Böhringer und Beate Söntgen, München: Fink, 2002, S. 81–117. Lipps, Theodor, Raumästhetik und geometrisch-optische Täuschungen, Leipzig: Barth, 1897. –, Ästhetik. Psychologie des Schönen und der Kunst. Bd. 1: Grundlegung der Ästhetik, Hamburg, Leipzig: Voss, 1903. –, Ästhetik. Psychologie des Schönen und der Kunst. Bd. 2: Die ästhetische Betrachtung und die bildende Kunst, Hamburg, Leipzig: Voss, 1906. Majetschak, Stefan, „Arbeit an der Sichtbarkeit“, in: Auge und Hand. Konrad Fiedlers Kunsttheorie im Kontext, hg. von S. Majetschak. München: Fink, 1997, S. 9–24 (= 1997a).

260

Norman Kasper

–, „Die Sprachlichkeit der Kunst. Konrad Fiedlers Sprach- und Kunsttheorie im Lichte der Sprachphilosophie Wilhelm von Humboldts“, in: Auge und Hand. Konrad Fiedlers Kunsttheorie im Kontext, hg. von S. Majetschak, München: Fink, 1997, S. 113–126 (= 1997b). Mallgrave, Harry Francis / Eleftherios Ikonomoú: „Introduction“, in: Empathy, Form, and Space: Problems in German Aesthetics, 1873–1893 (Texts and Documents), Santa Monica et al.: The Getty Center for the History of Art and the Humanities, 1994, S. 1–85. Masheck, Joseph, „Abstraction and Apathy: Crystalline Form in Expressionism and in the Minimalism of Tony Smith“, in: Invisible Cathedrals. The Expressionist Art History of Wilhelm Woringer, hg. von Neil H. Donahue, University Park, PA: Pennsylvania State UP, 1995, S. 41–68. Müller-Tamm, Jutta, Abstraktion als Einfühlung. Zur Denkfigur der Projektion in Psychophysiologie, Kulturtheorie, Ästhetik und Literatur der frühen Moderne, Freiburg i. Br.: Rombach, 2005. –, „Die ,Parforce-Souveränität des Autoriellen‘. Zur Diskursgeschichte des ästhetischen Abstraktionsbegriffs“, in: Struktur, Figur, Kontur. Abstraktion in Kunst und Lebenswissenschaft, hg. von Claudia Blümle und Armin Schäfer, Zürich, Berlin: diaphanes, 2007, S. 79–92. Nachtsheim, Stephan, Kunstphilosophie und empirische Kunstforschung 1870–1920, Berlin: Gebr. Mann, 1984 (= Kunst, Kultur und Politik im Deutschen Kaiserreich, Bd. 7). Öhlschläger, Claudia, Abstraktionsdrang. Wilhelm Worringer und der Geist der Moderne, München: Fink, 2005. Panofsky, Erwin, „Der Begriff des Kunstwollens [1920]“, in: Aufsätze zu Grundfragen der Kunstwissenschaft, hg. von Hariolf Oberer und Egon Verheyen, Berlin: Spiess, 1985, S. 29–43. Raulet, Gérard / Burghart Schmidt (Hg.), Vom Parergon zum Labyrinth. Untersuchungen zur kritischen Theorie des Ornaments, Wien et al.: Böhlau, 2001. Riegl, Alois, Stilfragen. Grundlegungen zu einer Geschichte der Ornamentik [1893], Berlin: R.C. Schmid, 21923. –, Spätrömische Kunstindustrie [1901]. Unveränderter fotomechanischer Nachdruck der 2. Aufl. Wien 1927. 5. unveränderte Aufl. Darmstadt: Wissenschaftliche Buchgesellschaft, 1987. –, „Naturwerk und Kunstwerk I [1901]“, in: Gesammelte Aufsätze, hg. von Artur Rosenauer, Wien: WUV, 1996, S. 49–61. Scheltema, F. Adama van, „Beiträge zur Lehre vom Ornament“, in: Zeitschrift für Ästhetik und Allgemeine Kunstwissenschaft 15 (1921), S. 404–453. Schmarsow, August, „Kunstwissenschaft und Völkerpsychologie. Ein Versuch zur Verständigung“, in: Zeitschrift für Ästhetik und Allgemeine Kunstwissenschaft 2 (1907), S. 305– 339, 469–500. –, „Anfangsgründe jeder Ornamentik“, in: Zeitschrift für Ästhetik und Allgemeine Kunstwissenschaft 5 (1910), S. 191–215, 321–355. –, „Entwicklungsphasen der germanischen Tierornamentik von der Völkerwanderung bis zur Wikingerzeit (IV.-IX. Jahrhundert)“, in: Jahrbuch der Königlich Preussischen Kunstsammlungen 32.2 (1911), S. 88–116; 32.3 (1911), S. 143–180. –, „Die reine Form in der Ornamentik aller Künste“, in: Zeitschrift für Ästhetik und Allgemeine Kunstwissenschaft 16 (1922), S. 491–500; 17 (1923), S. 1–17, 129–145, 209–234, 305–320; 18 (1924), S. 83–107.

Genetische Methode oder „Instinktschöpfung“

261

–, Grundbegriffe der Kunstwissenschaft. Am Übergang vom Altertum zum Mittelalter [1905]. Mit einem Nachwort von Eleftherios Ikonomoú, Berlin: Gebr. Mann, 1998. Schnädelbach, Herbert, „Die Abkehr von der Geschichte. Stichworte zum ‚Zeitgeist‘ im Kaiserreich“, in: Ideengeschichte und Kunstwissenschaft. Philosophie und bildende Kunst im Kaiserreich, hg. von Ekkehard Mai, Stephan Waetzoldt und Gerd Wolandt, Berlin: Gebr. Mann, 1983 (= Kunst, Kultur und Politik im Deutschen Kaiserreich, Bd. 3), S. 31– 43. Simmel, Georg, „Rembrandt. Ein kunstphilosophischer Versuch [1916]“, in: Gesamtausgabe, hg. von Otthein Rammstedt. Bd. 15, hg. von Uta Kösser et al., Frankfurt/M.: Suhrkamp, 2003, S. 303–515. Spencer, Herbert, Principien der Psychologie. 2. Bd. Nach der 3. engl. Ausg. übers. von B. Vetter, Stuttgart: Schweizerbart, 1886. Steinen, Karl von den, Unter den Naturvölkern Zentral-Brasiliens. Reiseschilderungen und Ergebnisse der zweiten Schingú-Expedition 1887-1888, Berlin: Reimer, 1894. Volkelt, Johannes, System der Ästhetik. Bd. 1: Grundlegung der Ästhetik, München: Beck, 1905. –, System der Ästhetik. Bd. 3: Kunstphilosophie und Metaphysik der Ästhetik, München: Beck, 1914. Wiesing, Lambert, Die Sichtbarkeit des Bildes. Geschichte und Perspektiven der formalen Ästhetik, Reinbek: Rowohlt, 1997. Wölfflin, Heinrich, Kunstgeschichtliche Grundbegriffe. Das Problem der Stilentwicklung in der neueren Kunst [1915], Darmstadt: Wissenschaftliche Buchgesellschaft, 111957. Worringer, Wilhelm, Formprobleme der Gotik [1911], München: Piper, 31912. –, „Entstehung und Gestaltungsprinzipien in der Ornamentik“, in: Kongress für Ästhetik und Allgemeine Kunstwissenschaft (Berlin 7.-9. Oktober 1913), hg. vom Ortsausschuss, Stuttgart: Enke, 1914, S. 222–231. –, Ägyptische Kunst. Probleme ihrer Wertung, München: Piper, 1927. –, Abstraktion und Einfühlung. Ein Beitrag zur Stilpsychologie [1908], hg. von Helga Grebing, München: Fink, 2007. Wundt, Wilhelm, Völkerpsychologie. Eine Untersuchung der Entwicklungsgesetze von Sprache, Mythus und Sitte. Bd. I/1: Die Sprache, Leipzig: Engelmann, 1900. –, Grundzüge der physiologischen Psychologie [1874]. Bd. 3, 5., erweiterte Aufl., Leipzig: Engelmann, 1903. –, Völkerpsychologie. Eine Untersuchung der Entwicklungsgesetze von Sprache, Mythus und Sitte. Bd. II/1: Mythus und Religion, Leipzig: Engelmann, 1905. Zeitler, Rudolf, „Richard Hamanns Buch der ‚Impressionismus in Leben und Kunst‘, 1907. Notizen zur Ideengeschichte“, in: Ideengeschichte und Kunstwissenschaft. Philosophie und bildende Kunst im Kaiserreich, hg. von Ekkehard Mai, Stephan Waetzoldt und Gerd Wolandt, Berlin: Gebr. Mann, 1983 (= Kunst, Kultur und Politik im Deutschen Kaiserreich, Bd. 3), S. 293–311.

262

Evolutive Kanonbildung? „Natur“ und „Kultur“ im Prozess literarischer Wertung Robert Charlier

I. Ansatz Der vorliegende Beitrag resümiert ausgewählte Ergebnisse meiner Forschungen zur Kanonbildung im Zeitalter der Globalisierung. Dabei rückt die Frage ins Zentrum, ob es sich bei kultureller Kanonbildung um ein Phänomen handelt, das mit naturhaften Prozessen verglichen und möglicherweise mit evolutiven Begriffen beschrieben werden kann. Dazu beleuchte ich zunächst die Theoriebildung in diesem Bereich: Werden literarische Kanones von Personen oder Institutionen „gemacht“, oder entstehen sie unabhängig von individuellen Absichten und subjektiven Werthandlungen? In einem weiteren Schritt frage ich nach den Chancen für evolutionstheoretische Erklärungen im Bereich der Kanonformation. Dabei wird zu prüfen sein, ob sich die technischen Möglichkeiten der Kanonisierung in den neuen digitalen Textmedien in Quantitäten bewegen, die eine evolutive Betrachtung erlauben. Ausgehend von diesem Aspekt der „markanten Masse“ dokumentiere ich einige Beispiele pseudo-evolutiver Goethe-Rezeption im Internet. Abschließend werde ich Erkenntnisse aus der quantitativen Namensforschung übertragen, um möglicherweise einem „Evolutionismus“ der deutschen Literaturgeschichtsschreibung auf die Spur zu kommen.

II. Kanonformation und Klassikerkonstruktion: „Schöpfung“ oder „Entwicklung“? Für die Formation von Kanones bzw. die Konstruktion von „Klassikern“ gelten je nach Lehrmeinung sehr unterschiedliche Faktoren als maßgeblich. Offenbar tendieren Literaturwissenschaftler – als (un)bewusste „Ästheten“ – zu Erklärungsansätzen, die vom autonomen Subjekt ausgehen oder ihm zumindest einen zentralen Platz einräumen (vgl. Charlier 2009).1 So entwerfen 1

Siehe auch unter http://www.klassikermacher.de (letzter Zugriff am 7.12.2011).

Evolutive Kanonbildung?

263

Renate von Heydebrand und Simone Winko eine Theorie literarischer Wertung, die auf der sogenannten Handlungstheorie basiert (vgl. von Heydebrand und Winko 1996). Darin steht der mündige Mensch als bewusst handelndes Individuum im Mittelpunkt. Literarische Urteile sind demzufolge menschliche Wertungsakte. Ästhetische oder literarische Qualität bilden keine objektiv messbaren Eigenschaften von sprachlichen Kunstwerken, sondern sind das Ergebnis relationaler Zuschreibungen. Um diese komplexen Prozesse nachvollziehbar zu machen, stecken die Autorinnen ein fein ausdifferenziertes Feld „axiologischer“ Kriterien ab, die ihrer Meinung nach für die Konstitution literarischer Wertung maßgeblich sind. Überindividuelle und meta-intentionale Faktoren begründet dieser Ansatz mit der Denkfigur von der „unsichtbaren Hand“ („invisible hand“), die auch auf dem literarischen Markt im Spiel sei. Damit adaptieren die Autorinnen einen Topos, der auf den schottischen Moralphilosophen und Ökonomen Adam Smith (1723–1790) zurückgeht (vgl. Winko 2002). Sozialwissenschaftler entwickeln hingegen lieber systemische Modelle zur Beschreibung von überindividuellen Prozessen. Subjektgläubigkeit gilt hier als quasi schöpfungstheoretische Voreingenommenheit. In diesem Sinne hat der Erziehungswissenschaftler Alfred K. Treml erste essayistische Ansätze zu einer entwicklungsorientierten Klassikertheorie vorgelegt (vgl. Treml 1997/99). Ausgehend von einer konstruktivistischen Erkenntnistheorie, greift er systemtheoretische Elemente auf, um die „Konstruktion von Klassikern“ aus der Perspektive der Evolutionstheorie zu betrachten. „Einflussreiche Semantik“ nennt Treml diejenigen Ideen und Werke, die sich innerhalb des kulturellen Gedächtnisses erfolgreich durchsetzen und über die Zeiten weitervererben. In diesem Kontext definiert er evolutionäre Entwicklungsstufen bei der Erhebung von Personen oder Texten zu „Klassikern“. Im Einzelnen erkennt Treml dabei folgende Gesetzmäßigkeiten kultureller Evolution: „Variation“, „Selektion“, „Reproduktion“ und „Stabilisierung“. Tremls Vorarbeiten zu einer evolutiven Klassikertheorie sind stellenweise sehr geistvoll und in jedem Fall höchst amüsant zu lesen. So erscheint z.B. sein Befund bemerkenswert, ein poetischer Text sei desto optimaler für ein „Überleben“ im kulturellen Gedächtnis geeignet, je vieldeutiger er konnotiere – sprich: je mehr zeitlose Projektionsfläche er anbiete. Unbehagen bereiten dem Literaturwissenschaftler allerdings Passagen wie diejenige über den (männlichen) Autor, dessen klassisches Prestige einzig und allein auf einer sinnentleerten Überschussproduktion von „Bedeutung“ beruhe, die ihn wie bei der sexuellen Selektion quasi zum Gewinner der Literaturgeschichte prädestiniere (vgl. Treml 2009).2 Das lyrische Gedicht als buntgespreiztes Gefieder eines „Dichtermännchens“ der Weltlite2

Vgl. insbesondere den Abschnitt über „Klassiker im Kontext der sexuellen Evolution“ (Treml 2009, S. 152–156).

264

Robert Charlier

ratur – solcher Literardarwinismus geht sicherlich nicht nur dem Germanisten zu weit. Dennoch lässt sich die Kernproblematik der vergleichsweise jungen und daher überschaubaren Theoriebildung in diesem Bereich im Anschluss an Treml treffend zusammenfassen: Handelt es sich bei Kanonbildungen um eine Herausbildung im Sinne einer kontingenten Entstehung, die sich nicht auf subjektive Absichten oder produktive Kausalitäten der Rezeption zurückführen lässt? Oder sind kanonisierte Autoren und Werke umgekehrt das Ergebnis fixierbarer ästhetischer Bewertungen auf dem Wege von Willensentscheidungen – geht es also um eine subjektive bzw. intersubjektive Herstellung ?

III. Neue Medien und „alte“ Kanonpraxis Das Projekt von Google Book Search bevorzugt mit dem Versuch, das Menschheitswissen in Form einer virtuellen Weltbibliothek zu kanonisieren, rechtefreie oder vergriffene Bücher und damit im weitesten Sinne ältere Literatur- und Wissensbestände (vgl. Charlier 2008). Dies geschieht, weil die Urheberrechte der Digitalisate entweder rechtlich nicht verfügbar (juristische Komponente) oder zu teuer sind (wirtschaftlicher Aspekt der juristischen Komponente). Begreift man die Digitalisierungsanstrengungen von Google als kommerziell motivierte Kanonisierungsstrategie, so ergeben sich bestimmte Gesetzmäßigkeiten. Je beschränkter die Nutzungsrechte am Werk eines bestimmten Urhebers sind, sprich: je jünger oder „neuer“ ein Buch oder Textkorpus, desto weniger kann es technisch sichtbar gemacht werden, sprich: desto extensiver wird es kanonisiert – das heißt: lesbar, zitierbar oder inhaltlich referenzierbar gemacht (sogenannter „non-display use“). Und umgekehrt gilt: Je älter ein Buch oder Beitrag, desto forcierter wird er durch eine virtuelle Teil- oder Vollansicht („Snippets“ im Modus des „display use“) kanonisiert. Ein rechtefreies Werk erfährt demnach die höchste Stufe möglicher digitaler Kanonisierung. Insbesondere bei vergriffenen Titeln ist das mit einem erheblichen Rekanonisierungseffekt verbunden. Genau auf diese Nische des institutionalisierten Büchermarkts, die einen lukrativen Grau- oder Grenzbereich zwischen Urhebern, Verlagen, Bibliotheken und Buchhandel ausfüllt, hat sich der Weltkonzern zurzeit spezialisiert.3 Auch bei öffentlich geförderten Initiativen zur dezentralen elektronischen Literaturversorgung durch bedeutende Förderorganisationen wie die Deutsche Forschungsgemeinschaft (DFG) dominiert der Trend zur Retrodigitalisierung. Dies gilt insbesondere mit Blick auf kritische Editionen und 3

Google Book Search ehrt Johann Wolfgang von Goethe sogar mit einem eigenen Portal. Gemäß der Rechtepolitik von Google dominieren darin retrodigitalisierte Ausgaben und Quellen älterer Provenienz (siehe unter http://www.google.de/googlebooks/goethe/index.html, letzter Zugriff am 7.12.2011).

Evolutive Kanonbildung?

265

historische Wörterbücher. Im Falle der großen Bibliotheken liegt dies in der Natur der Sache. Das geistige und literarische Erbe aus der ferneren Vergangenheit ist eben nicht nur wesentliche Grundlage unserer kulturellen Identität, sondern als historisches Allgemeingut auch gemeinfrei. Dieses Primat des historischen und rechtefreien – aus wissenschaftlicher oder philologischer Sicht im Einzelfall aber auch überholten – Text- oder Datenkorpus scheint derzeit eine Entwicklung zu sein, die sich für die digitale Kanonformation verallgemeinern lässt. Durch die neuen technischen Möglichkeiten kommt es dabei zu einem Verstärkungseffekt. Das bereits – auch mehrfach – gedruckte Buch oder Werk, das heißt: das literatur- oder wissenschaftsgeschichtlich schon einmal Kanonisierte – möglicherweise eben auch: Antiquierte – wird eher zum Gegenstand einer erneuten Erschließungsanstrengung als eine Neuerscheinung, die noch Urheberschutz genießt und im Werturteil der Öffentlichkeit ein noch unbeschriebenes Blatt darstellt. Praktiken der Kanonisierung im internationalen Literatur- und Wissenschaftsbetrieb bilden dazu eine Parallele. So werden die Nobelpreise ganz überwiegend an ältere Wissenschaftler oder Autoren bzw. Autorinnen verliehen. In der Regel wird nämlich abgewartet, welches Urteil die Zeit- oder Literaturgeschichte zu einer Entdeckung oder Erfindung fällt („Erfindung“ hier im weitesten Sinne auch als: fiktionales Werk, Fiktion). Die Zubilligung literarischer Wertschätzung vollzieht sich dabei stets eingedenk der Frage: Wie werden Leser, Kritiker oder Literaturwissenschaftler über ein Werk nach mehreren Jahrzehnten urteilen? Selbst vergleichsweise „frühe“ Preisentscheidungen folgen dem Prinzip des erweiterten Geltungshorizonts. „Erweitert“ bedeutet erstens: nicht auf die ästhetisch-literarische Qualität im engeren Sinne beschränkt (also heteronom, statt autonom); und zweitens: auf einen längeren Zeitabschnitt bezogen, auf historische Maßstäbe bedacht. Dafür spricht auch die Verleihung des Literaturnobelpreises 2009 an die Berliner Schriftstellerin Herta Müller. Nicht nur anlässlich der feierlichen Vergabe in Stockholm am 10. Dezember 2009 war neben ästhetischen und sprachlichen Qualitäten ausführlich von der politisch-moralischen Bedeutung die Rede, die Autorin und Werk für die postkommunistische Weltgeschichte nach dem Zusammenbruch des Ostblocks verkörperten. Die Koinzidenz der Preisentscheidung mit dem kalendarischen Jubiläum des Falls der Berliner Mauer 1989 legt nahe, dass das schwedische Nobelpreiskomitee seine finale Entscheidung erst vor dem Hintergrund dieses „historischen Horizonts“ fällte. Im Hinblick auf die skizzierte Motivation der Nobelpreisvergabe für Literatur könnte man auch wie folgt verallgemeinern: Bis zu einem gewissen Grad verstärkt das Nobelpreiskomitee lediglich valuative Trends einer Scientific Community („Skandinavier und Balten fühlten sich traditionell vom Kommunismus geostrategisch bedroht“) oder proto-kanonische Tendenzen innerhalb einer literarisch-politischen Öffentlichkeit (in Europa; „des Westens“) und überführt sie in eine repräsentative Entschei-

266

Robert Charlier

dung. „Repräsentativ“ ist diese Entscheidung dabei nicht im Sinn einer demokratischen Mehrheit oder höheren Gerechtigkeit. Sie aktualisiert lediglich die Synthese aus normativen Maßgaben (etwaige Preissatzung; Geist der Stifterpersönlichkeit) und dem trendverstärkenden Urteil eines kleinen, weltweit vernetzten Kollektivs. Das Prinzip des historischen Horizonts liegt auch bei kanonischen Wertakten vor, die nicht retro-, sondern prospektiv ausgerichtet sind. Gutes Beispiel für die Errichtung eines Kanonhorizonts in entgegengesetzter Blickrichtung bildet die Vergabe des Friedensnobelpreises 2009 an Barack Obama. In diesem Fall beabsichtigte das Osloer Komitee, dem „Prinzip Hoffnung“ auf der Bühne der Weltpolitik neuen Schwung zu verleihen. Die Konsensvermutung dieser Preisentscheidung wendet sich weniger zurück, etwa mit Blick auf die Geschichte des Ost-West-Konflikts oder das „kulturkämpferische Jahrzehnt“ seit 2001. Sie richtet sich vielmehr nach vorn, in die Zukunft. Die Osloer setzten mit Obama auf die Ankündigung einer atomaren Abrüstungsinitiative durch die einzig verbliebene militärische Supermacht. Diese Zukunftsoption ist nicht neu. In der Geschichte des 20. Jahrhunderts kamen bereits zwei amerikanische Präsidenten in den Genuss „prospektiver“ Nobelpreise für den Weltfrieden. Im Bereich der literarischen Nobilitierung können solche Verstärkungstendenzen auch dann als wirksam angenommen werden, wenn gewissermaßen exotische oder einsame Entscheidungen für einen bestimmten Preisträger fallen. Auch diese „Ausreißerentscheidungen“ – z.B. für Autoren, die heute so gut wie vergessen sind – beruhten in der Vergangenheit auf einer zumindest kontrastiven, gegen den Zeitgeist gerichteten Wertvermutung. Sie verstärkten also eine Tendenz der Abweichung, einen Gegentrend, dessen ursprüngliche Motivierung oder Zielrichtung oft ein Geheimnis der Findungskommission geblieben ist. Unbestreitbar sind es solche Selektionstendenzen und Stabilisierungseffekte, die sich auch in Medienphänomenen manifestieren, wie sie gegenwärtig etwas überambitioniert mit Schlagworten wie „Intelligenz des Schwarms“ beschrieben werden. Als Medium der Praktizierung kultureller Wertschätzung formiert das Internet nicht grundstürzend neue Kanonbildungen. Es selektiert und reproduziert lediglich vorhandene Präferenzen und stabilisiert bewährte Formen der Kanonbildung. Aus kanontheoretischer Sicht lässt sich die Analyse des weltweiten Wissensnetzes als sogenanntes „Pull-Medium“ bestätigen. Es handelt sich dabei um einen begrifflichen Gegensatz zu „Push-Medium“, wie es etwa das herkömmliche, nichtinteraktive Fernsehen darstellt. Mit Blick auf die Kanonisierung von Wissensinhalten und kulturellen Wertzuschreibungen bilden Mitmach-Enzyklopädien im Internet zweifellos eindrucksvolle Beispiele für die erstaunliche Leistungsfähigkeit kollektiver Subjekte. Wikipedia und vergleichbare Unternehmungen vergegenwärtigen aber auch die enormen Attraktions- und

Evolutive Kanonbildung?

267

Fliehkräfte, die das Phänomen der kollaborativen Autorschaft mit sich bringt: die technische Fortsetzung von Konsens und Konflikt als ein Prozess „epistemischer“ Evolution.4

IV. Das Internet – ein epistemisches Evolutionsmodell? Evolutive Begriffe wie „Selektion“, „Reproduktion“ und „Stabilisierung“ erscheinen im genannten Sinn plausibel. Als theoretisch verbrieft können die Termini für den vorliegenden Zusammenhang jedoch nicht gelten. Dazu wende ich mich zunächst einer Grundsatzfrage zu: Genügen die im Rahmen eines Internetprojekts umgesetzten und z.B. mit korpuslinguistischen Mitteln sinnvoll isolierbaren Datenmengen, um eine Betrachtung medialer Kanonisierungen aus evolutionistischer oder gar darwinistischer Sicht zu rechtfertigen? Mit Blick auf die natürlichsprachlichen Informationsmengen des Internets insgesamt haben wir es sicherlich mit Iterationszyklen zu tun, die an evolutionäre Größenordnungen heranreichen. Streng genommen schließt sich hier aber eher die Frage nach einer „evolutiven Informationstheorie“ an. Aus hermeneutischer Sicht ergibt sich zudem das Problem der Trennung zwischen logisch-maschinensprachlicher und semantisch-natürlichsprachlicher Ebene. Wie will man bei der maschinell erstellten quantitativen Erhebung entsprechender Forschungsdaten exakt unterscheiden zwischen mechanisch zufälliger und inhaltlich „gemeinter“ Zuschreibung? Praktisch ausgedrückt: Wie sprechend sind Statistiken über sogenannte Logeinträge tatsächlich? Kann man die Indizierung durch einen „Netzroboter“ mit dem Akt des Lesens oder der Weiterempfehlung eines Textes durch einen Menschen gleichsetzen? Was kann die Auswertung bzw. Gegenüberstellung von Zahlenmaterial über Hits versus Imprints versus Page impressions mit Blick auf die inhaltliche oder formale Bewertung von Texten wirklich erbringen? Aussagen, die die virtuellen Weiten des Internets insgesamt einbeziehen und gleichzeitig wissenschaftlich belastbare Erkenntnisse über die Dynamik von Zuschreibungs- und Wertungsprozessen gewährleisten, erscheinen nicht realisierbar, auch wenn statistische Webservices wie Google Trends oder Google Insights dazu bereits bemerkenswerte Modellansätze liefern.5 Allein das Übersetzungsproblem durch die Sprachgrenzen ist wohl zum gegenwärtigen Zeitpunkt auch im Internet aus technischer Sicht nicht wirklich zu meistern. Das birgt ein Dilemma. In dem Bereich, wo mit einem gewissen Recht para4

5

So bezeichnet der Begriff »Darwikinism« die inhaltliche und sprachliche „Evolution“ von Sachartikeln im Rahmen kollaborativer Internet-Lexika wie Wikipedia. Möglich macht dies die Dokumentation der (vollständigen) Entstehungsgeschichte sämtlicher Einträge (der sogenannten history). Eine im Entstehen begriffene Definition des Begriffs befindet sich unter http://meta.wikimedia.org/wiki/Darwikinism (letzter Zugriff am 15.12.2009). Siehe unter http://www.google.com/trends sowie unter http://www.google.com/insights/ search/ (letzter Zugriff am 7.12.2011).

268

Robert Charlier

evolutive Prozesse zu vermuten sind, erscheinen sinnvolle Ableitungen und kanontheoretisch abgesicherte Aussagen eher unrealistisch. Auf der Ebene einzelner Online-Projekte oder vernetzter Projekt-Cluster dagegen, wie sie z.B. das Berlin-Heidelberger Wörterbuchportal oder das Trierer Wörterbuchnetz darstellen, sind die quantitativen Dimensionen wohl noch zu klein. Allerdings ergeben sich aus der philologischen Mikroperspektive einige bemerkenswerte Aspekte, die möglicherweise eine vergleichende Betrachtung erlauben. Der interaktive Rücklauf, den ich aus formalisierten Anfragen zur sprachlichen Klassikerrezeption und speziell zur Goethe-Zitation erhalte, erlaubt eine solche experimentelle Vergleichsbetrachtung. Der Gebrauch von evolutionstheoretischen Begriffen bleibt dabei jedoch stets „metaphorisch“.6 Aus dem anonymisierten Korpus der Anfragen zu einem kanonisierten Autor wie Goethe lässt sich das Zuschreibungs- und Wertungsverhalten von Lesern oder Nutzern ansatzweise typisieren (vgl. Charlier 2005a; Charlier 2007).7 Dies kann beispielsweise dann geschehen, wenn Nutzer oder Nutzergruppen ein bestimmtes Zitat mit einer gewissen Anfrage- oder Referenzhäufigkeit Goethe zuordnen. Der Nutzer oder Leser wendet sich in der Regel mit einem Phrasem – sei es ein geflügeltes Wort, ein Ausspruch oder (gereimter) Vers – an den philologischen „Experten“, um es als Dichterwort zu identifizieren, sprich: einem Autorenkanon verbindlich zuordnen zu lassen. Dies erfolgt entweder kraft eigener Zuschreibung des Anfragenden (die nach autoritativer Affirmation verlangt) oder aber als Bestätigung bzw. Widerlegung eines vorgefundenen Nachweises von dritter Seite. Der Akt der Zuschreibung ist hier noch nicht in einem höheren Sinne „wertend“, sondern lediglich basaler Natur. Betrachtet man ein solches internes Korpus von Beispielanfragen, so ergeben sich erstaunliche Phänomene der Zitatzuschreibung. Dabei kommt es zu einer interessanten Wechselwirkung zwischen sprachlicher Kodifizierung und literarischer Kanonisierung. Bei einem Typus von Zitatanfragen gelangen nämlich Wortlaute in den Sprachfilter des Lexikografen, die eine Eigendynamik entwickelt haben. So gibt es beispielsweise eine markante Gruppe von angeblichen Goethezitaten, die sich bei genauerer Überprüfung als fiktiv erwiesen haben. Das heißt, ihr Wortlaut lässt sich in keiner Weise bei Goethe nachweisen. Erstaunlich ist aber nun, dass diese Pseudozitate durch die nichtzertifizierten Verweismöglichkeiten im Internet ein Eigenleben entwickeln und in variierenden Wortlauten frei im Netz zirkulieren. Es verbreiten sich also tiefsinnige (Aus-) Sprüche und Weisheiten, die sich philologisch nicht als originales Dichter6 7

Zum (natur)wissenschaftlichen Metaphernproblem aus begriffsgeschichtlicher Sicht vgl. Fellmann 1977. Siehe auch Hyperlink „Auskunft“ unter http://www.goethe-wortschatz.de (letzter Zugriff am 15.12.2009).

Evolutive Kanonbildung?

269

wort oder zumindest nicht als „Wort des jeweils angenommenen Autors“ belegen lassen. Im Internet wird also sprachlich kodifiziert (d.h. „zitiert“ und als Zitat verlinkt), was gar nicht Teil eines kanonisierten Werks ist. Dies führt zu hochinteressanten Effekten der sprachlichen Abwandlung sowie einer freimütigen und technisch „beflügelten“ Metamorphose vermeintlicher „Goetheworte“. Rein intuitiv lassen sich diese Effekte mit evolutiven Begriffen sehr anschaulich beschreiben. Ich bilde eine Analogiekette. Dabei bezeichnet das Erstglied des Vergleichspaars den sprachlichen Rezeptionsakt, das Zweitglied ergänzt die evolutionstheoretische „Analogie“: Zitation eines Wortlautes ~ „Replikation“ Variation eines Wortlautes ~ „Mutation“ Präferenz eines variierten Wortlautes ~ „Selektion“ bzw. „Stabilisierung“

Die dritte Gleichsetzung markiert die Genese eines neuen Wortlauts als (vermeintliches) Klassikerwort. In der von mir definierten Terminologie handelt es sich dabei um einen sogenannten „Goeth(e)ismus“. Dieser Begriff versteht sich in Abgrenzung zu ähnlich lautenden Termini wie z.B. „Goetheanismus“ (dabei handelt es sich um die anthroposophische Goethe-Rezeption der sogenannten Rudolf-Steiner-Schule). Das Sprachphänomen des Goetheismus dokumentiert, wie lebendig die Sprache der Klassiker auch im Zeitalter des Internets „reproduziert“ wird. Diese Form des fiktiven oder fälschlich zugeschriebenen Klassikerzitats existiert primär im deutschen Sprach- und Kulturraum und nur mit Blick auf einen Weltdichter und -denker wie Goethe. Die Entstehung eines Goetheismus lässt sich mit der stilisierten Wiedergabe einer „inneren Stimme“ auf den Punkt bringen, die als Regel für diesen Akt intuitiver Zuschreibung gelten könnte: „Was für ein schöner poetischer Wortlaut – der muss doch von Goethe stammen!“ Allerdings ist die Größe des kumulierten Korpus von goethebezogenen Zitatbeispielen viel zu klein, um auch nur ansatzweise evolutive Prozesse auf statistischer Basis zu modellieren. Dennoch genießen einzelne Korpusbelege einen besonderen Stellenwert. Dies etwa dann, wenn eine Zitatanfrage aufdeckt, dass eine Goethezuschreibung einmal oder mehrfach von einer autoritativen Instanz erfolgte – sie also einem renommierten Fachvertreter oder sogar Herausgeber oder Editoren gleichsam „passierte“. Dann wohnt dieser falschen Kanonisierung zugleich ein gewisser Multiplikationseffekt inne. Schließlich steht der Fehler der „Autorität auf ihrem Gebiet“ mit an Sicherheit grenzender Wahrscheinlichkeit für weitere Fehlzuschreibungen. Sein Vortrag mit dem vertrackten Klassikermotto steht ja immer noch im Internet, und seine Aufsätze werden weiterhin zitiert. Gehaltvolle Belege für Goetheismen ergeben sich zudem aus der Literaturgeschichte selbst. Es handelt sich dabei um Phraseme bzw. „Zitate“, die dem Dichter Goethe von bedeutenden Schriftstellern in den Mund gelegt wurden – und die diese Autoren dem großen Vorbild Goethe eindeutig

270

Robert Charlier

nicht kraft poetischer Lizenz, sondern aufgrund eines philologischen Irrtums – also fälschlich – zuschrieben. In einem Fall stammt das Zitat von einem anderen Autor der klassisch-romantischen Literaturperiode, der mit Goethe gleichsam verwechselt wurde, nämlich Novalis (vgl. Charlier 2005a, S. 166f.). Allerdings sind für diese „enharmonische“ Klassikerverwechslung auch hochkarätige Beispiele für andere Autoren bekannt geworden. Ein Fall, der in jeder Hinsicht durch die Literatur ging, bestand in der Verwechslung zweier Weimarer Klassiker durch einen renommierten Editionsphilologen. So gelangte ein Stammbuchblatt aus Wielands Hand in die Schiller-Nationalausgabe. Mediale oder literarische Belege für eine Form des „Schillerismus“ o.Ä. sind allerdings nicht in der für Goethe nachweisbaren Qualität oder Quantität feststellbar. Dies übrigens trotz der Tatsache, dass Schiller (als Dramatiker) wohl derjenige deutsche Dichter ist, der die meisten geflügelten Worte im Deutschen geprägt hat. Da mit besagten Zitatanfragen routinemäßig die Abfrage einschlägiger digitaler Editionen und Korpusdatenbanken erfolgt, werden die quantitativen Dimensionen der im Netz verbreiteten und – durch Verlinkung unzuverlässiger Textzeugen – potenzierten Fortschreibungen, Umdichtungen und Modulationen eines Klassikerzitates sichtbar und zahlenmäßig messbar. Aber auch die Qualität dieser Quantitäten aus zweiter Hand hält einer ernstzunehmenden Betrachtung aus evolutionstheoretischer Sicht kaum stand. Die grundsätzliche Möglichkeit, dass optimierte, sogenannte semantische Suchmaschinen zukünftig in der Lage sein werden, evolutionäre Prozesse im Bereich kultureller Zuschreibung und Wertung zu modellieren, vermag ich nicht vorwegzunehmen. Digitale Superagenten wie Google würden dieser Vision zufolge zu einer Art epistemischer Maschine mutieren, die zu einer Modellierung von Variations-, Selektions- bzw. Stabilisierungsprozessen innerhalb der menschlichen Sprache und Kultur geeignet wären.8 Mir ist bewusst, dass diese Vision einer Art semantischer „Darwin-Maschine“ auf Basis der explosiv evolvierenden Informations- und Kommunikationstechnologie eher plakativ anmutet. Mit Blick auf die kulturelle Übertragbarkeit der Evolutionstheorie erscheint es allerdings naheliegend, die quasi täglich rasanter fortschreitende Technikentwicklung in Betracht zu ziehen. Dies umso mehr, als es sich dabei wohl um die innovativste Schnittstelle zwischen Natur und Kultur handelt, die sich im Hinblick auf die zukünftige Entwicklung der menschlichen Zivilisation abzeichnet. Mit dieser Aussage verlasse ich allerdings den Zuständigkeitsbereich des Literaturwissenschaftlers. 8

Bekanntlich ist der Markenname der weltweit erfolgreichsten Suchmaschine von einem mathematischen Begriff abgeleitet – der nummerischen Einheit „Go(o)gol“, die eine 1 mit einhundert Nullen bezeichnet. Es handelt sich dabei um eine Mengenvorstellung, die sich nicht allein der menschlichen Vorstellungskraft, sondern jeglicher heute denkbaren physikalischen Dimension – selbst im astronomischen Bereich – entzieht (vgl. Charlier 2005b, Fn. 22).

Evolutive Kanonbildung?

271

V. Quantitative Präferenzforschung Im Folgenden möchte ich noch einmal präzisierend auf die Frage eingehen: Sind die durch die modernen Erkenntnisse der Genetik bestätigten bzw. modifizierten Darwin’schen Theoreme prinzipiell übertragbar auf Subjekte, Prozesse und Hervorbringungen der menschlichen Kultur? Für einschlägige Übertragungsversuche erscheinen die Zeiträume der menschlichen Kulturgeschichte zweifellos zu klein. Dies gilt eindeutig auch für einige theoretische Konstrukte aus dem Reflexionshorizont der sogenannten „kulturellen“ Evolution.9 Allerdings lassen sich bestimmte quantitative Befunde aus der kulturellen Sphäre möglicherweise mit evolutiven Gesetzmäßigkeiten beschreiben. Dies möchte ich anhand eines Beispiels verdeutlichen. Es handelt sich dabei um die statistische Erforschung der Vergabe von Vornamen durch die Gesellschaft für deutsche Sprache (GfdS) (vgl. Müller 2007).10 Die Auswertung von Statistiken der Standesämter in Deutschland, die die Gesellschaft seit 1977 systematisch betreibt, hat Folgendes ergeben: Die Namensvergabe bei Kleinkindern einer bestimmten Generation folgt bestimmten Mustern der kollektiven Präferenzentwicklung. Dabei tritt die Namenswahl von Eltern in Wechselwirkung mit der Namensentscheidung in anderen Familien ihrer unmittelbaren Zeitgenossenschaft. So waren die Namen Sophie/Sofie und Maximilian im Jahre 2008 Spitzenreiter. Daraufhin erlebten Anton, Mia und Noah einen Aufstieg auf der Beliebtheitsskala des Jahres 2009. Nach Aussagen der Sprachforscher der GfdS ist das Kriterium, nach dem Eltern heute passende Namen für ihre Kinder suchen, vor allem der Aspekt der „Modernität“. Das heißt: Der gewählte Name soll – neben anderen Intentionen, die nach den Erkenntnissen der Sprachwissenschaftler für die Namenswahl ausschlaggebend sind – vor allem zeitgemäß sein. In den 1950er Jahren, so die Wissenschaftler, waren die Auswahlkriterien noch viel stärker an familiären oder religiösen Traditionen orientiert. Spitzenreiter waren damals Vornamen wie Andreas oder Sabine. Dabei ist ein historisches Moment zu berücksichtigen. Die Praxis der Vergabe von Vornamen hat sich im Zeitalter von Globalisierung und Migration dynamisch ausdifferenziert. Dies geschah aufgrund eines – historisch betrachtet – enormen Wachstums der zur Auswahl stehenden Namen und Namensformen. So kam man im Mittelalter mit einer sehr geringen Zahl von männlichen Vornamen christlich-germanischer Provenienz für den gesamten deutschsprachigen Raum sehr gut aus. Die Tendenz zur modernen Ausdifferenzierung dokumentieren spektakuläre Fälle von Eltern, die auf ihren exotischen Na9

Zur methodischen und begrifflichen Problematik der sogenannten Kulturellen Evolution vgl. z.B. Hochkeppel 1999. 10 Jeweils aktualisierte Übersichten über die jährlich erhobenen Daten dokumentiert die Internetseite der Gesellschaft für deutsche Sprache unter http://www.gfds.de/vornamen/ beliebteste-vornamen/ (letzter Zugriff am 7.12.2011).

272

Robert Charlier

mensvorlieben beharrten. Dabei gerieten sie mit dem vergleichsweise strengen deutschen Namensrecht in Konflikt (und vor Gericht). Aufgrund eines stetig anschwellenden Auswahlkataloges erlangen die aktuellen Spitzenreiter unter den deutschen Vornamen also jeweils geringere Anteilsgrade an der Gesamtmenge aller vergebenen Jungen- bzw. Mädchennamen (in jüngerer Zeit z.B. Sophie mit 2 Prozent; 1967 dagegen Sabine mit 6 Prozent; in Deutschland existieren derzeit ca. 6.000 Vornamen, davon sind aber mehr als 50 Prozent nur einmal vergeben). Das von den Vertretern der GfdS beschriebene „Spitzenreiter-Phänomen“ besteht nun darin, dass nach Erreichen einer kritischen Masse von Benennungen der „anonyme, kollektive Massengeschmack“ (Gerhard Müller) gleichsam umschwenkt zu anderen, neuen Namensformen. Es handelt sich dabei um eine Gesetzmäßigkeit, die offensichtlich nicht an ein absolutes Quantum, also ein quasi kanonisches Maß, gebunden ist, sondern lediglich um eine relative Größe, also eine Häufigkeit im Hinblick auf die ko-generationelle Namensgebung in anderen Familien. Die statistische Evidenz lässt sich als Regel formulieren: „Wird ein Name zu oft vergeben, verliert er an Popularität.“ Zum Schluss möchte ich diese empirisch registrierbare, theoretisch aber nicht erklärbare Erfahrungsregel aus dem Feld der Zuschreibung von Vornamen auf einen Aspekt der Literaturgeschichte übertragen. Im Zusammenhang mit den Kanondebatten der 1960er und 1970er Jahre, deren Konnex zur kulturkritischen 1968er-Bewegung kaum zweifelhaft ist, kam es zu einer fundamentalen Umwertung im Bereich der Klassikerrezeption. Autoren wie Goethe oder Schiller wurden als herrschaftsaffirmativ und bürgerlich diskreditiert und die Allgemein- oder Alleinverbindlichkeit des literarischen Erbes einer Deutschen Klassik angezweifelt. Die bildungspolitischen Folgen bestanden in einer grundsätzlichen Skepsis gegenüber dem sogenannten bürgerlichen Literaturkanon, ja gegenüber Kanonbildungen überhaupt. Das Wort von der deutschen „Klassik-Legende“, geprägt auf dem Second Wisconsin Workshop (1969/70), bildet bis heute das Hintergrundrauschen dieses Umbruchs (vgl. Grimm und Hermand 1971; Jauß 1987). Bekanntlich ersetzte die etablierte Germanistik im Anschluss an diese Entwicklungen das nationale Konzept einer „deutschen“ durch den modernen Epochenbegriff der „Weimarer Klassik“ (vgl. Borchmeyer 1980; Borchmeyer 1994). Nicht durchsetzen konnte sich jedoch eine prinzipielle Kanonabstinenz, wie sie einige Kulturrevolutionäre jener Zeit vertraten. Der Sturz der bürgerlichen Klassiker begründete vielmehr neue Kanonsetzungen. Die Literatur von Frauen, Emigranten oder jüdischen Autoren trat an die Stelle kanonischer Autoren des bürgerlichen Literaturzeitalters. Mit einigem zeitlichen Abstand wurden schließlich die theoretischen Vordenker der Studentenbewegung selbst zu „Klassikern“ stilisiert. Man denke nur an den auch sprach-

Evolutive Kanonbildung?

273

lich greifbaren Adorno-Kult oder die epochale Stilisierung der Kritischen Theorie oder der Frankfurter Schule im Nachhinein. In gewisser Weise gelangte der Begriff des „modernen Klassikers“ überhaupt erst zu seinem Recht. Bemerkenswerterweise geschah dies von linkskritischer Seite in ähnlicher Weise (Kanonisierung Hermann Hesses durch die Hippie-Generation) wie auf Seiten der kulturkonservativen Literaturkritik (Inthronisierung Thomas Manns durch Marcel Reich-Ranicki). Die Mode der sogenannten MaoBibel aktualisierte den Kanonbegriff sogar in seiner ureigensten Bedeutung. Das Phänomen ist ein Musterbeispiel dafür, wie ein ideologischer Personenkult mit der quasi-religiösen und pseudoliterarischen Kanonisierung eines großen Führers zusammengeht. Wendet man die aus der statistischen Namensforschung gewonnene Zuschreibungsregel auf den politischen Umbruch der 1968er Jahre an, so ergibt sich folgende „quantitative Kanonregel“ für die Zuschreibung, welcher Autor bzw. welches Werk für welche Zeit als „klassisch“ zu gelten habe: „Wenn ein Autor oder ein Text von zu vielen Autoritäten zu häufig als mustergültig vorgegeben wird, verliert er an Attraktivität.“ In Analogie zur „kritischen Masse“ bei der Vornamenswahl ergäbe sich also mit Bezug auf die Literaturgeschichte eine kritische Zeitspanne, innerhalb derer die kanonische Attraktionskraft eines Autoren oder eines bestimmten Paradigmas gleichsam verfiele. Legt man als Erstbeleg für die Erhebung Goethes und Schillers in den Rang eines kanonischen Dichterpaars das (erstmals) mit „Schiller und Goethe“ überschriebene Kapitel aus einer Literaturgeschichte des 19. Jahrhunderts zugrunde – Georg Gottfried Gervinus’ Geschichte der poetischen National-Literatur der Deutschen (1835/42)11 – dann ergibt sich in etwa eine Zeitspanne von etwas über 130 Jahren für die Phase der Aufrechterhaltung des kanonischen Paradigmas. Aus der Übertragung solcher Präferenzregeln könnte man weitere Kanon-Zyklen ableiten, etwa als Ausgangspunkt für eine quantitative Klassikertheorie. Eine Betrachtung der Literaturgeschichte mit der Brille des quantifizierenden „Evolutionisten“ erscheint allerdings vorerst nur im Gedankenexperiment legitim. So erweist sich das beschriebene Kanonschema alles andere als zeitlich oder programmatisch konsistent.12 Erst in Verbindung mit der nationalen Sehnsucht der Deutschen konnte sich das Dioskuren-Paradigma seit den 1830er Jahren in der Literaturgeschichtsschreibung stabilisieren. Zuvor existierte überhaupt kein reproduzierbares Konzept für eine Deutsche oder Weimarer Klassik. Zeitweise kreiste das protokanonische Be11 Es handelt sich um das 13. Kapitel aus: Gervinus 1852, S. 351–548 (vgl. dazu Ziolkowski 2009, S. 48f.). 12 Auch während der vermeintlichen Geltungsdauer des Dioskurentopos kam es phasenweise zu je unterschiedlichen Gewichtungen der einzelnen Dichter. Erwähnt sei nur die nationalsozialistische „Schillerfeier“ in der Frühphase des Dritten Reichs. Solche De- bzw. Rekanonisierungen widersprechen der Irreversibilität evolutionärer Entwicklungen.

274

Robert Charlier

wusstsein vielmehr noch um die Frage, wer der „größere“ Dichter sei – Goethe oder Schiller. Den evolutionären Wettstreit ums Überleben im kulturellen Gedächtnis gewann jedoch nicht einer, sondern beendeten beide Dichter als „Sieger“. Dadurch erbte das Doppelparadigma einer „ZweiMann-Klassik“ (Theodore Ziolkowski) jedoch ein ganzes Bündel typisch deutscher Widersprüche. So stellte Karl Robert Mandelkow fest, das Konzept einer „Weimarer Klassik“ verdanke sich einer rezeptionsgeschichtlichen „Synthese von Polaritäten“ (Mandelkow 1980, S. 125).13 Diese prägen das Bild der Dichter bis heute. Noch in Goethe & Schiller. Geschichte einer Freundschaft (2009) aktualisiert Rüdiger Safranski altbekannte Dichotomien. Anhand zahlreicher Zitate – fast ausschließlich dem Briefwechsel entnommen und synthetisch mit der Beschreibungssprache des Buches verschmolzen – wiederholt und variiert Safranski die Litanei „Goethe der Realist“ versus „Schiller der Idealist“, „Natur“ versus „Geschichte“, „Humanität“ versus „Freiheit“ (vgl. Safranski 2009).14 Als früherer Vertreter links-kritischer Positionen perpetuiert Safranski damit also ausgerechnet das geistige Substrat eines einst als konservativ geschmähten „bürgerlichen“ Kanonschemas! Das schillerselige 19. Jahrhundert hatte überdies zunächst den Dichter der Freiheit voran- und den Denker hoher Humanität (und faustischer Dämonie) hintangestellt. Von Gervinus’ „Schiller-und-Goethe“-Kapitel führte also noch ein längerer Weg zu Ernst Rietschels Weimarer Goethe-SchillerDenkmal (1852–1857), einer Ikone der bis heute gültigen Rangfolge. Die Größe der Schillerfigur wurde im Schaffensprozess des Bildhauers bekanntlich verkleinert mit Blick auf das überlieferte Verhältnis der Körpergrößen – und das Paradigma damit auf ein gleichsam kanonisches Maß gebracht. Die antike Grundbedeutung des Wortes „Kanon“ bezeichnete übrigens ein Schilfrohr zur Herstellung von Richtscheiten, Mess- oder „Maßstäben“. Womit die quantitative Betrachtung eines literarischen Paradigmenwechsels an ihren begrifflich-etymologischen Ausgangspunkt zurückkehrt.

13 Bei Mandelkow heißt es wörtlich: „Klassik als Synthese von Polaritäten: Gervinus hat dieses von ihm geschaffene Modell an die Stelle der Alternative ‚Goethe oder Schiller‘ gesetzt“ (Mandelkow 1980, S. 125; kursive Hervorhebung R.C.). 14 Diese Biografie der Dichterfreundschaft liest sich stellenweise wie ein Neuaufguss von Safranskis Schiller-Biografie zum Schillerjahr 2005 (Safranski 2004). Aus literaturwissenschaftlicher Sicht bringt Goethe & Schiller kaum neue Erkenntnisse. Ein Manko des Buches bildet zudem der fast vollständige Verzicht auf die Auswertung der jeweiligen dichterischen und (natur-) wissenschaftlichen Werke.

Evolutive Kanonbildung?

275

Literaturverzeichnis Borchmeyer, Dieter, Die Weimarer Klassik. Eine Einführung, 2 Bde., Königstein/Ts.: Athenäum, 1980. --, Weimarer Klassik. Portrait einer Epoche, Weinheim: Beltz Athenäum, 1994. Charlier, Robert, „Jedermann ein Eckermann? Goethe-Rezeption im digitalen Zeitalter“, in: Jahrbuch für Internationale Germanistik 37 (2005), S. 161–168 (= 2005a). –, „Synergie und Konvergenz. Tradition und Zukunft historischer Semantik am Beispiel des Goethe-Wörterbuchs“, in: Begriffsgeschichte im Umbruch?, hg. von Ernst Müller, Hamburg: Meiner, 2005, S. 167–183 (= 2005b). –, „Goeth(e)ismus. Zur Phänomenologie literarischer Zitation“, in: Jahrbuch für Internationale Germanistik 39 (2007), S. 99–116. –, „Google statt Goethe? Kanonbildung im Zeitalter der Globalisierung“, in: Standard: Bildung. Blinde Flecken der deutschen Bildungsdiskussion, hg. von Ingwer Paul et al., Göttingen: Vandenhoeck & Ruprecht, 2008, S. 15–29. –, „Klassikermacher. Goethes Berliner ‚Agenten‘ der literarischen Kanonbildung“, in: Kanonbildung, hg. von R. Charlier und Günther Lottes, Hannover: Wehrhahn, 2009, S. 51–69. Charlier, Robert / Günther Lottes (Hg.), Kanonbildung. Protagonisten und Prozesse der Herstellung kultureller Identität, Hannover: Wehrhahn, 2009. Fellmann, Ferdinand, „Darwins Metaphern“, in: Archiv für Begriffsgeschichte 21 (1977), S. 285–297. Gervinus, Georg Gottfried, Geschichte der poetischen National-Literatur der Deutschen. Fünfter Theil: Von Göthe’s Jugend bis zur Zeit der Befreiungskriege, 3., verbesserte Auflage, Leipzig: Engelmann, 1852. Grimm, Reinhold / Jost Hermand (Hg.), Die Klassik-Legende. Second Wisconsin Workshop, Frankfurt/M.: Athenäum, 1971. Heydebrand, Renate von / Simone Winko (Hg.), Einführung in die Wertung von Literatur. Systematik – Geschichte – Legitimation, Paderborn: Schöningh, 1996. Hochkeppel, Willy, „Kulturevolution. Eine verfehlte Metapher“, in: Zeitschrift für Philosophie 2 (1999), S. 36–45. Jauß, Hans Robert, „Deutsche Klassik – Eine Pseudo-Epoche?“, in: Epochenschwelle und Epochenbewußtsein, hg. von Reinhart Herzog und Reinhart Koselleck, München: Fink, 1987, S. 581–585. Mandelkow, Karl Robert, Goethe in Deutschland. Rezeptionsgeschichte eines Klassikers. Bd. 1: 1773–1918, München: Beck, 1980. Müller, Gerhard, „Die beliebtesten Vornamen des Jahres 2006“, in: Der Sprachdienst 2 (2007), S. 53–61. Safranski, Rüdiger, Schiller oder Die Erfindung des Deutschen Idealismus, München: Hanser, 2004. –, Goethe & Schiller. Geschichte einer Freundschaft, München: Hanser, 2009. Treml, Alfred K., Klassiker. Die Evolution einflußreicher Semantik, 2 Bde., Sankt Augustin: Academia Verlag, Bd. 1, 1997; Bd. 2, 1999. –, „Klassiker: ‚Herstellung‘ oder ‚Herausbildung‘? Über die Evolution einflussreicher Semantik“, in: Kanonbildung, hg. von Robert Charlier und Günther Lottes, Hannover: Wehrhahn, 2009, S. 143–160.

276

Robert Charlier

Winko, Simone, „Literatur-Kanon als invisible hand-Phänomen“, in: Literarische Kanonbildung, hg. von Heinz Ludwig Arnold, München: Text + Kritik, 2002, S. 9–24. Ziolkowski, Theodore, „Zur Politik der Kanonbildung. Prolegomena zum Begriff einer ‚Klassik‘ in Deutschland“, in: Kanonbildung, hg. von Robert Charlier und Günther Lottes, Hannover: Wehrhahn, 2009, S. 33–50.

II. Case Studies / Fallstudien

10

Carsten Gansel, Dirk Vanderbeke

Shakespeare and the (Evolved) Pleasures of Revenge

279

Shakespeare and the (Evolved) Pleasures of Revenge Anja Müller-Wood

I. Introduction That the emerging field of evolutionary literary criticism has so far predominantly focused on prose (cf. Mellmann 2009) may not only have to do with literary scholars’ professional preoccupations, but also points to the function allotted to narrative in the wider debate around the adaptiveness of the arts in general and literature in particular.1 Unfortunately, this focus has occluded other potential roots of narrative that may be equally (if not more) interesting for evolutionary literary critics. As H. Porter Abbott suggested already some time ago, in order to comprehend the evolutionary dimensions of literary art, we ought to expand a narrow understanding of narrative as the “telling or recounting of stories” to include acts of “presenting or rendering of stories” (Abbott 2000, p. 249). Arguing that “playful mimesis is the origin of literary fictions,” Abbott draws our attention to drama as a potential source of fictional narrative (p. 251).2 The traditional, Aristotelian view of drama sees it as the imitative performance of human action with the aim of achieving particular (emotional) effects in the audience (cf. Aristotle 1996). However much “post-dramatic” performance theory and practice may frown upon concepts like “pity,” “fear” and “catharsis,” an evolutionary perspective may give these categories new significance. The turn to drama may thereby also help extend the scope of the emerging field of evolutionary literary criticism, which has tended to focus on the content (and its evolutionary dimension) of (mainly) narrative fiction, rather than on its aesthetic quality and affective functions.3 While, in doing so, evolutionary literary criticism has provided insightful readings of character action and interaction, it has focused less on the minds beyond 1

2 3

Scholars arguing for the adaptiveness of art are for instance Dissanayake 1988; Miller 2000. The argument that artistic activities are fitness-enhancing abilities is contested, however, as are arguments along those lines from a literary perspective – most recently (and extensively) Boyd 2009. For a convincing refutation of the argument that literature is an adaptation, see Pinker 2007, p. 170. See also Mellmann’s contribution to this collection. For an illustrative example see the essays collected in Wilson and Gottschall 2005.

280

Anja Müller-Wood

the text – that is, those of the readers – and their productive contribution to literary meaning and effect. It is this side of the literary encounter that may be illuminated with recourse to drama and its particular aesthetic and representational modes. Like drama, prose narratives do not merely aim at portraying human action and behaviour, but seek to achieve certain effects4; however, it would be simplistic to understand this process as a unidirectional transmission of authorial meaning and (for want of a more neutral term) “intention” to the receiver.5 An evolutionary perspective may be helpful in formulating a more complex, dialogical understanding of the creation of textual meaning. Whatever effects literature may achieve, whichever responses it may trigger – it can only do so because audiences and readers are able to comprehend and enjoy them. This, however, relies on particular emotional and cognitive abilities whose foundations lie in our evolutionary past. Accordingly, the implicit assumption of the following is that literature does not merely shape the reactions and responses of its consumers, but that, in a crucial way, it is shaped by them.6 Taking this perspective, I differ from older forms of reception criticism, which – despite a nominal concern with the reader’s perspective – have on the whole not taken into consideration the cognitive processes that enable readers to comprehend and enjoy literary texts in the first place.7 The emphasis on enjoyment points to another important facet of my argument: the role of the emotions in the reception of literary art. This is a 4 5 6

7

For James Phelan, literary texts are rhetorical structures that serve a communicative aim: “somebody telling somebody else on some occasion and for some purpose that something happened” (Phelan 2003, p. 132). Intentionality is not to be equated with the “low-flying behaviourism” that Stuart Hall associates with the traditional (unidirectional) transmission model of communication (Hall 1999, p. 510). My aim is neither to predict the responses of real readers, nor to suggest that particular features of a text lead all readers to react in the same particular way. Rather, I am here following Katja Mellmann’s idea of an “anthropological reader model” integrating the potential responses of readers that an evolutionary perspective might help elucidate (Mellmann 2006, p. 21). Even Wolfgang Iser ultimately places the exclusive focus on the text when he claims that “blanks in the text” lead to “constitutive activity” on the part of the reader, who by virtue of this activity makes sense of the “sequence of colliding images” caused by these blanks, which thereby “comes alive in the reader’s imagination.” The relationship between textual “blanks” and reader responses still privileges the former, which is “largely responsible for” and “organizes” reader participation (Iser 1980, p. 119). He remains obscure, however, on how these processes actually work. Of course, given the state of cognitive science at the time, Iser’s assumptions about reader responses had no empirical basis; whether he would have used this kind of scientific data, had it been available to him, is another question however. To try to ascribe a neuroscientific viewpoint avant la lettre to Iser’s view, as Massimo Salgaro has recently done, therefore seems to me at best a fallacious anachronism based on vaguely perceived analogies (cf. Salgaro 2009, pp. 160f.).

Shakespeare and the (Evolved) Pleasures of Revenge

281

far from frivolous or superficial concern. Given the substantial revaluation of the emotions in the wake of the neurosciences’ rethinking of the human mind, emotions are today no longer seen as a perplexing aspect of human behaviour, inexplicable and potentially inconsequential add-ons to our rational minds, but in fact are acknowledged as crucial to the maintenance of existence.8 Without emotions, we literally could not exist; they are, in Antonio Damasio’s words, “part and parcel of the machinery with which organisms regulate survival” (Damasio 2000, p. 54). John Tooby and Leda Cosmides similarly, describe emotions as evolved superordinate programmes whose adaptive function is to co-ordinate the human organism’s responses to environmental stimuli (cf. Tooby and Cosmides 2000b, p. 92).9 Because they are adaptations, emotions are neither spontaneous nor unrestrained, but are executed along the lines of the structured parameters that ultimately developed as best-bet responses to problems posed by Homo sapiens’ ancestral environment. Certain emotions may therefore be at odds with or detrimental in more recent human contexts (a point intrinsically relevant to the topic of revenge and one to which I shall return).10 The fact that our evolved emotions endure even though they are no longer vital, but in fact counterproductive, points us to their instrumentalisation in fictional contexts. As Noël Carroll puts it, emotions are “the cement that keeps audiences connected to the artworks, especially to the narrative fictions, that they consume” (Carroll 1997, p. 191). However, to systematically explain such intuitive appreciations of the role of emotions in the consumption and enjoyment of art, we need to understand their inherent evolutionary logic. An evolutionary perspective may thereby also account for the paradox at the heart of the reception of art: namely that we respond emotionally to literature even when the aesthetic cues it employs to trigger these emotions are negative (cf. Radford 1975). The latter point leads me to the central concern of my essay, Shakespeare’s early tragedy Titus Andronicus, more specifically to the topic of revenge that it explores. Shakespeare’s play traces the decline of an apparently orderly society determined by the rule of law into one in which revenge runs rampant – a social collapse punctuated by acts of violence of a notoriously gruesome kind. To suggest that these representations of violence could be enjoyable may seem a provocative statement to make; however, from an evolutionary perspective this suggestion is far from bizarre. There is evidence that real violence offers “intrinsic” rewards to its perpetrators in the form of enjoyment, whether this derives from the essential thrill of under8 For an overview of the debate see Levinson 1997. 9 See also Nesse 1990. 10 Although revenge is not an emotion itself, it is accompanied by urges and desires (cf. Frijda 1994, p. 265).

282

Anja Müller-Wood

taking a risky activity or the pleasure of demonstrating one’s power and dominance (cf. Eisner 2009). Revenge, as a particular type of violence, may cause similar sensations of satisfaction.11 What is important for my argument is that it does so even in fictional contexts such as drama. Shakespeare’s play has been considered from a variety of perspectives, both textual and contextual. To account for the notorious violent excesses that unfold in the course of the plot, critics have pointed to the Senecan tradition on which Shakespeare draws in the tragedy and the theatrical environment in which it was first performed, the legal-political dimension of its iconography of torture and violence or the religious conflict that one might read into the tragedy’s pervasive motif of remembrance.12 However, because of its cultural focus, most of this critical work appears strikingly evasive. Even when critics acknowledge the psychological significance of revenge in Titus Andronicus, they rarely consider the phenomenon and its emotional dimension as such, but seek to explain it through the external (cultural) influences that shape the view of revenge. In this way, even critics whose aim is to justify the vengeful actions of characters depict this impulse as something inhuman.13 By contrast, an evolutionary perspective allows us to take revenge seriously as a feasible evolved behaviour. To demand that revenge be taken seriously does of course not mean to condone it. However, a somewhat more unflinching take on this phenomenon may open our eyes to hitherto unconsidered aspects of the play in question and thus lead to a more general reconsideration of this notorious tragedy. From an evolutionary perspective, revenge in Titus Andronicus makes sense in two ways. First of all, in the play revenge is depicted as a ubiquitous feature of human behaviour and interaction, linked to an equally ubiquitous 11 As Robert C. Solomon puts it, “vengeance is not just punishment, no matter how harsh. It is a matter of emotion, and like punishment, it is always for some offense, not just hurting for its own sake (even if, in some sense it is deserved).” (Solomon 1994, p. 305). 12 On Titus and Seneca see Braden 1985. Feminist readings come from Cunningham 1990; Rowe 1994; Wilbern 1978. The tragedy’s indebtedness to contemporary confessional debates is discussed by Anderson 2006 and Rist 2008. While the former sees Shakespeare’s play as staging the Reformation’s “battle over signifying practices” (Anderson 2006, p. 32) and hence being “concerned with the same issues of language and representation that structured Foxe’s historiography” (ibid.) – that is, the “Book of Martyrs” – the latter reads it as surreptitiously ventilating a Catholic position in its emphasis on remembrance and burial rites. 13 A striking example is Willis 2002. From a perspective that conjoins trauma theory and feminist criticism, Willis argues that in the play “honor-driven retaliatory practices […] offer to members of both sexes what I will call a perverse therapy for traumatic experience” (p. 25). Whether “trauma” is the appropriate category to explain why in the play “victims can become perpetrators as they attempt to cope with profound threats to self-concept [sic] and with overwhelming emotion” is a question that Willis never raises. What is obvious, however, is that she, in order to explain vengeance, pathologises it as a defensive response to “threats to psychological integrity” (p. 26). My argument is that revenge in the play is pervasive not because characters are traumatised, but because this is a normal, even “natural,” response – in fact an expression of psychological integrity.

Shakespeare and the (Evolved) Pleasures of Revenge

283

concern with kinship and the family.14 Secondly, in the play the representation of revenge is functional, introduced to exploit particular evolved human emotions in the audience. On this second level, Shakespeare affirms the pervasiveness of revenge by exploring the audience’s own ability to experience vengeful emotions. This is not to say that members of the audience have to react in this way, or that all will share the same emotions; nevertheless, the way Shakespeare uses revenge to structure the play’s emotional architecture suggests that he expected a certain reaction from them. On this functional level, the play undercuts whatever moral message it sends out on the level of plot. We may condemn the titular hero’s decline into vengefulness, we may bemoan the violent excesses in which the play culminates not least thanks to his own actions, yet at certain important moments we are invited to realise – physically, viscerally – that the characters’ troubling vengefulness is something we share.

II. The Evolved Nature of Revenge To explain the thematic and emotional relevance of revenge in Shakespeare’s tragedy, we first need to address the function of revenge in human life. Revenge is typically seen as an antiquated, immoderate, indeed a “primitive” (Clare 2006, p. 1) way of regulating human interaction, typical of archaic honour cultures. In William I. Miller’s words, we tend to think “that revenge gives way to law and is inconsistent with it” (Miller 1998, p. 201). And yet, as Miller also points out, even in presumably civilised societies, revenge “retains its allure” (p. 164), as the pervasiveness of fictional representations of revenge indicates: “We still hunger for revenge in one way or another. If we can’t take it ourselves because the law and other competing internal inhibitions won’t let us, we still thrill in fantasies constructed around it.” (p. 165). The representation of revenge in popular culture – from Titus Andronicus to Dirty Harry – suggests that human beings clearly enjoy plots in which a single-minded avenger battles in the name of corrective justice, especially when this battle takes place in a setting where the legal framework has become inept and formulaic. The enjoyment apparently experienced in the exposure to representations of revenge, Miller argues, is related to the principle of retribution that underlies this behaviour – a concern with “getting even” that ultimately con-

14 I am not the first to emphasise the significance of the topic of kinship in Titus Andronicus. Kinship and its relationship with revenge is discussed by Boyd 2004. However, Boyd’s focus is mainly on the (admittedly complex) relationship between Aaron and Titus and its structural significance within the plot, rather than on the topic of revenge in general and its possible emotional significance for the audience.

284

Anja Müller-Wood

nects revenge and the law: “Whatever else revenge may be, it is a style of doing justice.” (p. 168).15 Miller is an anthropologist and not explicitly influenced by evolutionary thought; however, his astute reflections on the continuing pervasiveness of revenge make sense from the perspective of Evolutionary Psychology. Like sociobiology, from which it emerged in the 1980s, Evolutionary Psychology (EP) is interested in human nature; unlike its predecessor, however, this interest focuses less on contemporary human behaviour than on the emergence of the universal neural architecture that directs this behaviour. By extension, EP does not explain human behaviour in terms of fitnessmaximisation, but explores how – thanks to their adapted minds – human beings are able to respond flexibly to a wide range of informational inputs in different contexts (cf. Tooby and Cosmides 2005, p. 13). One of the most important implications of this shift in interest is that EP acknowledges that behaviours and reactions may be maladaptive, if not well-nigh detrimental in contexts where the ancestral pressures that shaped these behaviours have long ceased to apply (cf. Tooby and Cosmides 1990, p. 401). Vengefulness may be considered such a maladaptive behaviour in social contexts regulated by a functioning legal system, which also explains why it is almost universally condemned in modern contexts. However, the cultural artefacts that prove that vengeful impulses remain in place even in presumably civilised contexts (from the Hollywood movies mentioned by Miller to revenge tragedies like Titus Andronicus) urge us to understand how and why these impulses emerged in the first place. EP provides the background for Martin Daly and Margo Wilson’s study of revenge in the context of a larger investigation of homicide. Against pervasive anthropological beliefs, Daly and Wilson point out that revenge is a cross-culturally ubiquitous phenomenon whose apparent universality invites an evolutionary explanation. Revenge, they observe, is fitness-enhancing. In a context of material and reproductive rivalry (such as the ancestral environment in which Homo sapiens evolved), the willingness to take revenge, or the ability to convincingly signal that you have that willingness, may aid the survival of your kin (and, by implication, pass on this proclivity towards vengeance). The ultimate adaptive value of revenge may therefore be its function as a powerful deterrent; however, it is encouraged or discouraged by partic15 Solomon, similarly, connects vengeance and justice when he writes that “vengeance – often maligned in philosophy – already involves a small scale theory of justice, an ‘eye for an eye,’ or what Kant (1889) less violently but more ambiguously called ‘equality’” (Solomon 1994, p. 295). For Nico H. Frijda the lex talionis – the Mosaic principle of an eye for an eye – “represented a major advance in lawfulness” (Frijda 1994, p. 264). The relatedness of the law and revenge is pointed out several times in Titus Andronicus by different characters on either side of the cultural divide (Aaron at II.i.68; Titus at III.i.116–117), suggesting that the two phenomena are clearly related.

Shakespeare and the (Evolved) Pleasures of Revenge

285

ular kinds of social organisation. In some circumstances, acting upon the desire for vengeance – no matter how justified that desire may be – may set off chain reactions of violence, potentially leading to disproportionate and perpetual feuding. This is the worst-case scenario described by Daly and Wilson. However, as they also emphasise, human beings have the ability for compromise and cooperation: we do not (only) act upon our vengeful urges, but are willing to forgo revenge, reconcile and accept retributive alternatives (whether symbolic or material) or engage in the long-term cooperative principle of “titfor-tat”.16 Such strategies of course do not erase or expunge these urges as such, which remain in place even though their ultimate function has become obsolete. Further, cooperation itself bears within it the potential for conflict and vengefulness, caused for instance by non-cooperating individuals in groups (cf. Solomon 1994, p. 307). Revenge and justice are therefore not neatly segregated opposites, but related positions on a behavioural continuum. The fundamental relatedness of revenge and justice makes them particularly interesting for the narrative and performative arts, allowing for the depiction of complex characters and ambiguous psychological states while at the same time catering to the audience’s evolved emotional responses. It will have become clear why the two critical angles just described are mutually enhancing. Daly and Wilson explain why revenge is a pervasive, cross-cultural phenomenon that follows a plausible evolutionary logic, feeding thematic analyses of literary representations of revenge by explaining why these might be meaningful to human beings across cultures. Miller’s point of departure, by contrast, the observation that fictional representations of revenge are potentially enjoyable, draws attention to the reception of fictional depictions of revenge. Taken together, the two perspectives provide a fruitful frame of reference for a differentiated interpretation of Shakespeare’s tragedy from an evolutionary perspective.

III. The Dramatic Representation of Revenge On the surface, Titus Andronicus appears as a highly contrastive play about a clash of cultures: civilised Rome and her barbarous enemies, the Goths, the former determined by justice, the latter by revenge (cf. Sommers, p. 276 and Waith, p. 65). However, in the course of the play these easy distinctions are blurred, as vengefulness runs rampant across the cultural divide, drawing Rome and her enemies into a maelstrom of retributive violence that promises an apocalyptic end. The play, then, illustrates the conditions and effects of

16 Described in Axelrod 1984.

286

Anja Müller-Wood

Daly and Wilson’s worst-case-scenario of incessant feuding, which only a powerful outside force can stop. The immediate trigger of the chain of vengeful events in the play is the political conflict between the late Roman Emperor’s sons Saturninus and Bassianus, who vie for the succession to the Imperial throne. Their first entrance on stage through two opposite doors emphasises the factionism that divides the Republic: “Enter the Tribunes and Senators aloft; and then enter below Saturninus and his followers at one door, and Bassianus and his followers at the other, with drums [and colours].”(I.i., Stage direction).17 Titus Andronicus – a general who has just returned from a successful campaign against the Goths with a group of illustrious prisoners in tow – is drawn into this conflict when he is chosen to name the future Emperor. His decision to support Saturninus implicates him and his family in the larger struggle for political power. Yet it is precisely because the personal antagonism between the Andronici and Tamora’s family becomes enmeshed in this conflict that it is blown out of all proportion. The newly elected Emperor decides to marry Titus’s daughter Lavinia, thereby further antagonising his brother Bassianus, to whom she is at this point already betrothed. The ensuing brawl around Lavinia not only divides the Andronici, as Titus sees his sons’ support of Bassianus an act of filial disloyalty, leading him to kill one of them; it also provides the Goth Queen Tamora with an ideal position from which to enact her private revenge on Titus – who by way of asserting his honour had ritually sacrificed her own son Alarbus – when Saturninus unexpectedly abandons Lavinia to marry Tamora. In Shakespeare’s tragedy, political context and individual interests interact in a particularly pernicious way. Ruled by an erratic dictator and riven by internecine conflict, Rome is far from a sanctuary of law and justice; instead, the republic’s social order is a merely superficial frame within which the vengeful urges of individuals can run out of control. Although the play thereby suggests that revenge is more likely to occur in some environments than in others – emphasising not least that social stability is a political responsibility – it also acknowledges that in the final analysis revenge is a very personal thing. Shakespeare emphasises the latter point by foregrounding the kinship concerns that provide the ultimate reason for the chain of violence that unsettle Rome. Despite its political theme, the play is essentially a story of three families fending for survival and supremacy (a struggle taking place within the larger framework of the symbolic family of Rome): the Emperor’s sons, the Goth Queen Tamora and her children and the Andronici clan. These personal concerns are obviously exacerbated by the context of war, in which, we are told at the outset, Titus has already lost 21 of his 25 17 All references to the play are taken from the Arden edition, edited by Jonathan Bate (London, New York, 1995).

Shakespeare and the (Evolved) Pleasures of Revenge

287

sons – half as many as the legendary King Priam. The true implications of this loss become apparent for instance when Titus addresses his daughter in Act one: “Lavinia, live, outlive thy father’s days / And fame’s eternal date, for virtue’s praise” (I.i.170–171). Children are a bet on the future and pillars of a family line; as such, they connect past and present, as Titus’s son Lucius’s affirms, when he reminds his father that he is the “soul and substance of us all” (I.i.379). Their loss is not only an accumulation of individual deaths, but may potentially bring about the end of a family. Importantly, however, the Andronici are not the only kinship group in the play to think along these lines. Titus’s words to his daughter echoes those with which Saturninus justifies his claim to the throne: “I am his firstborn son that was the last / That wore the imperial diadem of Rome: Then let my father’s honours live in me, / Nor wrong mine age with this indignity” (I.i.5–8). The same concept of kinship may help explain Queen Tamora’s desperate pleas for her son Alarbus (as well as the vehemence of her revenge when Titus has him killed brutally). And the same principle is apparent in the admiration expressed by one of the Goth warriors summoned by Titus’s son Lucius to terminate the feud, when he calls him a “brave slip, sprung from the great Andronicus” (V.i.9).18 Such references to family bonds and kinship are far from metaphorical, however. Shakespeare is here invoking what Thomas Hardy would call, at the beginning of the twentieth century, “the family face” (Hardy 1998, p. 109): the inherited features that connect members of a family across generations. On the one hand, the apparently universal concern with family and kin has a levelling effect, crossing the political and ethnic boundaries that otherwise divide the characters.19 On the other hand, this concern is also a powerful source of conflict, as the example of Titus Andronicus illustrates – a play whose plot could be boiled down to the central tension between “concern for our kind and unconcern for others” (Boyd 2004, p. 66). This tension is reflected not least by the spectre of miscegenation overshadowing the plot. The child fathered by the black character Aaron with the Goth queen is described as “a joyless, dismal, black, and sorrowful issue” (IV.ii.66). Titus likens his daughter Lavinia after her rape and mutilation by Tamora’s sons to a “spring […] stained with mud” and “goodly summer” mixed with the “winter” of the Goths (V.ii.170–171) – and eventually kills her for that reason. By analogy, Saturninus’s and Tamora’s union creates a political impurity leading to the destabilising of Rome and the atrocities that follow in its wake. However, the play also insinuates that in 18 This overarching concern also blurs the distinction sometimes made between Tamora and her sons and the “very civilized lot” of Goth that supports Lucius’s uprising at the end of the play (Bate 1995, p. 19). 19 The blurring of the boundaries between cultures has already been observed by critics, but not explained in any plausible way (cf. Liebler 1994, p. 277).

288

Anja Müller-Wood

some circumstances it may be wise to expand one’s allegiances beyond the limits of your immediate kin, as at the end of the play it is symbolic miscegenation in the form of cooperation across political factions, which resolves the conflict when Lucius liberates Rome with the aid of a group of renegade Goths. Nevertheless, in the situation of clashing kinship groups that is so emphatically established at the beginning of the play, vengeance is not only an option, but almost an inevitability. Whatever retributive rituals are available in Rome to keep conflict in check – the sacrifice of Alarbus, for instance, performed to mark the end of violence – they are unhinged by the “passions bottomless” (III.i.216) triggered by the succession of injustices and slights that precipitate Titus into madness: the rape and mutilation of his daughter and the murder of two more of his sons, both undertaken with the Emperor’s approval. These unfathomable passions, which dovetail with Titus’s slow but steady alignment with his enemies, are expressed through an imagery of inundation and excess. In his most striking soliloquy, Titus visualises the inconceivable excessiveness of his pain by likening himself to both the raging sea and the land submerged by it (III.i.226); for these miseries, he claims, there are no limits. And yet, one is led to wonder whether madness is here not merely instrumentalised to justify a bloody vendetta, providing Titus with an antic disposition that allows him to enact his revenge with determined (and far from irrational) precision – up to its outrageous climax, when he kills Tamora’s remaining sons Chiron and Demetrius, bakes them into a pie and places it before their unassuming mother to eat. That Titus’s vengeful reactions are not merely irrational is also underlined by the kinship concerns that underpin them, which Titus shares with several other characters. Disturbingly, however, it is Aaron – Tamora’s black lover and the embodiment of absolute, inexplicable maliciousness – who is Titus’s closest mirror image in this regard. A Vice character whose violence requires no explanation, Aaron at first seems to stand apart from the play’s emotional economy: connected to no one, he is pure malice. After the birth of the child he had fathered with Tamora, his actions are suddenly driven by a concern with the life and well-being of his “flesh and blood” (IV.ii.86), which links him to other characters in the play. As Aaron joins the ranks of worried / grieving parents in the play, his feelings and the behaviour resulting from them become plausible and human. This, in turn, is also true of Titus, whose mad vengeance is exposed as an all too human phenomenon thanks to the mirror image presented by Aaron (cf. Boyd 2004, pp. 64f.).20

20 Note that my accent falls slightly differently. While Boyd focuses on the way the similarity between Aaron and Titus makes the former more human, I am interested in the effect of this interaction on our view of Titus.

Shakespeare and the (Evolved) Pleasures of Revenge

289

From an evolutionary perspective, Shakespeare’s tragedy may be seen as illustrating that revenge is a human universal that connects people across cultures and nothing more. Yet this kind of mimetistic explanation, according to which art is a mirror image of human behaviour and hence a mere repository of anthropological data, is a rather limited perspective to take for a literary scholar.21 Dramatic or literary characters are no human beings, even if their actions exist in a referential relationship with reality. Furthermore, such interpretations tell us little about the potential effects of art and the kind of readerly / audience expectations they presume. From this perspective, texts are no mere mirrors of reality, but aesthetic structures that not only orchestrate the responses of the audience, but actually respond to their evolved cognitive predispositions. If revenge is a pervasive topic in Shakespeare’s play on the level of plot, it becomes most striking and obvious when considered from the point of view of reception, where it harnesses the evolved cognitive and emotional predispositions of the audience.

IV. Staging Audience Emotions Even if Shakespeare’s characters are not human beings, they are to a certain extent modelled on real human experience; hence the emotional rationale that drives their actions might not be unfamiliar to the audience. In fact, one might argue that without those emotions the play would not be understandable: the genre of revenge tragedy can only exist if the audience knows what revenge means – and how it feels. The playwright’s intuitive awareness of these emotional predispositions becomes apparent in the representational strategy of dramatic irony – essentially, as is well known, an information deficit on the level of the plot which gives the viewer of a play (although this applies to readers of fiction, too) the cognitive advantage over a character (cf. Pfister 2001, p. 83). Inevitably, dramatic irony shapes also the audience’s emotional responses. Yet although the study of dramatic irony is a staple of drama criticism, its effects and theatrical significance may be underestimated or misjudged, particularly when it is deployed in connection with such a thorny topic as revenge. An illustrative example is Ronald Broude’s claim that “revenge tragedy […] us[es] dramatic irony to enable the audience to savor [sic] the process by which the criminal, too nearsighted to doubt his control over events, proceeds headlong toward death and damnation” (Broude 1975, p. 54). Hence for Broude in instances of dramatic irony audiences not only have a cognitive advantage over the character, they are also morally “better.” Such a conflation of cognitive and moral superiority disregards the possibility that in situations of 21 A point made, convincingly and repeatedly, by Karl Eibl and Katja Mellmann (see, e.g., 2007).

290

Anja Müller-Wood

dramatic irony the audience may actually identify with or admire their supposed objects of criticism. Broude’s notion of dramatic irony is therefore normative rather than functional, defining audience reactions on the basis of his own set of values, rather than investigating which responses may be realistic and why. The most general way of establishing dramatic irony is genre, a metainformation which inevitably sets in motion particular expectations on the part of the recipient. Genre thereby also tags an artefact as fictional, immediately putting in perspective the information provided. This ability of tagging comes under what John Tooby and Leda Cosmides call “scope syntax”: a set of cognitive procedures evolved to identify the source of information and assess its applicability and relevance (cf. Tooby and Cosmides 2000a). Precisely because we have the ability to distinguish between fact and fiction, literature can evoke and explore the audience’s cognitive and emotional abilities without running the risk of causing actual behaviour. It provides the frame within which these abilities are initiated in what Tooby and Cosmides call the “organisational” mode, in which the human neural architecture is merely finessed and trained. Actual behaviour, by contrast, is activated in what they label the “functional” mode (cf. Tooby and Cosmides 2001). Because of our cognitive ability to identify information as fictional, literature can act as a dummy triggering real existing human emotions, however without leading us to act upon them (cf. Mellmann 2006, pp. 42f.). Dramatic irony puts the audience a step ahead of the plot, with the effect of creating both a sense of intellectual satisfaction (because viewers know what’s coming) and an unnerving feeling of foreboding (because they know what’s coming): as such, it can be employed to produce suspense (cf. Mellmann 2007). Much of the dramatic irony in Titus Andronicus focuses on the Andronici, notably on Titus, who for too long underestimates the severity of the situation and repeatedly misreads the intentions of others. Titus seems deaf to the dictatorial undertone of Saturninus’s words when he commands him to hasten his decision on who should become Emperor: “Andronicus, would thou were shipped to hell / Rather than rob me of the people’s hearts” (I.i.210–211). This instance may already mark the beginning of the audience’s doubts about the general’s choices, which are subsequently affirmed as the principles and implications of Saturninus’s politics become apparent. This awareness is transmitted through a chain of asides, in which characters reveal their feelings, thoughts and plans to the audience, while leaving Titus and other characters in the dark. In an aside in act one the audience learns about Saturninus’s sudden infatuation with Tamora, although he had only shortly before claimed Titus’s daughter Lavinia as his wife: admiringly he describes her under his breath as “[a] goodly lady, trust me, of the hue / That I would choose were I to choose anew” (I.i.265– 266). This information may diminish the audience’s surprise when he pro-

Shakespeare and the (Evolved) Pleasures of Revenge

291

poses to the Goth Queen not too long afterwards. But the sense of unease that Saturninus’s rejection of Lavinia (and thereby the Andronici clan as such) may have created in the audience is exacerbated when Tamora unexpectedly suggests a truce between the Andronici and herself. The worries this offer might trigger in the audience is affirmed a little later when, again in an aside to Saturninus, Tamora suggests that he “dissemble all [his] griefs and discontents” (I.i.448) to enable her to plot against the Andronici until eventually she will “massacre them all” (I.i.455). Against this promise of overkill, Titus’s trust in Tamora’s assertion that she will abandon her vendetta against his family because she is now an “incorporate in Rome” (I.i. 462), speaks of his naivety and confirms the audience’s awareness of the terrible shape of things to come. The gap between the intentions and threats announced in the asides and Titus’s reactions to them is filled, I have suggested, by the audience. The incremental choreography of dramatic irony that structures the play keeps the audience a step ahead cognitively and emotionally. By the time Titus responds to Saturninus’s announcement that he will marry Tamora, the audience has already had time to react, be it with disappointment, anger or fear. By contrast, Titus’s comparison of the Emperor’s words to “razors to my wounded heart” (I.i.319) comes across as a somewhat lame paraphrase of emotions the audience has potentially already felt. This cognitive and emotional advantage on the part of the audience is exploited most strikingly in the climactic scene in Act three in which, according to M. C. Bradbrook, Titus turns from “lamenter” to “revenger” (Bradbrook 1979, pp. 105f.) and finally resolves to take action. This is the point when Titus has reached his absolute nadir: his daughter Lavinia raped and mutilated, his sons Quintus and Martius falsely imprisoned by Saturninus for the murder of his brother Bassianus and the former war hero himself reduced to a persona non grata. At this point of utter despair, he is visited by Aaron, who suggests that the Emperor might be willing to liberate Titus’s sons in exchange for their father’s hand. Driven by despair and apparently convinced that the “eye-for-an-eye” calculus will finally put an end to violence, he has Aaron chop off his hand – sending him off with a triumphant comment: Good Aaron give his majesty my hand. Tell him it was a hand that warded him From thousand dangers, bid him bury it: More hath it merited; that let it have. As for my sons, say I account of them As jewels purchased at an easy price, And yet dear too, because I bought mine own. (III.i.194–200)

292

Anja Müller-Wood

Yet Titus’s confidence is put in perspective by the double layer of dramatic irony that surrounds this scene. First of all, there still is Tamora’s earlier proclamation that she will extinguish the Andronici, in view of which a “deal” like the one Titus believes to have struck by cutting off his hand is no longer an option. In this larger context of total destruction, the hopes that lead Titus to resort to such a desperate deed are at best naïve. Second, his mutilation is framed by Aaron’s revealing asides, in which the audience learns that the Emperor has no intention of releasing Titus’s sons. Having revealed, before cutting off Titus’s hand, that he is about to “deceive” him, Aaron states after the horrific act: I go, Andronicus, and for thy hand Look by and by to have thy sons with thee. [aside] Their heads I mean. O, how this villainy Doth fat me with the very thoughts of it. (III.i.201–204)

Equipped with this information, the audience already knows before Titus that his hopes will be brutally dashed. He only learns this from the messenger who appears on stage carrying the general’s hand and the heads of his executed sons. But the messenger’s brief appearance may well be taken as a nod to the audience, as his position vis-à-vis Titus is similar to theirs. Like the audience, he has a cognitive advantage over the fallen hero whom he informs about the death of his children (and Aaron’s betrayal) and anticipates the pain of which Titus is as yet not aware: “Woe is me to think upon thy woes” (III.i.240). What he – as well as the audience – might therefore also be anticipating is Titus’s sudden (but far from irrational) resolve to avenge his children (cf. III. i.271–279). From this point onwards, Titus’s understanding of the situation and that of the audience no longer diverge and neither do their emotional responses. Titus’s triumph when he finally manages to get his own back on his enemies is the audience’s triumph, too, and it is justified because by that time Tamora is at the receiving end of the dramatic irony. When Titus puts the pie containing the remains of her sons before her, she is unaware of what she is about to eat. The audience, of course, knows what will happen and gleefully anticipates the horror that will accompany Titus’s unveiling of his secret. Only the knowledge that what they are watching and enjoying is only theatre frees the viewers from also “paying” for the bloody act of vengeance in which they are, both cognitively and emotionally, very active accomplices. Having said that, the awareness that in this plot they are not merely consumers, but also – at least when considered from an evolutionarily perspective – producers, might be a source of enjoyment in itself and could explain why even Shakespeare’s bloody theatre of revenge might be particularly pleasurable.

Shakespeare and the (Evolved) Pleasures of Revenge

293

References Abbott, H. Porter, “The Evolutionary Origins of the Storied Mind: Modelling the Prehistory of Narrative Consciousness and Its Discontents,” in: Narrative 8 (2000), pp. 247–256. Anderson, Thomas P., Performing Early Modern Trauma from Shakespeare to Milton, Aldershot: Ashgate, 2006. Aristotle, Poetics, ed. by Malcolm Heath, London: Penguin, 1996. Axelrod, Robert M., The Evolution of Cooperation, New York: Basic Books, 1984. Bate, Jonathan, “Introduction,” in: William Shakespeare, Titus Andronicus, ed. by J. Bate, Arden Shakespeare Series, London, New York: A & C Black, 1995, pp. 1–122. Boyd, Brian, “Kindness and Unkindness: Aaron in Titus Andronicus,” in: Words that Count: Essays in Honor of MacDonald P. Jackson, ed. B. Boyd, Cranbury, NJ: Rosemont, 2004, pp. 51–77. –, On the Origin of Stories. Evolution, Cognition and Fiction, Cambridge, MA, London: Harvard UP, 2009. Bradbrook, M. C., Shakespeare and Elizabethan Poetry: A Study of his Earlier Work in Relation to the Poetry of the Time [1951], Cambridge: Cambridge UP, 1979. Braden, Gordon, Renaissance Tragedy and the Senecan Tradition, New Haven: Yale UP, 1985. Broude, Ronald, “Revenge and Revenge Drama in Renaissance England,” in: Renaissance Quarterly 28.1 (1975), pp. 38–58. Carroll, Noël, “Art, Narrative, and Emotion,” in: Emotions and the Arts, ed. by Mette Hjort and Sue Laver, Oxford, New York: Oxford UP, 1997, pp. 190–211. Clare, Janet, Revenge Tragedies of the Renaissance, Horndon: Northcote House Publishers Ltd., 2006. Cunningham, Karen, “‘Scars Can Witness’: Trials by Ordeal and Lavinia’s Body in Titus Andronicus,” in: Women and Violence in Literature, ed. by Katherine Anne Ackley, New York, London: Palgrave Macmillan, 1990, pp. 139–155. Damasio, Antonio, The Feeling of What Happens: Body, Emotion and the Making of Consciousness [1999], London: Vintage, 2000. Dissanayake, Ellen, What is Art For? Seattle: University of Washington Press, 1988. Eibl, Karl / Katja Mellmann, “Literatur als Repertorium der Soziobiologie,” in: KulturPoetik 7.2 (2007), pp. 277–283 (19 December 2009: http://www.uni-saarland.de/ fak4/fr41/Engel/kulturpoetik/rez1403%20-%20Eibl-Mellmann.htm). Eisner, Manuel, “The Uses of Violence: An Examination of Some Cross-Cutting Issues,” in: International Journal of Conflict and Violence 3.1 (2009), pp. 40–59. Frijda, Nico H., “The Lex Talionis: On Vengeance,” in: Emotions: Essays on Emotion Theory, ed. by Stephanie H. M. Van Goozen, Nanne E. Van de Poll and Joseph A. Sergeant, Hillsdale, NJ: Laurence Erlbaum Associates, 1994, pp. 263–289. Hall, Stuart, “Encoding/Decoding,” in: The Cultural Studies Reader, ed. by Simon During, London, New York: Routledge, 1999, pp. 508–517. Hardy, Thomas, “Heredity,” in: Thomas Hardy: Selected Poems, ed. by Robert Mezey, London: Penguin Classics, 1998, p. 109.

294

Anja Müller-Wood

Iser, Wolfgang, “Interaction between Text and Reader,” in: The Reader in the Text: Essays on Audience and Interpretation, ed. by Susan R. Suleiman and Inge Crosman, Princeton: Princeton UP, 1980, pp. 106–119. Levinson, Jerrold, “Emotion in Response to Art: A Survey of the Terrain,” in: Emotions and the Arts, ed. by Mette Hjort and Sue Laver, Oxford, New York: Oxford UP, 1997, pp. 20–34. Liebler, Naomi Conn, “Getting it All Right: Titus Andronicus and Roman History,” in: Shakespeare Quarterly 45.3 (1994), pp. 263–278. Mellmann, Katja, Emotionalisierung – Von der Nebenstundenpoesie zum Buch als Freund: Eine emotionspsychologische Analyse der Literatur der Aufklärungsepoche, Paderborn: Mentis, 2006. –, “Vorschlag zu einer emotionspsychologischen Bestimmung von ‘Spannung’,” in: Im Rücken der Kulturen, ed. by Karl Eibl, Katja Mellmann and Rüdiger Zymner, Paderborn: Mentis, 2007, pp. 241–268. –, “Mimetistische Tendenzen im ‘Literary Darwinism’: Über Sinn und Unsinn in gegenwärtigen Versuchen einer evolutionsbiologischen Literaturbetrachtung,” in: Literaturkritik.de 2 (February 2009) (19 January 2010: http://www.literaturkritik.de/public/rezension.php?rez_id=12715&ausgabe =200902). Miller, Geoffrey, The Mating Mind: How Sexual Choice Shaped the Evolution of Human Nature, New York: Anchor, 2000. Miller, William Ian, “Clint Eastwood and Equity: Popular Culture’s Theory of Revenge,” in: Law in the Domains of Culture, ed. by Austin Sarat and Thomas R. Kearns, Ann Arbor: University of Michigan Press, 1998, pp. 161–202. Miola, Robert S., Shakespeare and Classical Tragedy, Oxford: Oxford UP, 1992. Nesse, Randolph M., “Evolutionary Explanations of Emotions,” in: Human Nature 1.3 (1990), pp. 261–298. Phelan, James, “Dual Focalization, Retrospective Fictional Autobiogaphy, and the Ethics of Lolit,” in: Narrative and Consciousness: Literature, Psychology, and the Brain, ed. by Gary D. Fireman, Ted E. McVay, Jr., and Owen J. Flanagan, Oxford: Oxford UP, 2003, pp. 129–145. Pfister, Manfred, Das Drama, Munich: Fink, 2001. Pinker, Steven, “Toward a Consilient Study of Literature,” in: Philosophy and Literature 31 (2007), pp. 161–177. Radford, Colin C., “How Can We Be Moved by the Fate of Anna Karenina?” in: Proceedings of the Aristotelian Society, Supplementary Volume 49 (1975), pp. 67–80. Rist, Thomas, Revenge Tragedy and the Drama of Commemoration in Reforming England, Aldershot: Ashgate, 2008. Rowe, Katherine A., “Dismembering and Forgetting in Titus Andronicus,” in: Shakespeare Quarterly 45.3 (1994), pp. 279–303. Salgaro, Massimo, “The Text as Manual: Some Reflections on the Concept of Language from a Neuroaesthetic Perspective,” in: Journal of Literary Theory 3.1 (2009), pp. 155– 166. Shakespeare, William, Titus Andronicus, ed. by Jonathan Bate, Arden Shakespeare Series, London, New York: A & C Black, 1995. Solomon, Robert C., “Sympathy and Vengeance: The Role of the Emotions in Justice,” in: Emotions: Essays in Emotion Theory, ed. by Stephanie H. M. Van Goozen, Nanne E.

Shakespeare and the (Evolved) Pleasures of Revenge

295

Van de Poll and Joseph A. Sergeant, Hillsdale, NJ: Laurence Erlbaum Associates, 1994, pp. 291–311. Sommers, Alan, “‘Wilderness of Tigers’: Structure and Symbolism in Titus Andronicus,” in: Essays in Criticism X.3 (1960), pp. 275–289. Tooby, John / Leda Cosmides, “The Past Explains the Present: Emotional Adaptations and the Structure of Ancestral Enviroments,” in: Ethology and Sociobiology 11.4/5 (1990), pp. 375–424. –, “Consider the Source: The Evolution of Adaptations for Decoupling and Metarepresentation,” in: Metarepresentations: A Multidisciplinary Perspective, ed. by Dan Sperber, Oxford: Oxford UP, 2000, pp. 53–115 (= 2000a). –, “Evolutionary Psychology and the Emotions,” in: Handbook of Emotions, ed. by M. Lewis and J. M. Haviland-Jones, New York: Guilford Press, 22000, pp. 91–115 (= 2000b). –, “Does Beauty Build Adapted Minds? Toward an Evolutionary Theory of Aesthetics, Fiction and the Arts,” in: SubStance 30.1/2 (2001), pp. 6–27. –, “Conceptual Foundations of Evolutionary Psychology,” in: The Handbook of Evolutionary Psychology, ed. by D. M. Buss, Hoboken, NJ: Wiley, 2005, pp. 5–67. Waith, Eugene M., “Introduction,” in: Titus Andronicus, ed. by E. M. Waith, Oxford: Oxford UP, 2002, pp. 1–69. Wilbern, David, “Rape and Revenge in Titus Andronicus,” in: English Literary Renaissance 8.2 (1978), pp. 159–182. Willis, Deborah, “‘The gnawing vulture’: Revenge, Trauma Theory, and Titus Andronicus,” in: Shakespeare Quarterly 53.1 (2002), pp. 21–52. Wilson, D. S. / Jonathan Gottschall (eds.), The Literary Animal: Evolution and the Nature of Narrative, Evanston: Northwestern UP, 2005.

296

Judith P. Saunders

Nepotism in Hawthorne’s “My Kinsman, Major Molineux” A Darwinian Approach to a Classic Text Judith P. Saunders

As its title plainly announces, Hawthorne’s 1832 short story, “My Kinsman, Major Molineux,” concerns itself with the blood ties of family. The fact of kinship drives development of plot, setting, character, and theme; nepotism is the object of auctorial attention throughout. Hawthorne examines expectations for preferential treatment of relatives, along with the social context in which such favoritism manifests itself. Community reactions to the privileges and obligations of family relationship in fact assume central importance in the protagonist’s experience. The story lends itself readily, in consequence, to Darwinian analysis; indeed, it appears to demand it. Insights from evolutionary biology serve to illumine the workings of this much admired text, usefully augmenting the already rich body of commentary it has generated over the past fifty years. Its central preoccupations are clearly rooted in principles of inclusive fitness and kin selection. William Hamilton was among the first to recognize that individuals pass on genes indirectly as well as directly, that is, through the reproductive success of their relatives as well as by means of their own personal reproductive efforts (cf. Dawkins 1989, p. 90; Burnstein 2005, pp. 528f.). Siblings and cousins, for example, who raise viable offspring contribute to the total number of an individual’s genes represented in the next generation, that is, to that individual’s inclusive fitness. Thus individuals without offspring (whose direct fitness is zero) nonetheless may leave a genetic legacy in ensuing generations through the reproductive efforts of kin. By the same token, those who do have offspring stand to raise their degree of fitness through the descendents of those to whom they are related (cf. Dawkins 1989, pp. 91–95). The fitness benefits inherent in the reproductive success of kin help to explain nepotistic behavior, that is, altruism directed preferentially toward relatives (cf. Daly and Wilson 1983, p. 45). Because of the potential genetic payoff, individuals are apt to offer more substantial assistance to siblings and children, or to nieces and nephews, for example, than any they ordinarily provide to unrelated persons. The success in life even of collateral kin can

Nepotism in Hawthorne’s “My Kinsman, Major Molineux”

297

enhance the altruist’s inclusive fitness (cf. Daly and Wilson 1983, p. 48). The closer the degree of relatedness, the more likely investment becomes: for instance, an individual’s own children, who share half of each parent’s genes, typically will be favored over a sibling’s children, who share approximately one-quarter of an aunt’s or uncle’s genes (cf. Dawkins 1989, pp. 93f.). The age, health, and socioeconomic circumstances of both helper and recipient also influence the likelihood of aid (cf. Trivers 2002, p. 35; Dawkins 1989, p. 95; Burnstein 2005, pp. 541f.). Investment in sickly, or post-reproductive, or physically unattractive, or socially disagreeable relatives, for example, is not likely to pay off in terms of realized fitness. Predictably, too, resources tend to flow from prosperous members of a family toward those less well off, since costs to the giver stand to be significantly outweighed by benefits to be enjoyed by a conspicuously more needy recipient. Action in “My Kinsman, Major Molineux” is initiated by “hints” of benefits to be conferred by a wealthy, high-status individual upon a relative possessing far fewer resources (cf. p. 224).1 Inclusive fitness theory explains the Major’s motives: this “childless” man lacks direct descendents in whom to invest and, being “elderly,” he evidently deems it unlikely now that he will sire offspring in the future (cf. pp. 224, 228). Enjoying “inherited riches” and “acquired … rank,” he acts to promote his indirect fitness by offering assistance to one member of the family constituting, readers must assume, his closest living kin (cf. p. 224): the protagonist’s father and the Major are “brothers’ children” (p. 224). Although there is reason to suppose that the Major’s wealth and status are not altogether new, and that he has for some time enjoyed material well-being exceeding that of his cousin, he does not offer help until late in life when the probability that he will have children of his own has grown very low. The timing of his offer is significant because the assistance he gives to his first cousin’s son is unlikely, at this point, to reduce any possible investment in offspring of his own (see Dawkins 1989, pp. 89f.). He would have passed on to a child exactly one-half of his genes, but he shares only one-eighth, approximately, with his first cousin, and onehalf of that amount (approximately one-sixteenth) with his cousin’s son. Any genetic legacy is better than none, clearly, so that the Major’s decision to underwrite “the future establishment … in life” of a first cousin once removed represents the best he can do, reproductively speaking, at this moment in his life (cf. p. 224). Arguably, too, the assistance he gives to one member of his cousin’s family stands to benefit others indirectly. The Major’s cousin has four children, evidently: remembering the home he has left, the protagonist, Robin, 1

This and all following parenthetical page references are to Nathaniel Hawthorne, “My Kinsman, Major Molineux,” in: The Snow-Image and Uncollected Tales, Centenary Edition, vol. 11, ed. by William Charvat et al., Columbus: Ohio State UP, 1974, pp. 208–231.

298

Judith P. Saunders

recalls an “elder brother” and two younger sisters (cf. p. 223). Now relieved of all need to help his second son find a place in life, Robin’s father may be able to do more for his other three children. Robin himself, once established in an advantageous economic and social position in the larger arena of “town,” may be expected to offer various kinds of aid to his siblings, with each of whom he shares approximately one-half his genes – a much larger percentage than any of them shares with the Major. Robin might help with monetary support for the brother remaining on the family farm, perhaps, or marriage opportunities for his sisters. His generosity to siblings could well exercise a positive impact upon their reproductive success and, eventually, that of their children. Because the workings of nepotism incline an individual whose situation in life improves to pass on some of the benefits gained to close kin, enhanced status and resources tend to be distributed throughout a family in ever expanding circles. In short, an act of altruism directed toward a single related individual has the potential to enhance Major Molineux’s inclusive fitness to a degree impossible to calculate precisely. The Major’s motives in choosing Robin as the recipient of his future favors fit well with the predictions of inclusive-fitness theory, as do Robin’s family’s motives in concurring with that choice. The selection of a male rather than a female no doubt reflects the historical period in which the story is set. Given the circumscribed vocational options for women in eighteenth-century America, Robin’s sisters would be less able than their brothers to take advantage of many kinds of opportunities for professional advancement. Probably the most the Major could do for a niece would be to arrange an advantageous marriage. As an unmarried man himself, however, he would be poorly placed to take on guardianship of a young girl with a rural upbringing, to give her the social education and polish necessary to launch her effectively in high-status circles. If she were to achieve prosperity and social prominence through marriage, furthermore, a woman would be less likely than her male counterpart to be able to increase that wealth or to extend the range of her family’s dominance. It is not impossible that a particular individual woman might achieve such things better than a specific individual man, obviously; it is simply less probable, on average, that she could do so in the social setting Hawthorne defines. Given the existence of high-quality male offspring in his cousin’s family, therefore, Major Molineux presumably never considers the daughters as candidates for his assistance. Only in the absence of suitable male kin would he be predicted to choose a female beneficiary for his altruism. Of the two sons, the younger is preferred for a constellation of reasons. He is conspicuously available for outside investment because his family has no particular vocational goal marked out for him, nor is his father in an economic position to pay for educational or business opportunities. As a second son, traditionally a position that leaves young men at loose ends when inheritance

Nepotism in Hawthorne’s “My Kinsman, Major Molineux”

299

favors primogeniture, Robin has nothing to lose by placing his destiny in the Major’s hands. The elder of the two brothers, in contrast, has expectations: he is “destined to succeed to the farm” owned by his father (p. 224). Although the farm appears to be modest in size and productivity, a well-defined future is secured to the eldest male through the inheritance of land in an agriculturally based economy. By default, then, it seems, the Major’s choice falls upon Robin, a boy with no identified prospects in life. The narrator’s descriptions of this physically robust and facially attractive young man indicate to readers, moreover, that the Major has good reason to regard Robin as a promising object of his “generous intentions” (p. 225). With his “vigorous shoulders,” “well-shaped limbs,” and “well-shaped features,” Robin displays the bodily strength and facial symmetry humans worldwide have been shown to prefer (Buss 2007, p. 144). He is said to be “handsome” and “athletic” (pp. 209, 217f.). His “bright, cheerful eyes” give evidence of energy and intelligence, as well as an agreeable disposition (cf. p. 205). In short, Robin’s outward appearance signals traits associated cross-culturally with dominance and high mate value (cf. Buss 2003, pp. 38–41). Commanding youth and vigor, good looks and a cheerful temperament, he is in a position to maximize his cousin’s investment in him, that is, to become socially and materially successful, to marry well, and to enhance his benefactor’s genetic legacy. It is reasonable to suppose that if Robin had not possessed such promising personal traits, he would not have been designated as “rather the favorite” (p. 225). Readers are told, after all, that Major Molineux “manifested much interest” in both brothers during his visit to their home (p. 224). If, under such scrutiny, the second son had failed to evince the right kind of qualities, the Major very likely would have bestowed his favor elsewhere in the family. There is evidence, too, that the Major may be influenced in his choice by some degree of physical resemblance between Robin and himself: phenotypic cues are an important factor in kin recognition, across species, and thus a powerful predictor of nepotistic altruism (Daly and Wilson 1983, pp. 51–55). The “fair woman” who describes Robin as “the good old gentleman’s very picture” may be mouthing empty flattery, to be sure, but the boy is quick to assume that an innkeeper’s “superfluous civility” is motivated by detection of a “family likeness” (pp. 217, 213). Robin’s thinking on this point suggests that similarities in appearance already have been noted (no doubt during the Major’s visit to his country relatives) and have elicited comment. Explanation of the Major’s nepotistic motives and intentions occupies very little narrative space in Hawthorne’s tale. One of the chief ironies in the final portion of the unfolding plot, of course, is that the projected benevolence never will be realized. Following Robin through a New England town on his frustrated quest to locate Major Molineux and “begin the world” with his kinsman’s promised assistance, Hawthorne directs attention toward

300

Judith P. Saunders

the social impact of nepotism (cf. p. 225): he foregrounds community reactions to kinship. As the tired and hungry young traveler makes his way through an unfamiliar community, larger and more populous than any he has known previously, he initiates a series of social exchanges that end, without exception, badly. He is thwarted repeatedly in his efforts to obtain directions to his kinsman’s dwelling, and the individuals who refuse to answer his inquiries treat him with varying degrees of hostility and ridicule. Baffled by the rude responses his simple and seemingly harmless quest for information elicits, the youth grows increasingly agitated, even belligerent. His efforts to communicate are foiled, as he eventually discovers, by his insufficient knowledge of the community he has entered and his faulty assumptions about the position Major Molineux occupies in its status hierarchy. Robin’s behavior is colored throughout by his conviction that his kinsman is a politically and economically powerful person. He not only expects to find the Major residing in a “worthy” house located in the most prosperous part of town, he assumes that everyone he meets will recognize the name of Molineux and accord it respect (cf. p. 210). He anticipates, in addition, that announcement of his familial connection to such a high-ranking individual will ensure him a gracious reception. Even though he makes an obviously countrified impression with his shabby, homemade clothing and oak cudgel, he does not imagine that his unprepossessing appearance could or “should outweigh the name of [his] kinsman, Major Molineux” (p. 215). He is confident, rather, that community members’ behavior will be guided by adaptations in human nature based on principles of kin selection. He knows, without consciously thinking about it, that people are inclined to guard the interests of those with whom they share genes and that, in consequence, they tend to resent and avenge insult or injury to relatives. He bases his own behavior, and his analysis of the behavior of others, on the corollary assumption that people refrain with particular care from antagonizing the kin of high-dominance individuals, since such individuals are especially well equipped to retaliate. Unarticulated and deep-seated awareness of the operations of nepotism in a social context explains Robin’s certainty that even a redneck lad without resources will be treated respectfully if he is related to a person of recognized status. When the first “citizen” he accosts dismisses him with “excessive anger and annoyance,” Robin is nonplussed (p. 211). Why would anyone risk antagonizing the relative of a powerful man like his cousin? Asking himself what could motivate this man, Robin concludes that only ignorance can explain such apparently self-destructive behavior. Because his tormentor seems unaware of the Major’s high standing (“I know not the man you speak of,” he declares), Robin decides he must be new in town, “some country representative” without knowledge of local personalities and status hierarchies (p. 211). There is irony, clearly, in his assessment of the well-

Nepotism in Hawthorne’s “My Kinsman, Major Molineux”

301

dressed stranger (who even wears silk stockings) as a bumpkin who “lacks … breeding” (p. 211): it is Robin himself who is the rural newcomer and who is basing his behavior upon a profound misunderstanding of local political conditions. Despite further instances of bewildering disappointment, Robin remains supremely reliant upon his connection with the Major. He continues to assume that he will profit from the “kinship” he repeatedly emphasizes. He begins each social exchange in exactly the same manner, asking on six different occasions to be directed to the residence of my kinsman, Major Molineux. Robin’s certainty that the family tie he announces will guarantee him favorable treatment is so powerful that repeated disappointment serves to activate violent impulses in him. His irritable urge to reach for his cudgel (to “smite” an elderly man on the nose or break an innkeeper’s head) helps to illustrate his conviction that the townsmen he meets deserve punishment (cf. p. 211). Their behavior violates established norms, in his view, for they are denying the social implications – and obligations – of nepotism. That is, to refuse courtesy to an important man’s relative is to repudiate the importance of kinship. The unshakeability of Robin’s expectations, even in the face of repeated rebuffs, helps to demonstrate that nepotistic behaviors represent much more than localized social custom; cross-culturally robust, they are rooted in evolutionary biological adaptations. To risk socially and economically damaging retaliation by derogating the relative of a highly placed individual must appear “strange” to Robin, for it defies cost-benefit analysis and contradicts self-interest (cf. p. 215). Meeting a succession of individuals who treat him with unvarnished incivility despite his kinsman’s importance, Robin begins “desperately” to wonder if ordinary reality has been supernaturally suspended: he is “almost ready to believe that a spell was on him” (p. 219). On this “evening of ambiguity,” namely, some of his key ideas about human nature unaccountably fail to function (p. 222). The physical environment effectively mirrors Robin’s psychological disorientation. Arriving in “the little metropolis of a New England colony” at 9:00 o’clock in the evening, he finds himself literally in the dark (p. 210). Quickly he becomes “entangled in a succession of crooked and narrow streets” which “crossed each other” and “meandered” in labyrinthine confusion (p. 211). He is trapped in a place of baffling complexity, tantalizingly close to an objective he never reaches. Local inhabitants refuse him guidance and manifest unexplained antagonism. Unable to conclude his quest, he seems doomed to roam the streets of this “little metropolis” indefinitely, endlessly lost and confused (cf. p. 210). Skillfully Hawthorne utilizes these external features of Robin’s journeying to underscore the youthful protagonist’s feelings of helplessness and frustration, along with his social isolation. He suffers from profound dislocation – geographical, emotional, and intellectual. He does not understand where he is or what is happening; his expe-

302

Judith P. Saunders

rience in the environment he has entered strikes him as abnormal.2 Confronted with an apparent dismantling of principles of nepotism, he has lost his bearings. The climax of the story demonstrates that human nature has not changed; it is Major Molineux’s status, rather, that is undergoing drastic alteration. Robin has been claiming kinship with a ruler about to be deposed, with a man suddenly bereft of power and influence. In the story’s introductory paragraph, the narrator provides readers with a brief history of local resistance to colonial governors (who were, inevitably, appointees of the British Crown), thus preparing readers for the possibility of “a popular insurrection” at any moment (p. 208). Robin’s arrival in town on precisely the night when a coup is planned – that is, on the very night when his relative will be cast out of his high position – is a contrivance in plot readers accept because it has been foreshadowed adequately and supported with historical evidence. The secret plan to overthrow the Major explains at a stroke the negative response Robin’s announcement of their cousinly relationship has provoked all evening long. The ill-natured treatment he has received from the town’s inhabitants makes perfect sense to him once he sees his cousin tortured, humiliated, and expelled. Just as there are benefits to be derived from kinship with prosperous, dominant individuals, kinship with social misfits or outcasts generally incurs costs. An individual’s chances to marry well or to join elite groups can be hindered by family members who manifest signs of physical or mental illhealth, for example, or who experience catastrophic financial reverses, or who violate important cultural norms. Hawthorne comments on the potentially damaging effects of family connections in The Scarlet Letter, when Roger Chillingworth declines to share in the “infamy babbling around [Hester] in the marketplace” (SL, p. 118).3 Explaining Chillingworth’s refusal “to be pilloried beside her on her pedestal of shame,” the novel’s narrator observes that “for her kindred … there remained nothing but the contagion of her dishonor; which would not fail to be distributed in strict accordance and proportion with the intimacy and sacredness of the previous relationship” (SL, p. 118). Young Robin Molineux is similarly aware of the disadvantages his cousinship with the newly disgraced Major poses. He is the relative of a man who has lost all status, a man now wholly unable to assist him in any 2

3

John N. Miller observes that Robin’s “own conceptual ordering of experience” grows increasingly threatened as he finds himself unable to comprehend the behavior of the people he encounters (cf. 53). When his “rationalizing mind” no longer can cope with the interpretive dilemmas confronting him, his perception of his environment begins to assume “dreamlike” and “phantasmagorical” qualities (53). This and the following parenthetical page references (marked SL) are to Nathaniel Hawthorne, The Scarlet Letter, Centenary Edition, vol. 1, ed. by William Charvat et al., Columbus: Ohio State UP, 1962.

Nepotism in Hawthorne’s “My Kinsman, Major Molineux”

303

way. Instead of deference, consequently, Robin may expect to be ignored or taunted – as, in fact, he is. No matter how loyal Major Molineux might feel toward family members, he is at the moment incapable of promoting their welfare or avenging insults to them. Robin’s immediate response to the grisly spectacle of his relative “in tarand-feathery dignity” is to distance himself from the latter’s fate (p. 228). Despite feelings of horrified compassion for the Major (“a mixture of pity and terror”), he is frightened for himself (“Robin’s knees shook”), and he allies himself with “the frenzied merriment” of the persecuting “multitude” (pp. 229f.). Joining with the laughter of the mob, he plainly is deciding not to offer aid to a relative in distress. His earlier, barely controlled inclination to repay rudeness with physical violence does not translate into a willingness to engage in combat with a rioting “mass of people,” nor does he attempt any verbal defense of the Major (cf. p. 228). Thus he is refusing assistance, as readers must notice, to the very person from whom he so recently anticipated receiving substantial benefits. Many readers are troubled by his passive collusion with the degradation of a kinsman.4 It is true that the narrator’s detailed descriptions of the “majestic” victim’s sufferings at the hands of “fiends” seem calculated to evoke empathy for the Major and contempt for his tormentors (cf. p. 230). There is no hope that Robin could rescue the Major single-handedly from an enraged crowd, however, and his selfprotective behavior makes good sense from an evolutionary biological perspective. As a nepotistic strategist, the boy undertakes an immediate (and unconscious) cost-benefit analysis, determining that there are no fitness benefits to be garnered from altruistic action in the present circumstances. All too obviously, the cost of any intervention on his kinsman’s behalf is apt to be extremely high. At the same time, however, and this is a crucial point, Major Molineux himself stands to benefit from his young relative’s seemingly selfish calculations. Just as an elderly, childless man’s plan to invest resources in a promising young relative is predictable according to kin-selection theory, the decision of a young man with his whole reproductive future ahead of him to dissociate himself from an outcast and essentially post-reproductive kinsman is equally predictable. Instead of provoking the volatile crowd’s wrath by a suicidal show of loyalty, Robin serves his own and his cousin’s genetic interests more effectively by preserving his own life and by doing his best to win acceptance from the Major’s enemies – enemies who constitute a clear majority in the immediate social environment. If Robin lives to reproduce, which 4

A large proportion of Hawthorne’s readers condemn Robin’s failure to assist his cousin as a moral fault, sometimes going on to identify it as a fall from innocence. See, for example, the discussions in Gross 1957; Marzec 1987; Pearce 1954; Broes 1964; Waggoner 1979; Gollin 1979; Thorpe 1969; Dennis 1971; Colacurcio 1986; Rodewald and Houston 1996; Fass 1971; Allison 1968.

304

Judith P. Saunders

he is likely to do even without cousinly help, the Major’s inclusive fitness will increase; and this is true even if the Major himself is no longer alive to notice or care. If Robin were to perish in a futile rescue effort, in contrast, his death would reduce the total number of Major Molineux’s genes represented in the next generation. Criticism of Robin’s acquiescence in the humiliation of his cousin loses much of its sting when considered in light of these evolutionary biological facts. Uncoupling nepotistic loyalty from moral principle, Hawthorne’s story demonstrates emphatically that kin-directed altruism is situation-dependent. It shows, too, that the object of individual strategizing is to proliferate copies of genes – and only incidentally to protect the living bodies in which genes temporarily are housed. In this instance, a relative is sacrificed because the cost of helping stands to decrease the fitness of the potential helper. All of Robin’s relatives stand to reap fitness benefits from his apparently disloyal conduct, furthermore, not excepting the sacrificed individual. In addition to exploring the meaning of Robin’s behavior toward his disgraced would-be benefactor, the story’s climax suggests how powerfully the adaptations surrounding nepotism affect social custom and psychological well-being. The discourteous treatment he experiences all evening long serves, as already noted, to challenge Robin’s understanding of familial entitlement. His inability to understand the animus directed toward him contributes in large measure to his discomfort and disorientation. Once he discovers that there is an excellent reason for behavior that earlier seemed inexplicable, he is greatly relieved. Uncomfortable as it is to be the target of second-hand hostility, it is still more disturbing to suspect that human nature itself has undergone some uncanny change. His kinsman’s fall from power reassures Robin that the psychosocial implications of kin selection remain in effect. He begins to recognize in the crowd some of the townspeople who earlier mocked or scolded him, and he finds them laughing now at his “amazement” (p. 229). They are curious to see how he responds to the one-hundred-and-eighty-degree shift in his conception of his kinsman’s social stature. Under their scrutiny, Robin remembers and reinterprets the evening’s adventures, realizing that all along he has been the butt of a terrible joke. The edge of ridicule and malice he felt in so many of his unhelpful encounters was rooted, evidently, in the secret knowledge possessed by his conversation partners: they were in possession of facts which rendered his behavior and his expectations absurd. As “the only person in the story who is not in on the plot,” he has been isolated by his ignorance (Colacurcio 1986, p. 209). Recognizing, after the fact, that his hopes of profiting from his cousin’s status were based on faulty premises, Robin joins in the general laughter at his own expense. His laughter is “the loudest there” because it is purgative: it expresses the enormous relief he feels at the restoration of normalcy in his perception of human motivation (cf. p. 230). The

Nepotism in Hawthorne’s “My Kinsman, Major Molineux”

305

events of the night are vicious and cruel, to be sure, but unlike his earlier adventures in town they do not contradict his understanding of adaptive mechanisms. His relative’s abrupt drop in status forces Robin to confront the dark side of nepotism.5 He began his journey focused optimistically on the benefits to be obtained from kin, but circumstances confront him with potentially problematic, socially costly consequences of genetic ties. He learns how quickly advantageous connections may become liabilities, and how abruptly loyalties – including his own – can rupture (cf. Burnstein 2005, pp. 529f.). In the space of a few hours, his views of kinship and its community context are decisively enlarged and corrected. Although he does not articulate any remorse for his betrayal of a family member, the hellish atmosphere of the climactic scene (complete with fire, fiends, and uproar) indicates his suffering, even as it demonstrates the overwhelming nature of the community forces marshaled against his cousin and, potentially, against Robin himself.6 His hard-won realizations lend emphasis after the fact to his initial naiveté, moreover, demonstrating that his easy confidence in his own powers of penetration was distinctly misplaced.7 He is astute enough to recognize and evade advances from a prostitute, certainly, but not sufficiently discerning to suspect some change in the Major’s status when mention of the latter’s name elicits repeated rebuffs. Politically inexperienced, he appears oblivious to the precariousness of his kinsman’s position in a hierarchy subject to frequent and tumultuous reorganization. Robin fails to consider, initially, that nepotistic altruism functions in a social environment subject to many kinds of alteration, traumatic as well as gradual. Neither family nor community circumstances remain static over time; conditions influencing the wish and the ability to give help to relatives are subject to change. Examples, along with the economic and emotional havoc they wreak, are as common in literary plots as in life itself: people choose and discard partners; they acquire and lose wealth; they win and forfeit status. Alliances shift, and power changes hands. Every such occurrence affects the nature and kind of assistance a specific individual is likely to receive from particular kin. Like the “double-faced fellow” who frightens Robin with his painted visage, nepotism manifests “two complexions” (i.e., costs and benefits) and speaks with “several voices” (i.e., competing interests) (pp. 228, 226). His new recognition of the complex, sometimes trou-

5 6 7

David M. Buss points to “the dark side of families,” discussing “pervasive conflicts over resources” and other sources of diverging interests in kin groups (Buss 2007, p. 246). Readers have noted the resemblance of the story’s climactic scene to hell, or Hades. The analyses in Dennis 1971; Allison 1968; Autrey 1985; Marzec 1987 provide pertinent details. Roger P. Wallins comments ably on the narrator’s role in “mocking . . . Robin’s own view of himself ” (Wallins 1975, p. 175).

306

Judith P. Saunders

bling interaction of nepotistic logic with environmental circumstance signals an important moment of maturation for Robin.8 In the story’s aftermath, its young protagonist is helped to a further insight with the assistance of a townsman who offers him companionship during the final events of the evening. This nameless “gentleman” intervenes when he learns that Robin intends to return immediately to his home (cf. p. 230). As his plan for departure demonstrates, Robin assumes that in the absence of help from a well-to-do and influential relative, there is no chance for him to prosper in this unfamiliar place. His companion then suggests to him that it is possible to “rise in the world” without the help of kin, an idea that appears to be new to the boy (cf. p. 231). Urging Robin to rely on his own efforts, rather than on the generosity of relatives, he implies that in this particular environment family connections are comparatively unimportant. As some readers have observed, the story’s conclusion appears to valorize socioeconomic conditions existing in the American colonies.9 In the mid-eighteenth century, America was the home of countless new and recent immigrants, who generally had left the bulk of their kin behind in Europe. Without access to efficient methods of travel or communication, they were thrown upon their own resources: they survived, in many cases, without much material or emotional support from family. By the same token, they were unlikely to suffer liabilities from the malfeasance or misfortune of relatives living on the other side of the Atlantic Ocean. When a population contains large numbers of individuals isolated from their kinship networks, networks that otherwise would play a significant role in their lives, the result is a social environment in which the effects of nepotism are to some degree diluted. This should be a source of solace to young Robin, as his new companion divines. A boy with no relatives to help him, even a boy connected to a person reviled and outcast, still may hope to thrive in such a place. This last piece of Robin’s initiation into the complexities of intra-familial altruism offers a bit of relief from the painful knowledge earlier forced upon him. An inhabitant of a thinly settled colony, Robin is less dependent upon the wealth and status of his relatives than he would have been elsewhere – in mid-eighteenth-century Europe, for example. Thus the final twist in Hawthorne’s narrative underlines the role played by environment in strategic decision-making: the adaptive logic of kin selection remains stable, but the expression of that logic is, within limits, culturally malleable.

8 9

In addition to readers mentioned in note 4 above, who interpret Robin’s experiences as a rite of passage into a fallen or sinful state, there are some who regard his coming-of-age in a more positive light. Consult discussions by White 2007; Miller 1989; Martin 1983, in particular. Comments in White 2007 and Grayson 1982 are especially relevant to this point.

Nepotism in Hawthorne’s “My Kinsman, Major Molineux”

307

Critical analysis of this much admired and often anthologized short story has by and large neglected the issues of kinship and nepotism its author clearly identifies as central to its workings. The story’s literary and historical sources have been traced; its mythic, archetypal, Freudian, and political implications have been probed. It has been interpreted as an initiation into adulthood, as a fall from innocence, as a rebellion against Oedipal or governmental authority, and as political, historical, sociological, or moral allegory.10 Historical context plays an undoubted role in the story’s setting and plot, and there is almost certainly political comment lurking behind its foregrounded themes. Allusion to a variety of sources undeniably enriches its statement and effect. It is suggestively symbolic in many of its features, and thus it points, potentially, to a multiplicity of auctorial purposes. At bottom, however, it is exactly what its title promises – a story about claiming kinship. It scrutinizes nepotistic strategies, ruthlessly exposing the inclusivefitness logic that drives them, along with the cost-benefit calculations that regulate them. Its youthful protagonist must confront the complex variables influencing kin-directed altruism, including the instability of status hierarchies and the terrors of collective violence. Finally, this disturbing narrative identifies what ultimately is at stake in nepotistic acts: not human beings but shared genes. Coming to grips with these harsh realities proves traumatic, nightmarishly so, for young Robin Molineux. The absence of auctorial judgment, explicit or implied, directed toward this nineteenth-century antihero underscores a confounding but incontrovertible truth: on some occasions, self-serving strategies may promote the evolutionary interest of a kinsman (i.e., continuance of his lineage) more effectively than would altruism.

References Adams, Joseph D., “The Societal Initiation and Hawthorne’s ‘My Kinsman, Major Molineux’,” in: English Studies 1.1 (1976), pp. 1–19. Alkana, Joseph, “Disorderly History in ‘My Kinsman, Major Molineux’,” in: ESQ: A Journal of the American Renaissance 53 (2007), pp. 1–30. Allison, Alexander W., “The Literary Contexts of ‘My Kinsman, Major Molineux’,” in: Nineteenth-Century Fiction 3 (1968), pp. 304–311. 10 Pearce 1954, Shaw 1976, and Grayson 1982 have undertaken detailed research into pertinent historical sources. Numerous other critics have commented on the historical context and political implications of Robin’s experience, among them Broes 1964; Adams 1976; Miller 1989; Alkana 2007; Gollin 1979; Downes 2004; Bellis 1995; Marzec 1987; Russell 1967; Martin 1983; Budick 1993; Colacurcio 1986. Autrey 1985 and Bremer 1981 discuss Robin’s journey in terms of conflict between rural and urban values. Literary sources and allusions have been identified and discussed, most notably in Allison 1968; D’Avanzo 1973; Shields 1998; Shaw 1976. Examples of Freudian analysis of Robin’s experience as a search for a father figure and, sometimes, as rebellion against the father, can be found in Waggoner 1979; Lesser 1955; Crews 1966; Colacurcio 1986; Fass 1971.

308

Judith P. Saunders

Autrey, Max L., “‘My Kinsman, Major Molineux’: Hawthorne’s Allegory of the Urban Movement,” in: College Literature 12.3 (1985), pp. 211–221. Bellis, Peter J., “Representing Dissent: Hawthorne and the Drama of Revolt,” in: ESQ: A Journal of the American Renaissance 41.2 (1995), pp. 97–119. Bremer, Sydney H., “Exploding the Myth of Rural America and Urban Europe: ‘My Kinsman, Major Molineux’ and ‘The Paradise of Bachelors and the Tartarus of Maids’,” in: Studies in Short Fiction 18.1 (1981), pp. 49–57. Broes, Arthur T., “Journey into Moral Darkness: ‘My Kinsman, Major Molineux’ As Allegory,” in: Nineteenth-Century Fiction 19.2 (1964), pp. 171–184. Budick, Emily Miller, “American Literature’s Declaration of Independence: Stanley Cavell, Nathaniel Hawthorne, and the Covenant of Consent,” in: Summoning: Ideas of the Covenant and Interpretive Theory, ed. by Ellen Spolsky, Albany: State University of New York Press, 1993, pp. 211–227. Burnstein, Eugene, “Altruism and Genetic Relatedness,” in: The Handbook of Evolutionary Psychology, ed. by David M. Buss, Hoboken, NJ: Wiley, 2005, pp. 528–551. Buss, David M., The Evolution of Desire: Strategies of Human Mating, revised edition, New York: Basic Books, 2003. –, Evolutionary Psychology: The New Science of the Mind, Boston: Pearson, 2007. Colacurcio, Michael J., “The Matter of America: ‘My Kinsman, Major Molineux’,” in: Nathaniel Hawthorne: Modern Critical Views, ed. by Harold Bloom, New York: Chelsea House, 1986, pp. 197–221. Crews, Frederick C., The Sins of the Fathers, New York: Oxford UP, 1966. Daly, Martin / Margo Wilson, Sex, Evolution, and Behavior, Belmont, California: Wadsworth, 1983. D’Avanzo, Mario L., “The Literary Sources of ‘My Kinsman, Major Molineux’,” in: Studies in Short Fiction 10 (1973), pp. 121–136. Dawkins, Richard, The Selfish Gene, new edition, Oxford, New York: Oxford UP, 1989. Dennis, Carl, “How to Live in Hell: The Bleak Vision of Hawthorne’s ‘My Kinsman, Major Molineux’,” in: University Review 37 (1971), pp. 250–258. Downes, Paul, “Democratic Terror in ‘My Kinsman, Major Molineux’ and ‘The Man of the Crowd’,” in: Poe Studies 37 (2004), pp. 31–35. Fass, Barbara, “Rejection of Paternalism: Hawthorne’s ‘My Kinsman, Major Molineux’ And Ellison’s Invisible Man,” in: College Language Association Journal 14 (1971), pp. 317– 323. Gollin, Rita K., Nathaniel Hawthorne and the Truth of Dreams, Baton Rouge, London: Louisiana State UP, 1979. Grayson, Robert C., “The New England Sources of ‘My Kinsman, Major Molineux’,” in: American Literature: A Journal of Literary History, Criticism, and Bibliography 54.4 (1982), pp. 545–559. Gross, Seymour L., “Hawthorne’s ‘My Kinsman, Major Molineux’: History as Moral Adventure,” in: Nineteenth-Century Fiction 12.2 (1957), pp. 97–109. Hawthorne, Nathaniel, The Scarlet Letter, Centenary Edition, vol. 1, ed. by William Charvat et al., Columbus: Ohio State UP, 1962. –, “My Kinsman, Major Molineux,” in: In The Snow-Image and Uncollected Tales, Centenary Edition, vol. 11, ed. by William Charvat et al., Columbus: Ohio State UP, 1974, pp. 208–231.

Nepotism in Hawthorne’s “My Kinsman, Major Molineux”

309

Lesser, Simon O., “The Image of the Father: A Reading of ‘My Kinsman, Major Molineux’ and “I Want to Know Why’,” in: Partisan Review 22 (1955), pp. 372–390. Martin, Terence, Nathaniel Hawthorne, United States Authors Series, ed. by Lewis Leary, revised edition, Boston: Twayne, 1983. Marzec, Marcia Smith, “‘My Kinsman, Major Molineux’s Theo-Political Allegory,” in: American Transcendental Quarterly 1.4 (1987), pp. 273–289. Miller, John N., “The Pageantry of Revolt in ‘My Kinsman, Major Molineux’,” Studies in American Fiction 17.1 (1989), pp. 51–64. Pearce, Roy Harvey, “Hawthorne and the Sense of the Past or, the Immortality of Major Molineux,” in: ELH 21.4 (1954), pp. 327–349. Rodewald, F. A. / N. B. Houston, “‘My Kinsman, Major Molineux’: A Re-Evaluation,” in: Real: A Journal of the Liberal Arts 21.1 (1996), pp. 40–44. Russell, John, “Allegory and ‘My Kinsman, Major Molineux’,” in: New England Quarterly 40.3 (1967), pp. 432–440. Shaw, Peter, “Fathers, Sons, and the Ambiguities of Revolution in ‘My Kinsman, Major Molineux’,” in: New England Quarterly 49.4 (1976), pp. 559–576. Shields, John C., “Hawthorne’s Kinsman and Vergil’s Aeneid,” in: Classical and Modern Literature: A Quarterly 19.1 (1998), pp. 35–51. Thorpe, Dwayne, “‘My Kinsman, Major Molineux’: The Identity of the Kinsman,” in: Topic 18 (1969), pp. 53–63. Trivers, Robert, Natural Selection and Social Theory: Selected Papers of Robert Trivers, Oxford: Oxford UP, 2002. Waggoner, Hyatt H., The Presence of Hawthorne, Baton Rouge and London: Louisiana State UP, 1979. Wallins, Roger P., “Robin and the Narrator in ‘My Kinsman, Major Molineux’,” Studies in Short Fiction 12 (1975), pp. 173–179. White, Charles Dodd, “Hawthorne’s ‘My Kinsman, Major Molineux’,” in: Explicator 65.4 (2007), pp. 215–217.

310

Wolfram R. Keller

Evolutionary Art Charles Dickens’s Bleak House and the Ovidian Metamorphosis of the Victorian Novel Wolfram R. Keller

What concerns me in this essay is a very specific historical moment in which evolutionary theory and aesthetical theory converge and bring about an important transmutation in the literary system of the Victorian Age. As part of a larger project that studies the metamorphoses of the – somewhat unfashionable – concept of literary career models in English literary history, this essay focuses on the resilience of Roman career models which can be grasped, as a shorthand, as Virgilian (pastoral to epic) versus Ovidian (mock pastoral to counter-epic) cursus, and how the models affect, rather counter-intuitively, Charles Dickens’s Bleak House. The mentioned Virgilian and Ovidian models for (more or less consciously) shaping literary careers have been evidenced in late classical and medieval literatures rather than in English literatures of the sixteenth, seventeenth, and eighteenth centuries (see Hardie 2007). As Philip Hardie observes, however, It is only recently that the contrast between Virgilian and Ovidian forms of narrative and representation has moved to centre stage among classical Latinists. But the contrast is an important and recurrent feature of the pre-nineteenth-century reception of Antiquity, and, correspondingly, of modern studies of that reception. (Hardie 2007, p. 156)1

It seems natural for Hardie to relegate this opposition to the pre-nineteenthcentury reception of Antiquity, especially since the Victorian period is believed to mark a turning point in the reception of the classics – away from Rome (toward Greece), and certainly away from Ovid, who was largely deemed illicit by the Victorians, but who, in my opinion, lives on poetologically. On the Victorian view, Ovid lacked moral respectability. Additionally, there were plenty of other reasons, Norman Vance suggests, why Ovid would have fallen out of fashion: due to the longevity of Romantic ideals, for instance, the Sulmonan poet “was blamed for being derivative; he was identified not only with Byron but with Pope,” who was rather unfashion1

In a different context, Pascal Nicklas stresses the Ovidian “bracket” of classical and modernist literary traditions (Nicklas 2002, esp. p. 16).

Evolutionary Art

311

able in the second half of the nineteenth century; writers also noticed, increasingly, that many Ovidian tales were “immeasurably older than Ovid”. Consequently, it is the “more public poetry of the Aeneid which dominated the nineteenth-century imagination”. And yet, Vance believes, “Time […] did not destroy Ovid in the nineteenth century. It changed him as his Arethusa was changed into a fountain from which wayfarers could drink without always recognizing the source” (Vance 1997, pp. 165, 167, 133, 174).2 Charles Dickens, I believe, is one of these wayfarers, and Ovidian structures feature in a number of related ways throughout his works. What I hope to show in this essay is that in Dickens’s Bleak House (1852–53), the synchronous metamorphoses of two central characters effect an Ovidian metamorphosis on the poetological level, transforming in important ways the genre of the romance/governess novel, which draws heavily on the Ovidian poetics of abandonment and finds its most powerful and popular expression in the mid-nineteenth century in Charlotte Brontë’s “autobiographical” novel Jane Eyre (1847). By means of engaging with evolutionary processes qua metamorphosis in Bleak House, Dickens rewrites Jane Eyre, thereby transforming – poetologically – Jane Eyre’s abandonment and subsequent metamorphosis into a new generic breed,3 a new breed the operative mode of which is based on (the) detection (of origins) rather than symbolic exposure. While Dickens may not necessarily embrace an Ovidian career model per se, Bleak House spotlights and exemplifies the poetological and literary-historical productivity of Ovidian metamorphosis as such. In order to argue these points, I shall first delineate the relationship between Ovidian metamorphosis and evolutionary theory. Second, I will highlight Dickens’s representation of metamorphosis in Bleak House with a view to Mr Krook’s spontaneous combustion, before I finally discuss Dickens’s engagement with metamorphosis vis-à-vis Jane Eyre in Esther Summerson’s narrative, in order to obtain better purview on the generic metamorphosis at stake.

I. It has become a commonplace for students of Victorian culture to emphasize the centrality of scientific discourse in general and evolutionary thought in particular in the second half of the nineteenth century. Ever since the 1830s, Philip Davis observes, “philosophy and theology were being forced out of science’s city” (Davis 2002, p. 57), as science, by the mid-century, had become 2 3

Theodore Ziolkowski, too, observes that in the Victorian period, “Ovid was largely displaced, at least in the public mind, by Virgil”. In phases of political, economical, and religious stability, he remarks, the Virgilian mode flourishes (cf. Ziolkowski 2005, p. 29; Ziolkowski 1993, p. 6). For Charlotte Brontë’s actual and fictional employment of the topos of Ovidian abandonment, see Kauffman 1986, pp. 159–201; for Jane’s “progression” through the Ovidian cursus, culminating in the novel’s counter-Virgilian, counter-imperial stance, see Keller 2010.

312

Wolfram R. Keller

a matter of secularized, professional inquiry. Moreover, literary critics frequently stress the importance of the changing perceptions of nature for the realist novel (cf. Davis 2002, pp. 55–87; Beer 2009).4 Dickens’s Bleak House can, of course, hardly be read as a direct response to Charles Darwin’s On the Origin of Species by Means of Natural Selection; or, The Preservation of Favoured Races in the Struggle for Life, given that Bleak House was published serially between March 1852 and September 1853, six years before Darwin was forced into publishing the Origin in 1859.5 This does not make the novel un-Darwinian, however, since evolutionary theory and evolutionary terminology were everywhere in evidence throughout the century preceding the publication of Darwin’s theory of natural selection; Darwin’s theory differed from its competitors in its advancement of “a design without a designer. Without an intended origin or a teleological end, there need be no shaping intelligence: intelligence itself was evolved from within the system” (Davis 2002, p. 65).6 Evolutionary thought as such “had been aired in scientific circles for at least a hundred years” before the publication of Robert Chambers’s Vestiges of the Natural History of Creation in 1844. For example, Benoît de Maillet’s posthumously published Telliamed ou entretiens d’un philosophe indien avec un missionnaire français, sur la diminution de la Mer, la formation de la Terre, l’origine de l’Homme (1748) articulated the theory “that animal species transmuted into one another – the fish into birds, and so forth” (Wilson 2003, p. 97), a claim that prompted controversy among the theologians and outright ridicule among the philosophers. Voltaire thus “wrote that if such an idea were true, one species changing into another, why, ‘The Metamorphoses of Ovid would be the best textbook of science that had ever been written’” (quoted in Wilson 2003, p. 97).7 The analogy of evolutionary thinking and Ovidian metamorphosis echoes through the late eighteenth and early nineteenth century, but at this point in a rather more serious vein, for instance, in the two volumes of Erasmus Darwin’s The Loves of the Plants, published in 1789 and 1792. Charles Darwin’s grandfather was known for his Zoönomia, or the Laws of Organic Life (1794–96) and earlier influential scientific writings, which had earned him the reputation of a serious scientist and physician – in order not to imperil his standing in the scientific community, The Loves of the Plants was 4 5

6 7

See Armstrong 2005, pp. 99f., about gender relations in this context. In fact, Beer observes that “the organisation of The Origin of Species seems to owe a good deal to the example of one of Darwin’s most frequently read authors, Charles Dickens, with its apparently unruly superfluidity of material gradually and retrospectively revealing itself as order, its superfecundity of instance serving an argument which can reveal itself only through instance and relation” (Beer 2009, p. 6, italics in original). For pre-Darwinian theories of evolution, see esp. Gillespie 1951; Glass 1959. Wilson cites this passage from Gavin de Beer 1869, p. 12. For the presence of evolutionary theory in popular discourse throughout the 1840s, see further Wilson 2003, pp. 98f.; for a twentieth-century, dramatic exploration of the overlap between Ovidian metamorphosis and evolutionary theory, see Spinney 2004, p. 445.

Evolutionary Art

313

published anonymously. The idea behind the two-volume work was to make accessible to a larger, lay readership Carolus Linnaeus’s taxonomy of plants. Darwin’s means of popularizing botany was through the medium of poetry, which evidently proved successful given that The Loves of the Plants quickly became a bestseller in the mid to late 1790s. In the “Proem”, Darwin likens his poetic endeavor explicitly to that of Ovid: Whereas P. OVIDIUS NASO, a great Necromancer in the famous Court of AUGUSTUS CÆSAR, did by art poetic transmute Men, Women, and even Gods and Goddesses, into Trees and Flowers; I have undertaken by similar art to restore some of them to their original animality, after having remained prisoners so long in their respective vegetable mansions; and have here exhibited them before thee. Which thou may’st contemplate as diverse little pictures suspended over the chimney of a Lady’s dressing-room connected only by a slight festoon of ribbons. And which, though thou may’st not be acquainted with the originals, may amuse thee by the beauty of their persons, their grateful attitudes, or the brilliancy of their dress. (Darwin 1791, “Proem”)8

Erasmus Darwin’s poetic demonstration of organic development of plants (and his challenge therein to the received notion of stable types) earned him the reputation of “The English Ovid”,9 and an anonymous reviewer of Charles Darwin’s Variation of Animals and Plants should comment, in 1868, that Seldom has a grandson been more faithful to his literary lineage; and Charles Darwin seems to have spent a large portion of his life in an attempt to illustrate, by scientific observation, what Erasmus Darwin, better than half a century since, illustrated in rich, imaginative, and sonorous, we suppose, in not very readable poetry. (quoted in Nicklas 2002, p. 135, emphasis added)

Another early theorist of evolution, Charles Lyell, also made extensive use of Ovid – especially Book Fifteen of the Metamorphosis – in his Principles of Geology, being an Attempt to Explain the former Changes of the Earth’s Surface, by Reference to Causes now in Operation (1830). The same goes for Robert Chambers, who made much of the concept of metamorphosis in his Vestiges, which heavily emphasized the role of natural processes over the will of a deity. Indeed, metamorphosis, with or without direct reference to Ovid, becomes one of the main tropes in the nineteenth century, marking a striking overlap between natural and poetic processes (cf. Beer 2009, esp. pp. 5, 64; Nicklas 2002, pp. 147–160).10 Moreover, it was notably metamorphosis, rather than natural selection, that incited the most vehement criticism of Darwin’s Origin among 8 9

For The Loves of the Plants, see further Fielitz 2000, pp. 365–368. Anne Seward believes that Erasmus Darwin “is surely not inferior to Ovid; and if poetic taste is not much degenerated, or shall not hereafter degenerate, the Botanic Garden will live as long as the Metamorphoses” (Seward 1804, p. 180). 10 For the acknowledgement of the instability of types in literary and scientific discourse, see Nicklas 2002, p. 135. The merit of Vestiges, Charles Lyell argued, lies in making the “English public familiar with the leading views of Lamarck on transmutation and progression, but [it]

314

Wolfram R. Keller

his contemporaries (see Nicklas 2002, pp. 160–82).11 The principle of metamorphosis, as it emerges in Ovid’s Metamorphoses, his counter-Virgilian epic and one of the most self-conscious musings on the metamorphoses of literary form itself, is thus very much alive in the Victorian period, even though, as intimated above, Ovid’s works as such found little favor with the Victorian literary establishment. It appears that the immediate encounter with the Roman poet is relegated to a deeper, poetological level. As I aim to show in the following, in Dickens’s Bleak House, the evolutionary and poetological dimensions of Ovidian metamorphosis are mutually constitutive, forced together by pressures of a highly competitive literary market.12

II. Just as Charles Darwin appears to have been fascinated by Dickens’s narrative art, Dickens appears to have been interested in the scientific developments of his time. He was certainly familiar with the evolutionary theory of his day, although he did rarely comment on scientific debates directly. One exception is Dickens’s 1848 review of Robert Hunt’s The Poetry of Science; or, Studies of the Physical Phenomena of Nature for the Edinburgh Review, which testifies both to Dickens’s belief in the mutability of species and to his fascination with the concept of metamorphosis. Hunt’s book aimed to popularize scientific inquiry among lay readers, dressing up science as an aesthetic discourse. While Dickens appears to be generally in favor of Hunt’s project, he articulates a slight discomfort about Hunt’s negative slant on Chambers’s Vestiges, which, as mentioned above, took God out of the (evolutionary) equation. While Dickens does not discuss evolutionary theory per se, he still cannot help but observe that Hunt is ultimately indebted to Chambers for creating a reading public for scientific works in the first place (cf. Dickens 1848). This does not say much about Dickens’s take on evolutionary theory, of course. As Shubrought no new facts or original line of argument to support these views” (quoted in Wilson 2003, p. 96). 11 Nicklas, cites, inter alia, a commentator’s explicit comparison of Darwin with Ovid (published in the North British Review for May 1860): compared with Darwin’s metamorphoses, Ovid’s transformations are here judged as “tame” (quoted in Nicklas 2002, p. 179). 12 It is perhaps salient to stress the terminological confusion about metamorphosis/evolution among the Victorians. As Beer remarks, “The blurring of the distinction between ontogeny […] and phylogeny […] in the single term ‘evolution’ proved to be one of the most fruitful disturbances of meaning in the literature of the ensuing hundred years, and is a striking example of the multivalency of evolutionary concepts” (Beer 2009, p. 12). Beer also draws attention to the differences between Ovidian metamorphosis and evolution, the latter entailing extinction, the former ensuring survival beyond death. The concepts both of transformation and metamorphosis, she observes, were “organised in nineteenth-century thinking by that third, crucial, term […]: Development” (Beer 2009, p. 104). For further terminological musings and the relation of metamorphosis to origins, see Nicklas 2002, pp. 11–24.

Evolutionary Art

315

Fang Lai points out, however, the review clearly reveals not only “Dickens’s delight in scientific discovery but also links him to the most controversial scientific issue of the time: evolution” (Lai 2008, pp. 64f.); this is particularly evident in Dickens’s rejection of Hunt’s comment that “the gradual development of animals from the lowest up to the highest orders” is unfounded (Hunt 1848, pp. 366f.).13 Whereas this remains one of the few documented moments in which Dickens immediately addresses evolutionary theory, his (later) novels often do engage with scientific discourse in general and evolutionary theory in particular – and many a Dickensian novel explores mutations and adaptations of various sorts, often from a viewpoint not unlike Jo’s in Bleak House: “There he [Jo] sits, the sun going down, the river running fast, the crowd flowing by him in two streams – everything moving on to some purpose and to one end – until he is stirred up, and told to ‘move on’ too” (p. 291).14 Admittedly, Dickens’s Bleak House refers neither to evolutionary theory nor to Ovidian metamorphosis directly. These related forms of transformation are nevertheless frequently alluded to, I believe, and they play an important part in the novel – and for the novel. First of all, as Lai has observed, there are several allusions to evolution in the novel, as, for example, the opening paragraphs of Bleak House, which imagine biblical Genesis side-byside with Victorian views on the beginning of life on the planet, complete with “a Megalosaurus, forty feet long or so, waddling like an elephantine lizard up Holborn-hill” (p. 11). Moreover, the members of the Smallweed family boast an odd resemblance to monkeys, and they seem to belong to a different age altogether. The narrator’s unraveling of the Smallweed family tree ends with the observation that the “house of Smallweed” has had “no child born to it, and that the complete little men and women whom it has produced, have been observed to bear a likeness to old monkeys with something depressing on their minds” (p. 308). Especially Judy Smallweed “happily exemplifies the before-mentioned family likeness to the monkey tribe”, and “seemed like an animal of another species”. Moreover, she later “appears to 13 Dickens’s fascination with nature’s changeability is evident everywhere in the review, as in the following passage: “there is, in every forest, in every tree, in every leaf, and in every ring on every sturdy trunk, a beautiful and wonderful creation, always changing, always going on, always bearing testimony to the stupendous workings of the Almighty Wisdom […]” (Dickens 1848, p. 131). For Dickens, Lai observes, “science is not just a sidelight or a casual reference […] but an important threshold and resource bearing on the form of fiction, arousing his imagination, and enticing his creation. He transforms scientific allusion into artistic form, while remaining free from any particularly ideological doctrine of science” (Lai 2008, p. 70). 14 This and all following parenthetical page references are to Stephen Gill’s edition (Dickens 1998). As Davis comments vis-à-vis the Dickensian eco-system: “For always in Dickens’s world of far-reaching connections and unexpected mutations, the force of significance must be picked up – ‘now in one shape, now in another’ […] – and taken to heart somewhere by somebody […]” (Davis 2002, p. 314).

316

Wolfram R. Keller

attain a perfectly geological age and to date from the remotest periods” (pp. 309, 313). These, and other passages, certainly show that Dickens was attuned to the evolutionary debates of his time.15 Second, the tacit references to evolution (and Ovid) are complemented by the novel’s focus not only on the various (miraculous) transformations of a rather large number of characters, whose lives and transactions are often rendered in detail, but also by the novel’s emphasis on their origins. And third, on a poetological level, Bleak House explores its own (narrative) metamorphosis – in analogy to the metamorphosis of the first Bleak House into the second Bleak House in the novel – into a different genre, making metamorphosis one of the novel’s key tropes at the interface of Victorian science (evolution) and Ovidian poetics. Bleak House features two narrators and two seemingly unrelated plots that both eventually revolve around questions of origins (of Jarndyce and Jarndyce and Esther Summerson, respectively). The novel opens with a present-tense narrative told by a heterodiegetic narrator, who relates the events regarding the lawsuit of Jarndyce and Jarndyce, which has become legendary for having dragged on for decades without an end in sight – a narrative that showcases how performative speech acts can be employed efficiently in the service of stasis: at court, nothing ever appears to move forward. It is this narrative that frequently alludes directly to Virgil’s Aeneid, especially the underworld scenes in Book 6.16 Intertwined is a homodiegetic narrative, Esther Summerson’s woeful, and yet comparatively dynamic tale: Esther grows up without knowledge of her parents, is supervised first by an unloving aunt and later by an all-too loving, benevolent guardian. Primarily on account of her aunt’s comments regarding her mother – “Your mother, Esther, is your disgrace, and you were hers” (p. 26) – she is characterized by an excessive sense of guilt for damaging the reputation of the mother she never knew; her autodiegetic, retrospective narrative is therefore primarily concerned with the uncovering of her origins – or, more appropriately, with the attempt to un-write these origins. Dickens’s few overt references to Ovid’s Metamorphoses occur in Esther’s narrative.17 15 For this and other references to evolutionary theory/science, see Lai 2008, pp. 68f.; Fielding with Lai 1999; and, more generally, Levine 1986. For the megalosaurus, see Roberts 1993. The novel further wields together Malthus’s theory of population growth, which proved influential for the major proponents of evolutionary theory (Spencer, Darwin, Wallace) and evolution, for instance, in the quixotic views of Harold Skimpole, who notices, with some misgiving, the plethora of children and grandchildren around him (p. 625), and who also comments, somewhat too optimistically, on Chancery victims’ abilities to adapt to the legal system, that is, how “it was very pleasant to see how things lazily adapted themselves to purposes” (pp. 232f., and see 364). For the role of Malthus’s theory in evolutionary theory, see Davis 2002, pp. 59f. 16 For Dickens’s direct references to Virgil’s Aeneid, see Shatto 1988, pp. 99, 153, 181f., 203, 253. Additionally, Tulkinghorn’s chambers represent a kind of Roman Empire en miniature, for which see Leckie 2008. For performative speech acts in the novel, see Miller 2001, pp. 55f. 17 For Dickens’s references to Ovid, see Shatto 1988, pp. 129, 150.

Evolutionary Art

317

The root of the novel’s many discoveries that frequently result in transformations, it is clear from the beginning, is the lawsuit, which has “grimly rived” things “into many shapes,” as the narrator puts it, even if “no man’s nature has been made the better by it” (p. 15).18 The two most consequential metamorphoses occur in both of the narratives, in the middle of the novel (around chapters 31–37), and both transformations are all the more striking for their synchrony. At this point, Esther’s narrative touches upon the portentous illness – the smallpox – which has beset Bleak House and which disfigures Esther’s face. Although it initially seems that she might be spared, the recovery of Esther’s maid, Charley, marks the moment she comes down with the illness as well: “But I was not free from an impression that I had been walking about the two rooms in the night, a little beside myself, though knowing where I was; and I felt confused at times – with a curious sense of fulness, as if I were becoming too large altogether”. In the course of the day, her illness cannot be hidden anymore – even Charley now “saw the secret in my face” (p. 463, emphasis in original). The eventual disfiguration of Esther’s face is bound up with her discovery of her own origins, which she finds out about upon meeting Lady Dedlock in the woods. This physical and psychological transformation of Esther’s being (see below) occurs at the same time that the omniscient narrator reports the miraculous transformation of Mr. Krook, who rules as the “Lord Chancellor” over a rag-and-bottles warehouse, referred to as the Chancery and, therefore, (suspiciously) doubling this veritable legal institution. Mr. Krook metamorphoses into soot; he falls victim, that is, to spontaneous combustion, the sudden burning of a body without an external source of fire or energy. The discovery of Mr. Krook’s strange demise ensues when Mr. Guppy and Tony Jobling (Mr. Weevle) are about to meet Mr. Krook in order to receive documents from the latter that potentially could lead to the discovery of Esther’s secret (parentage). Just before the meeting, the two are astounded by the ubiquitous soot around them: Mr Guppy has been biting his thumb-nail during this dialogue, generally changing the thumb when he has changed the crossed leg. As he is going to do so again, he happens to look at his coat-sleeve. It takes his attention. He stares at it aghast. “Why, Tony, what on earth is going on in this house to-night? Is there a chimney on fire?” “Chimney on fire!” “Ah!” returns Mr Guppy. “See how the soot’s falling. See here, on my arm! See again,

18 “That Sir Leicester becomes a double for Krook (who already is a double for the Lord Chancellor) suggests the novel’s extravagant metamorphoses, all things writhing into the same shape, copies (like what the law-writer himself makes) of the law-writer, as the contaminating language of law seems to spread, reducing the English, who so guard the language spoken in the sun, to illiteracy, to the dumbness of Jo” (Ragussis 1979, p. 270).

318

Wolfram R. Keller

on the table here! Confound the stuff, it won’t blow off – smears like black fat.” (p. 472)

The soot is everywhere around them (pp. 474, 476), and events will take a turn for the worse when Tony Weevle finally goes down to meet Mr. Krook at the appointed time. Tony cannot find Krook, however, and immediately returns to Mr. Guppy: “‘I couldn’t make him hear, and I softly opened the door and looked in. And the burning smell is there – and the soot is there, and the oil is there – and he is not there!’ – Tony ends this with a groan” (p. 476). In a brief suspension of the usual narrative mode, the heterodiegetic narrator seems to focalize the discovery of Krook’s transformation internally, as “we”, the readers, join the two characters: Mr Guppy takes the light. They go down, more dead than alive, and holding one another, push open the door of the back shop. […] They advance slowly, looking at all these things. The cat remains where they found her, still snarling at something on the ground, before the fire and between the two chairs. What is it? Hold up the light? Here is a small burnt patch of flooring; here is the tinder from a little bundle of burnt paper, but not so light as usual, seeming to be steeped in something; and here is – is it the cinder of a small charred and broken log of wood sprinkled with white ashes, or is it coal? O Horror, he IS here! and this, from which we run away, striking out the light and overturning one another into the street, is all that represents him. (p. 479, my italics)

Ironically, Krook has turned into his very element, the soot and dirt that characterize him and his establishment – the soot, which is omnipresent also in the streets of London and the world of the Chancery, as indicated by the depiction of the city at the beginning of the novel: “Smoke lowering down from chimney-pots, making a soft black drizzle, with flakes of soot in it as big as full-grown snow-flakes – gone into mourning, one might imagine, for the death of the sun” (p. 11). Krook’s spontaneous combustion occurs at an important moment – and tests the readers’ credulity. Moreover, the scene has often been seen as eradicating and canceling identities, insofar as the very documents that could lead to a discovery of the secret are located in Krook’s simulacrum of the Chancery, and have presumably turned into soot along with Krook.19 At the same time, an important metamorphosis takes place on the level of narrative: a different mode of discovering origins comes into being. In making “us” complicit in the discovery of Krook’s spontaneous combustion, 19 As Robert L. Patten puts it, “Halfway through the novel, at a climactic moment of recognition [of Krook’s new identity] and reversal, one certainty is named, and all other certainties appear canceled. No more eternal marks, on skin or parchment or paper, of Esther’s identity and relationship; no more manifest connections (apparently) between her and Chancery or Chesney Wold; no more discoveries for Charley or Guppy, who, when he next meets Esther, is quite repelled by her altered face. This spontaneous combustion is but the most fundamental erasure of identity […]” (Patten 2008, p. 97).

Evolutionary Art

319

readers are not only invited to further quest for answers in Esther’s mystery, but also to discern the changes in the narrative technique that enable them to do so, that is, a generic transformation, which is bound up with Krook’s spontaneous combustion. The latter prompted much criticism from contemporary readers, who thought that Dickens had strayed from what is believable, from what is real. This, in turn, compelled Dickens to restore verisimilitude to the novel by adding a (poetologically insightful) preface to the print edition of Bleak House, in which he offers the following explanation: The possibility of what is called Spontaneous Combustion has been denied since the death of Mr Krook; and my good friend MR LEWES (quite mistaken, as he soon found, in supposing the thing to have been abandoned by all authorities) published some ingenious letters to me at the time when that event was chronicled, arguing that Spontaneous Combustion could not possibly be. […] In Bleak House, I have purposely dwelt on the romantic side of familiar things. I believe I have never had so many readers as in this book. May we meet again! (p. 6)

It is precisely the transformation of the familiarity of the romance plot that is at stake in Krook’s transformation into the omnipresent soot20 – and notably, it was the romantic side of familiar things – in the shape of fictional female autobiography – that audiences of the 1840s and 1850s were naturally selecting and that was threatening to outsell even Dickens. In this context, an important metamorphosis in Esther’s narrative comes into view, which occurs simultaneously with Krook’s spontaneous combustion and which reveals the secret that merely seemed to have gone up in flames in Krook’s Chancery.

III. In the 1840s, possibly much to Dickens’s chagrin, women writers were increasingly dominating the British literary scene with autobiographical romances that, as Lisa Jadwin observes, “developed a domestic master narrative featuring an orphaned, impoverished, but genteel heroine who achieves respectability and financial security through hypergamy – by marrying up” (Jadwin 1996, p. 115).21 The most successful of these popular novels was Charlotte Brontë’s Jane Eyre, a book that “may have hit Dickens so hard he claimed never to have read it” (Jadwin 1996, p. 111) – even if Bleak House obviously boasts so many parallels to Brontë’s “autobiographical” novel.22 20 For Childers, the preface is representative of the state of affairs in the novelistic traditions of the mid-nineteenth century: realism is on the rise, but the romantic side, the legacy of writers like Walter Scott and the Waverley-tradition still “demanded attention” (Childers 2002, p. 407). 21 Hypergamy apparently was an anathema to Dickens, who praised Eilot’s Adam Bede and Gaskell’s Mary Barton, in which the “servants’ attempts to ‘marry up’ end in disaster” (Jadwin 1996, p. 115). 22 For parallels between Jane Eyre and Bleak House, see Jadwin 1996; Newsom 2001, p. 99, drawing attention also to the parallels between Jane Eyre and David Copperfield. Likewise, scholars

320

Wolfram R. Keller

The correspondences between Bleak House and Jane Eyre are quickly summarized: both heroines conflate their “autobiographical” romance with a gothic mystery-plot centering on her secret relation to a “fallen woman,” both novels begin with an ill-treated orphan, punitive aunts, girl schools, etc., both receive marriage proposals from patriarchal benefactors, suffer from existential isolation etc., attraction to a younger suitor, ending on the blissful marriage of the original suitor. (Jadwin 1996, p. 112)

Jadwin further believes that Dickens decided to rewrite Jane Eyre, because Brontë’s fictive autobiography so closely described his own childhood experiences, which he, in fact, was just beginning to chronicle at the time Jane Eyre was published. Very likely, Dickens would have been upset that it was a woman writer who beat him at what should have been his game – and a woman writer openly advocating hypergamy to boot (see Jadwin 1996, p. 112).23 Dickens’s Bleak House is more than a retelling of Brontë’s novel, however. On the one hand, Dickens re-tells Jane Eyre not once, but twice. On the other hand, Dickens engages with the poetological dimension of Jane Eyre and transforms the literary tradition informing Brontë’s novel, namely, that of female abandonment – a tradition which, Lawrence Lipking argues, ultimately goes back to Ovid’s Heroides (cf. Lipking 1988, esp. pp. 32–56, 91–96, 136– 144). In going beyond Esther’s abandonment, Dickens, like Brontë, transcends the tradition of female abandonment, but, in contrast to Brontë, Dickens inquires further into what happens after the transformation, which is relayed at the end of Jane Eyre. Brontë’s Jane Eyre is an abandoned woman who angrily exposes the evil-doings of her various tormentors – her aunt, John Reed, her school master, her first prospective husband, who turns out to be married to the madwoman in the attic, and her second potential husband, St. John Rivers. Jane does so in an angry and longish fictional “letter” sent back to the frequently addressed “dear reader”. In contrast to the majority of classical abandoned women, who lament their plights in the letters included in the Heroides and who usually commit suicide soon after, Jane manages to transcend her abandonment. In a passage that alludes to Medusa’s metamorphosis, her status as a dependent woman is suddenly transformed, as she comes into money, which enables her to marry the now crippled Rochester and to live happily ever after, albeit exiled in the English backwoods of rural have highlighted the likeness (and the possible, mutual influence) of Brontë’s Villette and Bleak House (see Blackall 1977; Newsom 1991). 23 After speculating on reasons why Dickens might have kept secret his reading of Jane Eyre – similar childhood experiences may have led to a questioning of male hegemony, the “feminized nature of his early experience” as enabling of creativity – Jadwin concludes that the novel “substitutes feminine submissiveness for proto-feminist rebellion at a variety of levels”. Esther, in her view, is “his most notorious aesthetic failure”, while the novel itself “links the psychological genesis of fiction to the experience as well as the rise of the woman writer” (Jadwin 1996, p. 113).

Evolutionary Art

321

Yorkshire.24 In Jane Eyre, the metamorphosis that brings Jane happiness occurs towards the end of the novel and remains unexplored: readers merely obtain a glimpse of the couple’s domestic bliss. Dickens, by contrast, retells Jane Eyre in the first part of Bleak House, keeping to the established pattern of the autobiographical romance, whereby it is crucial to note that Esther is Dickens’s only female narrator and that the transformation occurs already in the middle of the novel. A noticeable difference between Jane and Esther might lie in their respective anger management insofar as Esther attempts to suppress the anger that is so characteristic of her literary historical ancestors (and of Jane Eyre). The fact that Esther’s (unreliable) narrative might not seem to be particularly angry, though, does not mean that it is not. After all, as Robert Newsom observes in his comparison of Esther and Lucy Snowe (in Brontë’s Villette), “Lucy is much less cool than she sometimes supposes, and Esther is much keener and less deferential than she indicates – that is a main reason she irritates readers, after all” (Newsom 1991, p. 70, and see n. 17). The aggression of the abandoned woman is so well established, perhaps, that readers would sense it automatically underneath the trauma, which, in Bleak House, is articulated early on. At the occasion of her birthday, Esther learns – in a chapter entitled “A Progress” – that her mother is her disgrace (see above), whereupon Dickens’s heroine retreats into her bedroom, crying herself to sleep in the belief that “I had brought no joy to anybody’s heart, and that I was to no one upon earth what Dolly was to me”. In her abandonment, she vouches to “try, as hard as ever I could, to repair the fault I had been born with […] and would strive as I grew up to be industrious, contented and kind-hearted […]” (p. 27). Her metamorphosis towards the middle of the novel suitably makes her internalized shame legible on her disfigured face. Esther’s physical metamorphosis, her disfiguration, also represents a psychological process of reconfiguration: “At once a child, an elder girl, and the little woman I had been so happy as, I was not only oppressed by cares and difficulties adapted to each station, but by the great perplexity of endlessly trying to reconcile them” (p. 513). This process of self-reconciliation ensues at great length here. While Esther hopes that she can quickly adapt to the new situation – she says to Charley that she hopes “she can do without my old face very well” (p. 516) – Esther eventually feels forced to send away her best friend in order “to be a little more used to my altered self ” (p. 519). At this point, as a first effect of her physical alteration, she relates her romantic infatuation with Mr. Woodcourt, which was hinted at, but never made explicit up to this point. Now, she admits that she has been in 24 For Brontë’s Ovidian rhetoric, see Kauffman 1986, pp. 159–201; for Jane’s transcendence of abandonment and her eventual (exilic) happiness, see Keller 2010.

322

Wolfram R. Keller

love with Mr. Woodcourt the entire time, and felt abandoned when the latter searched his luck in the colonies: And now I must part with the little secret I have thus far tried to keep. I had thought, sometimes, that Mr Woodcourt loved me; and that if he had been richer, he would perhaps have told me that he loved me, before he went away. I had thought, sometimes, that if he had done so, I should have been glad of it. But, how much the better it was now, that this had never happened! What should I have, if I had to write to him, and tell him that the poor face he had known as mine was quite gone from me, and that I had freely released him from his bondage to one whom he had never seen. (p. 526)

This admission is followed by further musings on her physical alteration as she finally faces herself in the mirror: “I was very much changed – O very, very much. At first, my face was so strange to me, that I think I should have put my hands before it and started back, but for the encouragement I have mentioned. Very soon it became more familiar, and then I knew the extent of my alteration in it better than I had done at first” (p. 528). This second scene revolving around her disfigured face is directly followed by the revelation of yet another secret – the secret that should have been – but could not be – uncovered in the heterodiegetic narrative: Esther’s origins. Chancing upon Lady Dedlock in “The Wood”, Esther learns that she is Lady Dedlock’s illegitimate child and that Lady Dedlock, now married to the unsuspecting, pompous Sir Leicester Dedlock, had only recently found out that Esther was, in fact, alive. Moreover, Lady Dedlock details her own story of abandonment. Seeing her mother kneeling in front of her, Esther “felt, through all my tumult of emotion, a burst of gratitude to the providence of God that I was so changed as that I never could disgrace her by any trace of likeness” (p. 535). Once again, the physical disfigurement is reinterpreted as advantageous, as masking Esther’s emotions and her origins, respectively. Lady Dedlock gives Esther a letter that yields further information regarding Esther’s birth, and she “derived from it – and that was much then – that I had not been abandoned by my mother” (p. 539). As so often in Victorian novels, however, Esther’s gain predicates her mother’s loss: If within a single lifetime a major character moves from an old dispensation to a new, there is often someone else in the novel who remains left behind: so it is in the double structure of Dickens’s Bleak House […] with Esther Summerson […] and her secret mother, Lady Dedlock … (Davis 2002, p. 126)25

Esther’s physical and psychological metamorphosis ultimately strengthens her in her initial resolve to be a positive force in the world: I had had experience, in the shock of that very day, that I could, even thus soon, find comforting reconcilements to the change that had fallen on me. I renewed my resolutions and prayed to be strengthened in them, pouring out my heart for myself and 25 For the pathologizing of Lady Dedlock, see Armstrong 2005, pp. 80f.

Evolutionary Art

323

for my unhappy mother and feeling that the darkness of the morning was passing away. (p. 543)26

Esther, like Jane, is thus able to transcend her abandonment – a process that finds an analogue on the level of narration, as the familiarity of the romance plot, qua Krook’s and Esther’s metamorphoses, disfigures the novel itself, which evolves into a new generic breed, marking an advantageous mutation for the literary market (and literary history itself). The second half of the novel is no less concerned with the search for origins and the evolution of characters, but the mode of discovery is now that of detection,27 as Dickens’s Bleak House becomes the “first”, and possibly “the most perfectly constructed” English detective novel. The detective, Inspector Bucket, since he enters both narrative strands, becomes “the principal unifying force” of the novel, argues Ronald Thomas, since he brings together the juxtaposed accounts “of fundamental legal corruption” and “sentimental autobiography” (Thomas 2001, pp. 176f.) – a change that has been anticipated, poetologically, by means of the metamorphoses discussed above. Dickens’s dramatic metamorphosis of his novel’s genre, which establishes a different mode of detecting origins, ensues at the nexus of contemporary evolutionary theory and Ovidian abandonment and metamorphosis, and is possibly forced into being by the generic predilections of a romancehungry literary market. Furthermore, the metamorphoses of Bleak House and Bleak House mark, I believe, a decisive transmutation en route to the modern novel. And as such, Dickens’s sprawling Bleak House demonstrates a continuous engagement with Ovidian and Virgilian models; particularly, it evinces the ongoing poetological relevance of Ovid, whose influence, as mentioned above, is generally seen as declining throughout the nineteenth century, to become tangible again only with the Moderns. While the jury may still be out on whether Esther Summerson ultimately re-inscribes patriarchal structures or represents a nascent form of écriture féminine,28 it appears 26 “First, at one time of your life, you make a resolution in response to a disastrous discovery about yourself. That resolution determines the whole course of your life. Years later, in response to a new discovery that changes your entire sense of self once more, you ‘renew’ that first resolution in the changed circumstances, still speaking silently to yourself ” (Miller 2001, p. 37). 27 “The ‘whodunit’ is the poor, or less prestigious, stepsister of a scientific treatise like the Origin of Species, and Darwin’s injunction that we ‘possess no pedigrees or armorial bearings’, and ‘we have to discover and trace the many diverging lines of descent in our natural genealogies, conforms to what the detective novel, in its characteristically displaced form, does” (BoheemenSaaf 1998, pp. 60f.). For her, it is the discovery of Lady Dedlock in Tom-all-Alone’s that represents “unique insight into the generic transformation from (family) romance into detective novel” (ibid.). 28 See esp. Felber: “Dramatizing the challenges of reading a gendered discourse and the risks of French feminism, Bleak House can be read in support of traditional limiting roles for women – a ‘Victorian’ reading – at the same time the texts writes the female body and desires. A text

324

Wolfram R. Keller

that literary modernism might owe much to the dis-figurative poetics she represents.

References Armstrong, Nancy, How Novels Think: The Limits of British Individualism from 1719–1900, New York: Columbia UP, 2005. Beer, Gavin de, “Introduction,” in: Vestiges of Creation, ed. by Robert Chambers, reprint of first ed., Leicester: Leicester UP, 1969, pp. 1–28. Beer, Gillian, Darwin’s Plots: Evolutionary Narrative in Darwin, George Eliot and NineteenthCentury Fiction, Cambridge: Cambridge UP, 32009. Blackall, Jean Frantz, “A Suggestive Book for Charlotte Brontë,” in: Journal of English and Germanic Philology 76 (1977), pp. 363–383. Boheemen-Saaf, Christine van, “The universe makes an indifferent parent: Bleak House and the Victorian Family Romance,” in: Interpreting Lacan, ed. by Joseph H. Smith and William Kerrigan, New Haven, CT: Yale UP, 1983. Rpt. in: Charles Dickens, Bleak House, ed. by Jeremy Tambling, Basingstoke: Macmillan; New York: St. Martin’s Press, 1998, pp. 54–64. Chambers, Robert, Vestiges of the Natural History of Creation, London, 1844. Childers, Joseph W., “Victorian Theories of the Novel,” in: A Companion to the Victorian Novel, ed. by Patrick Brantlinger and William B. Thesing, Malden, MA: Blackwell, 2002, pp. 406–423. Darwin, Charles, On the Origin of Species by Means of Natural Selection; or, The Preservation of Favoured Races in the Struggle for Life, London: Murray, 1859. Darwin, Erasmus, The Botanic Garden; or, The Loves of the Plants, London: J. Johnson, 1791. Davis, Philip, The Victorians, Oxford: Oxford UP, 2002. Dickens, Charles, Bleak House, ed. by Stephen Gill, Oxford: Oxford UP, 1998. –, “Rev. of ‘The Poetry of Science’, by Robert Hunt,” in: Examiner, 9 December 1848. Rpt. in: The Dent Uniform Edition of Dickens’ Journalism, ed. by Michael Slater, London: Dent, 1994–2000, pp. 129–134. Felber, Lynette, “‘Delightfully Irregular’: Esther’s Nascent écriture féminine in Bleak House,” in: Victorian Newsletter 85 (1994), pp. 13–20. Fielding, K. J. with Shu-Fang Lai, “Dickens’s Science, Evolution and ‘The Death of the Sun’,” in: Dickens, Europe and the New Worlds, ed. by Anny Sadrin, Houndmills: Macmillan; New York: St. Martin’s Press, 1999, pp. 200–211. Fielitz, Sonja, ‘Wit, Passion and Tenderness’. Ovids ‘Metamorphosen’ im Wandel der Diskurse in England zwischen 1660–1800, Frankfurt/M.: Lang, 2000. Gillespie, Charles, Genesis and Geology: The Impact of Scientific Discoveries upon Religious Beliefs in the Decades before Darwin, Cambridge, MA: Harvard UP, 1951. Glass, Bentley / Owsei Temkin / William Straus (eds.), Forerunners of Darwin 1745– 1859, Baltimore, MD: Johns Hopkins UP, 1959. which examines a feminist problem and inscribes the feminine, Bleak House valorizes the feminine and demonstrates a strategy to destabilize male hierarchy” (Felber 1994, p. 19).

Evolutionary Art

325

Hardie, Philip, “Contrasts,” in: Classical Constructions: Papers in Memory of Don Fowler, Classicist and Epicurean, ed. by S. J. Heyworth, Oxford: Oxford UP, 2007, pp. 141–173. Hunt, Robert, The Poetry of Science; or, Studies of the Physical Phenomena of Nature. London: Reeve, Benham & Reeve, 1848. Jadwin, Lisa, “‘Caricatured, not faithfully rendered’: Bleak House as a Revision of Jane Eyre,” in: Modern Language Studies 26.2–3 (1996), pp. 111–133. Kauffman, Linda S., Discourses of Desire: Gender, Genre, and Epistolary Fictions, Ithaca, NY: Cornell UP, 1986. Keller, Wolfram R., “Exiled at Home: Ovidian Abandonment and Charlotte Brontë’s Jane Eyre,” in: “What Countrey’s This? And Whither Are We Gone?” Papers Presented at the Twelfth International Conference of Region and Nation, ed. by J. Derrick McClure, Karoline Szatek-Tudor, and Rosa E. Penna, Newcastle upon Tyne: Cambridge Scholars, 2010, pp. 196–217. Lai, Shu-Fang, “Bleak House and Victorian Science,” in: Approaches to Teaching Dickens’s ‘Bleak House’, ed. by John O. Jordan and Gordon Bigelow, New York: Modern Language Association of America, 2008, pp. 64–70. Lipking, Lawrence, Abandoned Women and Poetic Tradition, Chicago: University of Chicago Press, 1988. Leckie, Barbara, “Mr. Tulkinghorn’s Chambers,” in: Approaches to Teaching Dickens’s ‘Bleak House’, ed. by John O. Jordan and Gordon Bigelow, New York: Modern Language Association of America, 2008, pp. 85–91. Levine, George, “Dickens, Darwin, Science, and Narrative Form,” in: Texas Studies in Literature and Language 28.3 (1986), pp. 250–280. Maillet, Benoît de, Telliamed ou entretiens d’un philosophe indien avec un missionnaire français, sur la diminution de la Mer, la formation de la Terre, l’origine de l’Homme, Amsterdam: L’Honoré & Fils, 1748. Miller, J. Hillis, “Moments of Decision in Bleak House,” in: The Cambridge Companion to Charles Dickens, ed. by John O. Jordan, Cambridge: Cambridge UP, 2001, pp. 49–63. Newsom, Robert, “Vilette and Bleak House: Authorizing Women,” in: Nineteenth-Century Fiction 46.1 (1991), pp. 54–81. –, “Fictions of Childhood,” in: The Cambridge Companion to Charles Dickens, ed. by John O. Jordan, Cambridge: Cambridge UP, 2001, pp. 92–105. Nicklas, Pascal, Die Beständigkeit des Wandels: Metamorphosen in Literatur und Wissenschaft, Hildesheim: Olms, 2002. Patten, Robert L., “Plot and the Plot of Bleak House,” in: Approaches to Teaching Dickens’s ‘Bleak House’, ed. by John O. Jordan and Gordon Bigelow, New York: Modern Language Association of America, 2008, pp. 92–98. Ragussis, Michael, “The Ghostly Signs of Bleak House,” in: Nineteenth-Century Fiction 34.3 (1979), pp. 253–280. Roberts, Adam, “Dickens’s Megalosaurus,” in: Notes & Queries 40.4 (1993), pp. 478f. Seward, Anne, Memoirs of the Life of Dr. Darwin, London: Johnson, 1804. Shatto, Susan, The Companion to ‘Bleak House’, London: Unwin Hyman, 1988. Spinney, Laura, “A Stage of Evolution,” in: Nature, 25 November 2004, p. 445. Thomas, Ronald R., “Detection in the Victorian Novel,” in: The Cambridge Companion to the Victorian Novel, ed. by Deirdre David, Cambridge: Cambridge UP, 2001, pp. 169– 191.

326

Wolfram R. Keller

Vance, Norman, The Victorians and Ancient Rome, Oxford: Blackwell, 1997. Wilson, A. N., The Victorians, London: Arrow, 2003. Ziolkowski, Theodore, Virgil and the Moderns, Princeton, NJ: Princeton UP, 1993. –, Ovid and the Moderns, Ithaca, NY: Cornell UP, 2005.

Liebestod Revisited

327

Liebestod Revisited Wasted Reproductivity in Wagner’s Operas1 Brett Cooke

At the end of Tristan und Isolde, the heroine expires with the last note of her Liebestod. As with Elsa in Lohengrin and Elisabeth in Tannhäuser, Isolde’s death is readily deconstructed: after all, she dies for no discernible medical reason!2 John DiGaetani acknowledges that these strange deaths “remain recurrent problems in Wagnerian opera” (DiGaetani 2003, p. 49). The notion that Isolde dies of a broken heart he finds “laughably melodramatic and unrealistic” (p. 90). Indeed, some productions have her merely collapse, not expire, over Tristan’s body, but these are in the minority. Somehow, despite such evident flaws, Richard Wagner’s (1813–1883) operas gain repeated attention. Although Catherine Clement denounces Isolde’s death as “easy” and “rotten,” this scene is for many viewers instead the acme of Wagner’s achievement (Clement 1988, pp. 53 and 58). If “disbelief ” is “suspended” when the curtain is raised, what cognitive protocols replace it with the bias necessary for narrative logic? Opera very likely increases the “suspension” effect. Wagner’s music places us firmly into right hemisphere cognition, whereupon strange events become not only plausible but immensely moving. Can biopoetics help explain what happens next? Notably, when objective logic is suspended, what follows is not random chaos, but instead a behavioral pattern that indicates underlying biases likely shaped by our ancestral history. As the peaks of nineteenth-century European musical culture, if not all artistic culture itself for that era, Wagner’s operas probably inform us little about the distant origins of art. But they clearly support our case that the arts are the product of natural selection. Close study of his ten mature operas after Rienzi, all central to the operatic canon, reveals thematic structures that are irrational, indeed hysterically so, in their asymmetrical treatment of male and female characters, yet central to their dramas and crucial to the indubitable aesthetic success of these works. That artistic power, not 1 2

I am grateful to Mathias Clasen for his helpful comments. It is interesting to note that Wagner’s first attempt at writing an opera, Die Hochzeit, apparently included yet another case of “Liebestod.” According to sketchy accounts of the opera, Ada dies at the grave of her lover, whom she accidentally killed.

328

Brett Cooke

critical derision, is generated by Wagner’s distorted rendition of women invites consideration whether this derives from underlying biological functions that accord with principles identified by evolutionary science. In this case, his operas reflect a bias that accords with Bateman’s Principle, though that could hardly have been his conscious intent. For example, the three women who die mysteriously in Wagner’s operas are young and attractive, none of them mothers, but all ready to begin their childbearing years. Indeed, all have a life partner in hand to support them in that effort.3 Furthermore, all expire at the very end of their operas, a point of obvious dramatic consequence. It should also be noted that audiences often know in advance that this will happen, thanks to their familiar mythical sources and premonitions in the music, let alone the common inclusion of synopses in programs. Given the limitation of the operatic repertory in which Wagner’s works enjoy supreme prestige, we undergo this experience again and again. In the case of Wagner it cannot be argued that the music somehow makes up for imperfections in the libretti. Almost uniquely amongst opera composers, Wagner wrote his own texts. His drafts show that words usually preceded the music. According to Patrick Smith, “the function of the music was to further illumine the words” (Smith 1975, p. 261); “the librettist guides the musician at every step” (p. 259). Moreover, his writing enjoys respect second possibly only to that of Lorenzo da Ponte, who provided the texts for Mozart’s Le Nozze di Figaro, Don Giovanni, and Così fan tutte. In Smith’s opinion, “The development of Wagner’s mature librettos […] represents a progress comparable to the strictly literary progress of writers such as Tolstoy, Goethe, and Ibsen […] Die Meistersinger […] can lay strong claim to being the greatest libretto ever written” (p. 260). Wagner’s libretti are of clear aesthetic significance and thus eligible for close biopoetic scrutiny. Smith concludes, “never has another body of librettistic work been subjected to such close scrutiny and yielded such rich rewards,” and “Richard Wagner, as librettist, is the greatest the form has produced” (pp. 273 and 287). The core hypothesis for all of my work is that aesthetic interest is elicited by behaviors closely related to inclusive fitness. If our minds are shaped by natural selection to respond to particular environmental cues, then the objects of our attention should be of adaptive importance, espe3

Tannhäuser is the single male who also dies mysteriously in Wagner’s operas. His death seems to be the result of Elisabeth’s sacrifice, much as Senta’s suicide at the end of Der fliegende Holländer triggers the sinking of the Dutchman’s ship. Meanwhile, there are other women who die strangely in Wagner. Another mystical death like Tannhäuser’s is that of Kundry, who is about a millennium old. She dies at the end of Parsifal, as she has long wished it, when she is finally given absolution. On the other hand, the evil Ortrud falls lifeless at the end of Lohengrin when the Swan Knight undoes the spell she spun over Godfrey.

Liebestod Revisited

329

cially when they are able to attract notice on a repeated basis. A related consideration involves the standardization of behavior noted by Brian Boyd and others. We construct expectations as to how people typically pursue inclusive fitness and we quickly calculate, often in a subconscious manner, the degree by which they deviate from those standards. As Boyd recently deduced, this standard is what makes stories possible (cf. Boyd 2009, p. 28). It then follows that our attention is attracted by marked exceptions to this internalized benchmark. One illustration is our sensitivity to any possibility of incest. Incest avoidance is often cited as a human universal, one that is egregiously violated by Siegmund and Sieglinde in Die Walküre, who are not only full siblings but also twins. There are also lesser cases elsewhere: Brünnhilde is Siegfried’s blood half-aunt in Siegfried, and Isolde is Tristan’s affinial aunt in Tristan und Isolde. But sometimes just a slight hint will create an adversive reaction. Hermann in Tannhäuser is a bit too doting an uncle to Elisabeth, Elsa is suspiciously attached to her brother Gottfried in Lohengrin, while both Tristan and Parsifal are fixated on their dead mothers. These slight hints were sufficient for audiences and critics like Eduard Hanslick to smell a rat. For example, James McGlathery notes how fathers like Daland in Der fliegende Holländer and Viet Pogner in Die Meistersinger von Nürnberg direct their daughters towards men like themselves (McGlathery 1998, pp. 22ff.). Such critics were right to be suspicious, for Wagner has a strong tendency to depict incestuous relationships in his highly repetitive operas. Of course, another interest-attracting deviation from behavior normally seen to be viable happens when healthy women die of … Liebestod. Wagner’s operas evince a number of repetition syndromes. Virtually the same story is told repeatedly, with minor variations, but always attracting unflagging interest. Some themes show up again and again, such as the motif of a woman redeeming a man through her sacrifice. Meanwhile, other possible concerns like disease, hunger, or normal work are wholly or nearly completely absent on Wagner’s stage. Such skewed allocation of our attention to certain issues, especially those pertaining to evolutionary tenets, and not to others, is a likely symptom of the influence of ancient environments via natural selection. Now that modern society has effective contraceptives and fertility clinics, female reproductivity is much more negotiable. But it remains one of the central concerns of narrative, especially musical theater which depends on such highly emotional issues to provide sufficient impetus for singing.4 Wagner’s operas have been subjected to intense study regarding the composer’s motives. The strange and repetitive behavior of his characters has been scanned as evidence of Wagner’s presumed androgyny, transvestitism, latent homosexuality, bipolarism, and mere neuroticism, as well as ex4

See my recent study of biological themes in the core opera repertoire, Cooke 2010.

330

Brett Cooke

pressions of his interest in Schopenhauer and other important cultural influences (cf. DiGaetani 2003, p. 3). As we shall see, this recurrent philanderer was repulsed by modern sensuality and sexual excess, apparently including his own, and often prudishly idealized purity, if not also celibacy (cf. Millington 1998, p. 171). But for a work of art the point of selection lies with what the public will accept. Since few of these possible influences are shared by most people, we will ignore them. Our question rather is: Why are Wagner’s mature operas received as masterpieces by widespread audiences? Could it be because we all share the same panhuman biases? Come to think of it, evolutionary psychology is a science of our biases. It studies the cognitive shortcuts inured in us by ancestral history. Per the adapted brain hypothesis, we have specialized functions which accelerate and regularize our reactions to environmental changes. These functions, along with our differential allocation of attention, would seem to accord with threats and opportunities once frequent or pressing in ancient environments. Furthermore, they color our value systems and give meaning to the things we encounter. Thus Darwinist tenets may help us understand common artistic phenomena, in this case the unusual treatment of female reproductive capital in Wagner’s masterworks. Wagner’s handling of female characters appears to constitute an extreme expression of Bateman’s Principle. In 1948 the British geneticist A. J. Bateman observed much greater variance in reproduction in fruit flies amongst males than females. Since, as he theorized, females have much less than males to gain from having multiple sexual partners, he deduced that the gender with the more limited reproductive potential will more likely be the object of competition by the other. Thus in most species, including our own, males will contend, even fight, over reproductively promising females, while the reverse relationship is relatively rare. There are some exceptions where males constitute a reproductive bottleneck, usually in those species where they provide most parental care, mostly birds and seahorses. This pattern so underlies our expectations that we take it for granted. Male sexual competition appears in innumerable dramas and operas. Out of the 99 most popular operas,5 two or more men compete for a woman in 55: Andre Chenier, Arabella, Un Ballo in maschera, The Barber of Seville, Bartered Bride, Carmen, Cavalleria rusticana, Così fan tutte, Daughter of the Regiment, Don Carlos, Don Giovanni, Don Pasquale, Elektra, L’elisir d’amore, Die Entführung aus dem Serail, Eugene Onegin, Falstaff, Fiery Angel, Der fliegende Holländer, La Forza del Destino, Der Freischütz, Giulio Cesare, Götterdämmerung, L’incoronazione di Poppea, Jenufa, Katya Kabanova, Lady Macbeth of the Mtsensk District, Lucia di Lammermoor, Die lustigen Weiber von Windsor, The Makrapoulos Case, Manon, Manon Lescaut, Die Meistersinger von Nürnberg, Le Nozze di Figaro, I Pagliacci, Pearl Fishers, Pelleas et Melisande, Porgy and Bess, Rigoletto, Romeo et Juliette, Der Rosenkavalier, Rusalka, Ruslan and Liudmila, Siegfried, Simon Boccanegra, Tales of Hoffmann, Il Tab5

See my study for how this core repertory is defined: Cooke 2010.

Liebestod Revisited

331

arro, Tannhäuser, Tosca, Tristan und Isolde, Il Trovatore, Turandot, Die Walküre, Werther, Wozzeck.

In many cases, this conflict is not between sexual rivals, but between a wouldbe lover and a male relative of his beloved. Two or more women compete as sexual rivals over a man in only 12 of these operas: Adriana Lecouvreur, Aida, Cenerentola, La clemenza di Tito, Così fan tutte, Idomeneo, L’incoronazione di Poppea, Il matrimonio segreto, Médée, Nabucco, Norma, The Rake’s Progress. (Cooke 2010, p. 79)

This topos certainly appears in Wagner. In Die Walküre Siegmund and Hunding fight over Sieglinde. In Lohengrin the title character crosses swords with Telramund over Elsa, albeit not as a romantic interest for the latter. Does the heroine have no choice of her own or will the issue come down to might makes right? Other examples of intrasexual selection in Wagner are less violent. In Die Meistersinger von Nürnberg David attacks Sixtus Beckmesser for wooing Magdalena. This happens accidentally, since Beckmesser mistakes Magdalena for Eva, arousing David’s fury. Beckmesser, for his part, fully knows what he is doing when he does his best to keep Walter von Stolzing from competing for the hand of Eva. The poverty-stricken Eric poses a meek challenge for the gloomy, but rich Dutchman in Der fliegende Holländer, while Wolfram provides only chaste competition for the passionate Tannhäuser in Wagner’s other singing contest. The reverse case, where women contend over a man, is rare in opera and non-existent in Wagner. Audiences typically tolerate great asymmetries in the depiction of gender. I suggest this supports Bateman’s Principle. Since potential female reproductivity is quite limited, as compared to the vast potential of men, it bears distinct value. Women are often treated as transferable property. In Der fliegende Holländer Daland trades his daughter Senta for the Dutchman’s treasure. In Götterdämmerung Siegfried trades Brünnhilde to Gunther in exchange for the latter’s sister, Gutrune. Tristan abducts Isolde as a present for his uncle, King Mark. Clearly some resist. These forced marriages move Isolde to drink poison and Brünnhilde to plot Siegfried’s murder. A more glaring example of the commodification of women is found in Die Meistersinger, where Viet Pogner offers Eva, his only child, as a prize in a singing contest. Since membership in the mastersinger guild is a prerequisite for entrants, Eva quickly deduces that the loathsome Sixtus Beckmesser is almost the only eligible contestant. With Walter, the young man she loves, barred from the competition, she tries to persuade Hans Sachs to compete for her hand, thinking, so it seems, that it is better to live with the widower Sachs, who has grown children of his own, than face a choice between Beckmesser and spinsterhood. Quite possibly the same happens in Tannhäuser where the Landgrave has his niece Elisabeth preside over a contest of song; the prize she will bestow on the winner is

332

Brett Cooke

not unspecified, rather it will be up to the winner. It probably is significant that the two contestants named, Tannhäuser and Wolfram, are both in love with her. And then there is the direct exchange of woman for capital in Das Rheingold, where Wotan pays for the construction of Valhalla with Freia. Since his sister-in-law grows the “golden apples” of eternal youth, a veritable reference to reproductive value, Wotan later steals the Rhinegold to buy her back. As Loge observes, no one is crazy enough to give up a woman, especially when there is none to compare with Freia (cf. Clement 1988, p. 141 f.). In that same opera, Alberich forswears love in order to grab the Rhinegold, but then he uses some of it to lure a woman into bearing his evil son, Hagen. Wagner’s heroines approach peak reproductive potential: usually sung by sopranos, they are young and described as very attractive. Daland says that Senta “adorns her sex!” (Wagner, Der fliegende Holländer, 1960, p. 6),6 Brangane says of Isolde, “Where is the man who would not love you?” (Wagner, Tristan und Isolde, 1972, p. 21).7 Nuremberg’s married mastersingers wish they were free to compete for Eva. Kundry poses an exception that supports this rule. Although the magician Klingsor often transforms her into a ravishing beauty in an effort to snare the Knights of the Grail, elsewhere she appears as a hag. She has been unable to die since she laughed at Christ on the Cross about a thousand years previously. Notably Kundry is the only heroine in Wagner usually played by mezzosopranos. None of these heroines are yet mothers; probably all except Kundry and Sieglinde are virgins. This is made clear in Brünnhilde’s case and obvious with Eva, Elisabeth, Senta, and Elsa, adding to their likely value as mates. Their demanding vocal parts suggest both great physical vitality and, given Wagner’s pure lines, sincerity. Except for Kundry and Isolde, they pose little risk of infidelity. Senta and Elsa give their hearts to their intended husbands before they see them for the first time. As Senta’s gloomy music suggests, she has long been obsessed with the Dutchman’s portrait and has committed herself to be his savior (cf. DiGaetani 2003, p. 39). Heretofore she has distinguished herself for devotion to her father, a virtue the Dutchman cites as a sign of her future fidelity: “True to him, she’ll be true to her husband, too.” (Wagner, Der fliegende Holländer, 1960, p. 6).8 Female fidelity is a prominent theme in this opera. Sailors, like hunters, travel far from home, leaving their loved ones behind. There is little surprise that they sing about whether their girlfriends are waiting for them back at their home port. Notably, the sole romantic challenge to the seafaring Dutchman comes from Eric, who is not a sailor. For his part, the Dutchman has been disappointed in female fidelity 6 7 8

“[S]ie zieret ihr Geschlecht!” (ibid.). “Wo lebte der Mann, der dich nicht liebte?” (ibid.). “[I]hm treu, wird sie auch treu dem Gatten sein.” (ibid.).

Liebestod Revisited

333

many times before – and this condemns him to sail continually, only lighting into port to try his luck every seven years. Female fidelity is an important theme in other Wagner operas. In Die Meistesinger Eva is seen walking arm in arm with her father, also presaging her devotion to her future husband. Lohengrin is, of course, the knight of Elsa’s dreams. Although she has promised her heart to him, he requires absolute obedience from her; she cannot even wish to know his name and origin, a strange and extreme demand from a husband. Meanwhile the love-stricken Elisabeth has long awaited Tannhäuser’s return. Even when she learns of his manifold sins, she remains devoted to him. Although parents treat their daughters as exchangeable property, according to sexual selection theory they seek good value in their sons-in-law. Their daughters’ reproductivity is theirs as well, after all. This may explain why they pose difficult tests for prospective suitors. Pogner’s insistence that Eva marry a mastersinger conveys a parental desire for augmenting her limited reproductive potential with mate quality; moreover, her future husband must win a contest of singing. Brünnhilde similarly persuades her father to temper her abandonment with a magic fire that will deter all but the brave: “let no cowardly boaster have me as his prize. He must not be worthless who wins me.” (Wagner, Die Walküre, 1988, p. 241)9 They are not disappointed. Only Siegfried is able to cross Wotan’s barrier a full opera later. Indeed, Wotan himself attempts to bar the hero’s path, but Siegfried shatters Wotan’s spear with his sword Nothung. Walter von Stolzing turns out to be a talented composer and singer. He is a nobleman, so Pogner and Eva achieve hypergamy. The dramatic tension of Wagner’s comedy derives from the possibility that Walter will be unable to compete successfully for her hand, with the result that she will be forced to decide between Beckmesser and not being allowed to marry anyone at all. On the other hand, in Die Walküre Sieglinde is abducted and forced to marry the brutish Hunding. Notably, while she bears her husband no children, she is soon pregnant by Siegmund. For his part, Siegmund previously came to blows with Hunding’s clan when he attempted to rescue another woman from a forced marriage. In other words, Wagner raises our anxiety that the heroines’ reproductivity will be wasted. As for Brünnhilde, for a time she is claimed by a hero who truly knows no fear. But in Götterdämmerung the Heldentenor Siegfried cheats the system by disguising himself as Gunther, even wooing her in baritone, all in order to trade her to his new friend, someone who never could have crossed Loge’s Magic Fire. Being immeasurable, male reproductivity is cheap and expendable. Men, not women, often die violent deaths in Wagner’s operas. Telramund (Lohengrin), Melot, Kurnewal, Tristan (Tristan und Isolde), Fasolt, Siegmund, 9

“[D]em feigen Prahler gib mich nicht preis! Nicht wertlos sei er, wer mich gewinnt.” (ibid.).

334

Brett Cooke

Hunding, Fafner, Mime, Siegfried, and Gunther (Der Ring des Nibelungen) die at the hands of other men. The Rhinemaidens drown Hagen. As opposed to these twelve male victims, only Sieglinde and Siegmund’s mother is murdered, and this happens offstage, long before the action of Die Walküre.10 Note that Wotan has Siegmund killed for incest and adultery, but not his sister Sieglinde (Die Walküre), although she is guilty of the same crime.11 Women are more likely to suffer violent deaths by their own hand: Senta and Brünnhilde. If anything, Wagner’s works express a desire for male celibacy. Weddings in Lohengrin and Götterdämmerung are nearly disrupted. Siegmund, Siegfried, Tannhäuser, and Amfortas (Parsifal) suffer for sexual transgressions. Tannhäuser cavorts with the goddess Venus herself to a point of exhaustion, whereupon he exclaims, “My salvation lies in [the Virgin] Mary!” (Wagner, Tannhäuser, 1961, p. 15)12 In the Brothers Grimm, one of Wagner’s sources, Tannhäuser returns to Venus when refused absolution by the pope, but in the opera he dies of grief instead. Amfortas was speared by Klingsor while engaged in flagrante delicto with Kundry. Meanwhile, Lohengrin and Parsifal resist intercourse. Lohengrin’s mystical powers depend on his bride Elsa not knowing his name.13 Notably their scene in the bridal chamber is disrupted when she pops the question and their virginity is untrampled. We are given to believe that Parsifal’s name is Arabic for “pure fool.” Only by resisting the blandishments of twelve flower maidens placed in his path and, subsequently, Kundry’s kiss is Parsifal able to destroy Klingsor’s castle and eventually restore worship of the Holy Grail.14 In effect, Wagner seems to suggest that there can be an excess of male sexuality. Unlike some of his sources for Parsifal, Wagner’s Grail knights are all male and expected to be 10 Another exception is that of Irene in Wagner’s early Rienzi, who, along with the other principal characters, is killed in a riot. This apparently follows the plot of Edward Bulwer-Lytton’s novel, which served as the model for Wagner’s libretto. Meanwhile, our count does not include the husbands of the twelve flower maidens whom Parsifal defeats; their fates are unclear. 11 However, she has reason to fear some sanctions, inasmuch as Brünnhilde helps her to find shelter from their angry father. 12 “Mein Heil ruht in Maria!” (ibid.). DiGaetani notes that Wolfram’s tribute to Elisabeth is, quite ironically, addressed to the “Evening Star,” i.e., the planet Venus (cf. DiGaetani 2003, p. 49). 13 The association of male virginity and not knowing their own names is found in Die Walküre, where Siegmund learns his name from his long-lost twin sister Sieglinde, and Parsifal, who learns his from Kundry. The Hutcheons note how often Tristan and Isolde say each other’s names in their love duet. In Götterdämmerung Hagen tricks Siegfried into forgetting knowledge of any women prior to his meeting Gutrune. Apparently, male virginity figuratively can be restored. But it does not last. In Act III, another libation restores his memory of his tryst with Brünnhilde, whereupon Hagen kills him with a spear (cf. Hutcheon and Hutcheon 2004, p. 61). 14 There are limits to this. Klingsor castrates himself in a vain attempt to be accepted by the order. He takes vengeance by turning to black magic and having Kundry seduce the monastic knights. Since Parsifal is the first man to resist Kundry’s charms, he is able to liberate her from Klingsor’s spell.

Liebestod Revisited

335

celibate (cf. Millington 1998, p. 257). The seeds of Götterdämmerung are literally sown by Wotan. By various women he is the father of Siegmund, Sieglinde, Brünnhilde, and the other eight Valkyries.15 When the elderly Beckmesser tries to force himself on Eva in Die Meistersinger, he is made the butt of the joke. Wagner makes a virtue of abstinence. The venerable Hans Sachs yields Eva to Walter; he fears to repeat King Mark’s mistake in marrying a younger woman. And Mark attempts to correct his own mistake. Hearing that Tristan and Isolde inadvertently drank a love potion, King Mark yields his wife to his beloved nephew.16 Although they had not consummated their marriage, this happens much too late (cf. McGlathery 1998, p. 191). Wotan vainly attempts to keep his grandson Siegfried from penetrating the Magic Fire and Brünnhilde. So why do some of Wagner’s beautiful women simply drop dead as the climax of his operas? The answer seems to be that, sharing our natural calculation of inclusive fitness, Wagner wastes their reproductive potential to heighten our sense of loss.17 Elisabeth prays to, notably, the Holy Virgin Mary to sacrifice herself for Tannhäuser’s redemption. Senta drowns herself for the Dutchman and Brünnhilde mounts Siegfried’s funeral pyre, arguing with Gutrune as to who is his rightful wife. Not all women die childless, but Tristan and Siegfried’s mothers die in childbirth, while Parsifal’s and Sieglinde’s meet tragic ends. This is conveyed by the name of Parsifal’s mother, “Herzeleide,” who died of grief. The only surviving mother we ever see on Wagner’s stage is Erda.18 No doubt there is more to be said to explain the viability of Isolde’s Liebestod. For example, Isolde’s ability to die of love also redeems her for being previously betrothed to Morold and now married to King Mark. And then there’s the music … But biopoetics has already revealed at least some of the narrative logic of this scene. Notably most of Wagner’s plots are based on traditional myths, in which the composer argued “human relations almost completely love their conventional form, which is intelligible only to the abstract reason [and] show what is eternally human and eternally comprehensible.” (quoted in Fergusson 1972, p. 72). Francis Fergusson cites Tristan und Isolde as “the most perfect instance of drama as ‘the expression of emotion.’” (p. 81). 15 Quite likely one woman Wotan has failed to impregnate is his wife, Fricka; there seem to be no legitimate children of the gods in Der Ring. It should be noted that Valhalla is built in a vain attempt to keep Wotan at home. 16 In an earlier version of the myth Mark has Tristan burned alive and sends Isolde off to live with lepers (cf. Clement 1988, p. 57). Similar to the magnanimity of Hans Sachs, the Marschallin of Richard Strauss’ Der Rosenkavalier yields her young lover Octavian so that he can marry Sophie. 17 This thinking does not pertain to Kundry, for whom death comes as a relief, much as must be the case for the long-suffering Dutchman. 18 Isolde’s mother is alive back in Ireland.

336

Brett Cooke

Although this scan of Wagner’s ten mature operas constitutes a small statistical sample, the asymmetries we perceive reveal common biases. Beginning with Der fliegende Holländer, all of Wagner’s operas, despite their daunting demands on performers and massive costs for producers, hold stable positions in opera’s core repertoire. If money was not an issue and if there were more Heldentenors available, surely they would be played more often than they already are. Apparently utilization of elemental and universal human dispositions like those described in Bateman’s Principle, especially in the form of deviations from their common expression, helps operas like Wagner’s successfully compete for our attention. Obviously, there is much more to be said to explain the aesthetic success of Isolde’s Liebestod. Fergusson sees in Tristan the “feeling that our intellectual life, our loyalties, and our relationships are all deluded – that we are really moved by undefinable and instatiable passion – is never far away.” (Fergusson 1972, p. 94). Despite its apparently illogical plot, the opera “feels to us like the very truth of the human condition” (p. 95). Barry Millington and Joseph Kerman both note how the composer is able to captivate audiences for hours with a narrative containing remarkably little action (cf. Millington 1998, p. 231; Kerman 1952, p. 197). In other words, Wagner does this by revealing to us an enthralling and insatiable emotional logic, one that admittedly requires and deserves further explication, especially with regards to the music. We anticipate there will be many other biopoetic perspectives on these masterpieces as we learn how to apply our growing knowledge of Darwinian influences on our behavior to the arts. As we see from this sample of biodeconstruction, stripping bare the surface structure, as in the case of the heroines’ strange deaths, gives us a glimpse of the remarkable things going on in the mind.

References Boyd, Brian, “The Purpose-Driven Life,” in: The American Scholar 78.2 (2009), pp. 24– 34. Clement, Catherine, Opera, or the Undoing of Women (L’opéra ou la défaite des femmes [1979], transl. by Betsy Wing), Minneapolis: University of Minnesota Press, 1988. Cooke, Brett, “Cliches Worth Singing: Narrative Commonplaces in Opera,” in: The Evolutionary Review. vol. 1, ed. by J. Carroll and A. Andrews, Albany, NY: SUNY Press, 2010, pp. 76–81. DiGaetani, John Louis, Wagner and Suicide, Jefferson, NC: McFarland & Company, 2003. Fergusson, Francis, The Idea of a Theater, Princeton: Princeton UP, 1972. Hutcheon, Linda / Michael Hutcheon, Opera: The Art of Dying, Cambridge, MA: Harvard UP, 2004. Kerman, Joseph, Opera as Drama, New York: Vintage, 1952. McGlathery, James, Wagner's Operas and Desire, New York: Peter Lang, 1998. Millington, Barry, Wagner. Princeton: Princeton UP, 1998.

Liebestod Revisited

337

Smith, Patrick J., The Tenth Muse: A Historical Study of the Opera Libretto, New York: Schirmer, 1975. Wagner, Richard, Der fliegende Holländer (transl. by Gwyn Morris), New York: Angel Records, 1960. –, Tannhäuser (transl. by William R. Gann), Los Angeles: Capitol Records, 1961. –, Tristan und Isolde (transl. by John Kehoe), London: EMI Records, 1972. –, Die Walküre (transl. by William Mann), Hamburg: Deutsche Grammophon, 1988.

338

Mathias Clasen

“Can’t Sleep, Clowns Will Eat Me” Telling Scary Stories Mathias Clasen “Among the earliest forms of human self-awareness was the awareness of being meat.” (Quammen 2004, p. 3)

I. Lost in the Woods Ordinary people rarely get lost in the woods during wild witch-hunts. Nevertheless, this is basically the plot line of the stupendously successful horror film The Blair Witch Project (1999),1 which was produced for $35,000 and grossed almost a quarter of a billion US dollars worldwide.2 Why would anyone pay good money to sit in for an hour and a half on such a film? Why would anyone care? The horror genre continues to draw large audiences in literature, film, and interactive entertainment. It might seem strange that vicarious fear and anxiety are sought out by many people, maybe especially when considering the relative safety of modern urban environments. As William James pointed out in 1892, the “progress from brute to man is characterised by nothing so much as by the decrease in frequency of proper occasions for fear” (James 1920, p. 408). To understand the present, we must know the past and the forces that hammered and twisted our species into shape. One problem reliably faced by our forebears in the “environment of evolutionary adaptedness” – the hypothetical, statistical conglomerate of selective pressures which shaped Homo sapiens – was that of predators. Even if modern, civilized existence offers little in the way of true peril, our species grew up in a dangerous world. We have evolved specialized neural machinery dedicated to the problem of danger detection and handling – adaptations that were essentially established far back in our pre-hominid past – and it is my contention that this has farreaching consequences for the study of horror fiction, consequences that are largely unexplored. In this essay, I propose a theoretical framework for a bio1 2

The Blair Witch Project, dirs. Daniel Myrick and Eduardo Sánchez, Haxan Films, 1999. “The Numbers,” 2 November 2009: http://www.the-numbers.com/movies/series/BlairWitchProject.php.

“Can’t Sleep, Clowns Will Eat Me”

339

cultural approach to horror fiction, an approach which is vertically integrated with the evolutionary social sciences (cf. Gottschall 2003).

II. Defining Horror Horror fiction is the kind of narrative art which is designed to scare and / or disturb its audience.3 Thus, horror fiction is defined affectively and not according to, for example, a specific setting, like the Western. The affect caused by horror ranges from wild-eyed fear to low-level anxiety or Angst. Cinematic horror is better at engendering powerful fear and startle responses, whereas literary horror usually aims for a quieter sort of unsettlement. Horror can also figure as an element in a narrative not otherwise regarded as a “horror story,” an observation which has been used by several critics to validate the genre, asserting that most, if not all, of our great writers have written horror stories or stories with fear-inspiring passages (cf., e.g., Winter 1989, p. 12; Sullivan 1986, p. vii). To understand the nature of horror, it is essential to recognize that horror fiction is evolved from earlier, recognizably similar kinds of stories; that horror is not, exclusively, a cultural or social construction but rather a predictable product of an evolved human nature (even as individual works of horror are strongly modulated by cultural context). Horror is what happens when Homo sapiens meets the world; it is a “natural” genre, not merely the chance product of an unusual mind or a specific set of cultural circumstances. As the American writer and critic H. P. Lovecraft asserted, “the horrortale is as old as human thought and speech themselves.” This, he said, is “naturally [to be] expected of a form so closely connected with primal emotion.” In his slim history of the genre, Lovecraft found the roots of the modern horror story in “the earliest folklore of all races” and charted its development from folk- and fairytales via the Gothic novel to the modern tale of terror (Lovecraft 1973, p. 17). This conception stands in stark contrast to the widespread historicist notion that horror fiction came into miraculous being with the publication of Horace Walpole’s The Castle of Otranto in 1764, the first Gothic romance. In this view, the birth of the horror story is seen as a symptomatic by-product of the Enlightenment.4 3

4

Although adequate as an operational definition, my definition is easily criticized. It is perhaps too inclusive or too restrictive, or too reductive. Moreover, a horror story may scare one person witless and leave another relatively unperturbed. However, insofar as a work of horror is discernible as being consciously designed to scare and/or disturb, the parameter of the ‘scariness’ of a fiction can be viewed as an objective structural feature, rather than as a subjective criterion of success. E.g. Kendrick 1991: “Scary entertainment, as we know it today, showed its first stirrings in the middle of the eighteenth century” (p. xxii). See also Stephen King, Danse Macabre (1983); Botting 1996; Skal 2001.

340

Mathias Clasen

There is some truth to the historicist view, however. Even as horror stories through time and space display several static features (e.g., a relatively limited monster gallery), they should also be seen in their cultural context, since a work of horror is always, to an extent, a translation of locally and historically contingent, and usually salient, anxieties. And yet horror varies within a narrow range: like languages, horror stories are cultural variations on a limited, biologically constrained set of “rules.”

III. Differential Interest There is a striking disconnect between the plots of most horror stories and the lives of ordinary people. We rarely get possessed by demons (The Exorcist),5 get chopped up by chainsaw-wielding maniacs (The Texas Chainsaw Massacre),6 or are preyed upon by animated corpses (Night of the Living Dead),7 and yet stories featuring such unlikely events attract large audiences. This disconnect is baffling only until one dons a pair of evolutionary glasses. As Benson Saler and Charles A. Ziegler remark, “since monsters, in one form or another, were an omnipresent feature of our evolutionary past, tales about slaying monsters […] have a salience and relevance for us that represent a heritage from our Paleolithic ancestors” (Saler and Ziegler 2005, p. 224). As Brett Cooke observes, “no one wants to read a novel on tax preparation” (Cooke 1998, p. 50). “There are limits to our interests,” as he points out, “and this is reflected in viable art.” Cooke invokes the concept of “differential interest” to explain why humans are generally more interested in certain themes than others, and he predicts that once a “biothematics” – an investigation into the sort of themes that perennially interest readers – is more fully developed, “topoi will accord with central principles of sociobiology” (p. 51).8 Thus, adaptationist literary study predicts that themes associated with or derived from the concerns of inclusive fitness (e.g., mate selection, survival, reproduction, kin relations) are likely to be overrepresented in narrative art, especially in popular fiction. It certainly seems that horror fiction is obsessed with a few themes of keen adaptive importance. Horror stories are so often about identifying and negotiating monstrous threats, about surviving in a universe brimming with hostile forces. Horror is a very “primal” genre, a genre intimately concerned with life and death and the struggle for existence.

5 6 7 8

The Exorcist, dir. William Friedkin, Warner Bros., 1973. The Texas Chainsaw Massacre, dir. Tobe Hooper, Vortex, 1974. Night of the Living Dead, dir. George A. Romero, Image Ten/Laurel Group, 1968. See also Cooke 1999.

“Can’t Sleep, Clowns Will Eat Me”

341

IV. Universal Monster The monster is a defining feature of the horror story. This is the case even when we don’t know whether it exists only in a character’s head or is really out there, as in Henry James’ “The Turn of the Screw,” or if it is merely the unfortunate combination of a case of bad nerves and an optical illusion, as in Poe’s “The Sphinx,” or if it turns out not to be a monster at all, as in Washington Irving’s “The Legend of Sleepy Hollow.” As Noël Carroll suggests, a “monster or a monstrous entity” (Carroll 1990, p. 16) is a necessary, though not sufficient, condition for horror. We can supplement this with the claim that a monster or a monstrous entity (such as a curse, like in Richard Bachman’s Thinner) – a monstrum – needs to have narrative dominance for a tale to be classified as a horror story. The monster gallery of horror fiction is conspicuously narrow. A few fearsome creatures seem destined to prey on us, with little hope of rest eternal.9 In tales from all over the world we thus find undead creatures like zombies and vampires, half-animal predators like werewolves and trolls, and revenants from beyond the grave. As David Gilmore notes in his cross-cultural anthropological survey of monsters, “people everywhere and at all times have been haunted by ogres, cannibal giants, metamorphs, werewolves, vampires, and so on” (Gilmore 2003, p. ix). Gilmore finds a range of universal monster characteristics which are summarized by Saler and Ziegler as follows: [G]reat size and / or remarkable strength; a prominent mouth with fangs or some other means of facilitating predation on humans; an urge to consume human flesh and / or blood; and hybridism, for they often combine human and animal features, or mix living and dead tissue, or manifest amalgams of discordant parts of various organisms. (Saler and Ziegler 2005, p. 220)

Gilmore relies on psychoanalytical theory in explaining the fear and fascination that monsters engender universally. For example, he notes that monsters almost always come with a mouthful of horrible teeth: “However else they are rendered in anatomical terms, monsters are depicted has [sic] having yawning, cavernous mouths brimming with fearsome teeth, fangs, or other means of predation.” (Gilmore 2003, p. 176). This “obsession with oral aggression” (p. 178) is explained by Gilmore as a variant of the “oral-aggressive stage” in psychosexual development and the Freudian wish to eat the mother (cf. pp. 180f.). However, the sharp teeth of monsters make me think of what David Quammen calls “alpha predators” rather than repressed infantile complexes and matrivorous babies. Occam’s razor applies: the more parsimonious explanation is preferable. Likewise, Freud claimed that the fear of being 9

Stephen King, in his monograph on horror fiction Danse Macabre (1983), offers four horror archetypes: the Vampire, the Werewolf, the Thing Without a Name, and the Ghost (p. 50).

342

Mathias Clasen

buried alive was “merely a variant of […] the fantasy of living in the womb” (Freud 2003, p. 150). There is, however, no good scientific reason for decorating with fantastic assumptions and quirky theorems the trivial observation that nobody would desire such a fate. Quammen’s alpha predators include tigers, bears, crocodiles, the great white shark, lions, pythons, and other fearsome animals. This grouping of organisms has “no taxonomic or ecological basis” – rather, its “reality is psychological, as registered in the human mind” (Quammen 2004, p. 5). Our species’ past struggles with real monsters have left a lasting imprint in our genome and our psychology, one that not even an existence free from the danger of predation can quite erase. In the words of E. O. Wilson, “a sweet sense of horror, the shivery fascination with monsters and creeping forms that so delights us today even in the sterile hearts of the cities, could [in ancestral environments] see you through to the next morning […] We stay alert and alive in the vanished forests of the world.” (Wilson 1984, p. 101). And interestingly, even monsters of which description is scant are frequently depicted in animal and predatory terms. For example, in the beginning of Stephen King’s monumental It, six-year-old George enters the basement in search of a candle. As he turns on the basement light, he fears that “while he was feeling for the light switch, some horrible clawed paw would settle lightly over his wrist,” a paw belonging to a thing “all hairy and full of killing spite” (King 1987, p. 18). And when the eponymous monster is glimpsed for the first time, George sees “yellow eyes […] the sort of eyes he had always imagined […] down in the basement. It’s an animal, he thought incoherently.” (King 1987, p. 24). Similarly, in Clive Barker’s short story “Coming to Grief,” a monster figures in the periphery, a monster whose only described feature is a “clawed hand” (Barker 1989, p. 103). And the single attribute offered of the ancient and otherwise amorphous monster in T. E. D. Klein’s acclaimed horror novel The Ceremonies is that it has “claws” (Klein 1985, p. 7). That a claw should be synecdochal of a modern horror monster is striking, since claws are probably responsible for very few casualties in modern urban environments. However, in ancestral environments, a claw spelled potential death.

V. Predation Pressure There is good reason to believe that predators exerted a strong selection pressure on our evolutionary ancestors, and that this selection pressure resulted in a change in our genome so that even today, when predators are relegated to cages and nature programming on TV, we are wired to pay attention to things that were dangerous to us in prehistory (cf. Öhman and Mineka 2001).

“Can’t Sleep, Clowns Will Eat Me”

343

This gives a “non-random distribution of fears” (Marks and Nesse 1994, p. 255),10 and fears and phobias fall in a short, predictable list – a list which includes snakes, spiders, “heights, storms, large carnivores, darkness, blood, strangers, confinement, deep water, social scrutiny, and leaving home alone.” (Pinker 1999, p. 386). As Steven Pinker notes, the “common thread is obvious. These are the situations that put our evolutionary ancestors in danger.” (ibid.). Several of the items on Pinker’s list are strikingly reflected in horror writer Stephen King’s list of “personal terrors,” published in 1973 (quoted in Spignesi 1991, p. 4): 1. Fear of the dark 2. Fear of squishy things 3. Fear of deformity 4. Fear of snakes 5. Fear of rats 6. Fear of closed-in spaces 7. Fear of insects (especially spiders, flies, and beetles) 8. Fear of death 9. Fear of others (paranoia) 10. Fear for someone else It is remarkable indeed that few of the items constitute a serious threat to a denizen of the north-eastern US state of Maine, where King lives.11 Yet as Brett Cooke speculates: “Since mundane actuality seems to curb our fantasy, we may be more likely to fantasize about the snake in a relatively snake-free milieu.” (Cooke 1999, p. 155). This may be why Stephen King writes of one spider “perhaps fifteen feet high” (King 1987, p. 1029) and another the size of a cat (King 2004, p. 676), why Ray Bradbury in “The Fog Horn” describes a sea serpent “ninety or a hundred feet” (Bradbury 2007, p. 244) long, and why horror monsters in general seem to be rather exaggerated in terms of size and fearsomeness (think King Kong and the giant serpentine monsters of Tremors). What seems to corroborate Cooke’s claim is the way that systematic habituation or desensitization is used therapeutically in the treatment of phobia. If sustained exposure to the object of fear decreases its power to instil fear in the patient, then presumably, if the mental monster has no immediate real-world counterpart with which to compare it, the imagined monstrosity can grow independently and 10 See also Barrett 2005. 11 For somebody born in 2006 (the most recent year from which statistics are available) in the US, the lifetime odds of dying from spider bite are about 1 to 1,000,000 (National Safety Council, “Odds of Death Due to Injury,” 15 December 2009: ).

344

Mathias Clasen

free of the natural constraints that are imposed on actual organisms. Happily, we find no fifteen-foot spiders in nature. As the horror film director John Carpenter has observed, “What scares me is what scares you. We’re all afraid of the same things. That’s why horror is such a powerful genre.” (McCarty and McLaughlin 2003).12 A related observation is offered by the horror writer Thomas F. Monteleone: “a horror writer has to have an unconscious sense or knowledge of what’s going to be a universal ‘trigger’.” (Wiater 1997, p. 119). The things that humans fear are not random and not entirely culturally constructed; nobody fears a perfect triangle, and nobody could be conditioned to acquire a serious phobia of perfect triangles. It comes easily, on the other hand, to acquire fear of deadly animals and supernatural menace. And so, when it comes to fashioning horrors, the human imagination is startlingly limited and circumscribed by our evolutionary heritage.

VI. Distortions of the Human Morph It may be that humans are born with abstract predator templates (cf. Barrett 2005) which are then fleshed out either by experience or vicariously, for instance via narrative (cf. Tooby and Cosmides 2001; Scalise Sugiyama 2006). It may also be that we are born with a set of general principles: avoid animals that are larger than you and / or have a sharp muzzle. There are, however, two species which depart from this general template, both of which presumably exerted a sustained selection pressure on our ancestors: snakes and spiders. We have reason to believe that human beings are born with templates for these species13 and a simple epigenetic rule which instructs the organism to pay attention to snakes and spiders, and to easily acquire fear of them if appropriate. Not surprisingly, then, we find both snakes and spiders in modern horror fiction produced by and for urban audiences (cf. Clasen 2010), who are in no overwhelming danger from snake or spider bite. Regarding the snake, Arne Öhman has pointed out that “reptiles provided an archaic prototype for threats emanating from predation pressure, and […] this may explain the human tendency to equip the embodiments of evil with bestial features.” (Öhman 2000, pp. 587f.).14

12 See also “John Carpenter Looks Back at Halloween on Its 25th Anniversary,” 19 May 2006: . 13 On an evolved spider detection mechanism, see D. H. Rakison and J. L. Derringer 2008. See also Wilson 1984; Cooke 1999. 14 A good example is the juxtaposition of the cute and cuddly Mogwai with the evil, reptilian Gremlins in the film of that name.

“Can’t Sleep, Clowns Will Eat Me”

345

However, not all horror monsters are variations on ancestral threats, or so it would appear. It seems reasonable to assume that the selection pressure from ghosts was negligible in our past, yet the ghost is a true universal (Atran and Norenzayan 1992, p. 713). However, the ghost appears to spring from an innate dualism in our psychology, a hard-wired tendency to view humans as consisting of matter and spirit, and to suppose the existence of a spiritual dimension alongside the physical, observable one. Conspicuously, flesh decays, whereas the soul may just hang around after the decomposition of the organism. Typically, the ghost wants not to eat you: its hunger is spiritual or emotional. It may seek revenge, it may seek to right a wrong perpetrated to it or maybe its kin pre-mortem, and it may wish to consume your soul. Ghosts disturb on a more cerebral level than other monsters; they may create cognitive dissonance and disturbances in one’s world view, insofar as they are, in fact, portrayed as horrible, odious, or unnatural. As Lovecraft pointed out, the true “weird tale” – a particular class of horror literature associated with that author – must have a “hint […] of that most terrible conception of the human brain – a malign and particular suspension or defeat of those fixed laws of Nature which are our only safeguard against the assaults of chaos and the daemons of unplumbed space” (Lovecraft 1973, p. 15). Possibly the raw power of the ghost stems from a common apprehension that “there’s more than we can see, that the visible world is not the whole story,” as the author Peter Straub puts it: “We know within us, somewhere at a very deep level, that there is simply more, and the supernatural comes out of that apprehension, I think.” (quoted in Clasen 2009, p. 41). The supernatural typically takes the shape of occult agency or disembodied minds (sometimes with uncanny access to the inner lives of mortals), and the apprehension that Straub talks about is probably a product of an evolved “Theory of Mind” or intuitive understanding that other people are not just physical objects but that they also have psychological existence or minds. Another pertinent case is the evil clown, by now a mainstay of horror fiction. As the horror actor Lon Chaney reportedly observed, “[t]here’s nothing funny about a clown in the moonlight” (quoted in Skal 2001, p. 364). Murderous or insane clowns appear in as different venues as Stephen King’s It and an episode of the TV-show The Simpsons.15 We are obviously not born with an epigenetic algorithm coding for coulrophobia, but the clown may trigger other adaptive responses. As Robert Winston points out, “clowns obscure their face with paint, thus covering their features and 15 King 1987 and “Lisa’s First Word” (in: The Simpsons, dir. Mark Kirkland, episode 10, season 4, 20th Century Fox, 1992), from which I take the title quote of this essay. Brett Cooke pointed out to me that the lead character in Leoncavallo’s 19th-century opera I Pagliacci is also a murderous clown (personal communication).

346

Mathias Clasen

true emotions; they confuse our ability to judge their mood” (Winston 2002, p. 37). A murderous clown is merely a human predator with facepaint; we may note in passing how many human monsters of psychological horror films or thrillers obscure their faces with masks or clothing, from Leatherface in The Texas Chainsaw Massacre to Michael Myers of Halloween, from the killer of Scream to Jason Vorhees in Friday the 13th and the maniacal fisherman in I Know What You Did Last Summer. An earlier example is the Phantom of the Opera of Gaston Leroux’s 1909/1910 novel of that name; the Phantom’s face is severely disfigured and he therefore covers it up.16 In general, what Joanne Cantor and Mary Beth Oliver call “distortions of natural forms” (Cantor and Oliver 2004, p. 226) plays a significant role in horror fiction. Many scary creatures look decidedly sick, thus activating powerful, innate disgust mechanisms. Zombies are a case in point, since they are generally portrayed as animated rotting corpses, and bodies in a state of decomposition are found cross-culturally to evoke disgust because they activate mechanisms selected for by the threat of disease (cf. Curtis and Biran 2001) They may thus trigger an avoidance mechanism that originated in adaptations for food choice: spoiled meat is bad for you (and even more so when it wants to devour you). Zombies may also, as recognizable humanoids, tap into an evolved social decision system designed for mate selection: part of the repulsion that zombies engender may be due to their poor mate potential. Since physical attractiveness (or beauty) has been found to correlate with phenotypic and genetic quality (Grammer et al. 2003, p. 399), unattractiveness may signify relatively poor health or fitness. Zombies presumably activate the psychological machinery that we use to assess the attractiveness of other people: skin quality is one such parameter (Grammer et al. 2003, pp. 369f.), and zombies have notoriously bad skin. The phenomenon known as the “uncanny valley” – the observation that entities which resemble humans significantly yet lack something essential in their appearance, like moving corpses or very humanoid robots, tend to be perceived as uncanny or repulsive – is well-documented (cf. MacDorman et al. 2009), but the cause of the aversive response to uncanny creatures has until recently remained the object of speculation. Several evolutionary explanations for the uncanny valley have been offered (relating mainly to pathogen avoidance and mate selection), and one study set out to test whether it is based on cognitive machinery unique to humans, and thus whether the evolutionary hypotheses pan out. In this study, five macaque monkeys were shown a variety of computer-generated monkey faces, and they “consistently exhibited the uncanny valley effect” (Steckenfinger and Ghazanfar, 2009, p. 18363), preferring not to look at the uncanny, realistic-yet-synthetic CG monkey faces (“monkey zom16 Gaston Leroux, The Phantom of the Opera, New York, NY: Dorset Press, 1988.

“Can’t Sleep, Clowns Will Eat Me”

347

bies”) that they were presented with. Thus, the uncanny valley does indeed seem to run through an evolved mental landscape.

Fig. 1: Mori Uncanny Valley graph (source: Wikimedia Commons).

The uncanny valley effect presumably pertains to all humanoid monsters. Of course, the sexy vampires of True Blood are a far cry from the repulsive bloodsuckers in 30 Days of Night: some vampires are decidedly attractive, and in True Blood, a sizable demographic known as “fangbangers” actively seek out sexual liaisons with vampires. The vampire in general is more malleable than the zombie – indeed, the zombie is merely a vampire without the bells and whistles, and folkloristic vampires are more like modern zombies than their own post-Stokerian descendants (Barber 1988) – and can be disgusting or attractive, according to the author’s needs. The vampiric genotype – the basic blood-sucking revenant – is realized as different vampire phenotypes in different cultural ecologies. Or in other words, each culture breeds its own monsters, yet within a possibility space constrained by human nature. Just like human behavior and culture are products of intricate interactions between genome and environment, so are fictional monsters products of cultural circumstances and conserved dispositions in human hard-wiring. As an example, Brian Regal has cogently suggested that the werewolf ’s formerly central position as human-like monster par excellence has been supplanted by the monstrous primate such as the Yeti

348

Mathias Clasen

or Bigfoot, and that this takeover can be explained with reference to the introduction of Darwinian evolutionary theory in the nineteenth century: actual wolves gradually ceased to be a threat to mankind, whereas the apeman composite became an object of fear and revulsion, not least due to anti-evolutionary sentiment (cf. Regal 2009). To understand our monsters, we need to understand both the deep history of human evolution and the local ecology of specific monsters.

VII. Distorted Eyes Eyes are frequently distorted in horror fiction. In Bram Stoker’s Dracula, the count’s conspicuously red eyes are mentioned about a dozen times (cf. Stoker 1992, pp. 43, 88, 91, 94, 126, 221, 244f., 247, 251, and 325). In Stephenie Meyer’s Twilight, supernaturally handsome Edward Cullen’s vampire eyes change color according to his mood (cf. Meyer 2008, e.g., pp. 46, 70, 170, and 243). The eyes of demonic André Linoge in Stephen King’s Storm of the Century are occasionally pitch-black with no whites (cf. King 1999, pp. 11, 30, 60, 112, 124, 142, 215, 221, 271, 297, and 373), and the eponymous new-born monster of Ira Levin’s Rosemary’s Baby is more than just “so small and rosyfaced”: his eyes are “golden-yellow, all golden-yellow, with neither whites nor irises; all golden-yellow, with vertical black-slit pupils” (Levin 1997, pp. 295f.). For human beings whose ecological niche is highly social, others’ attention and the direction of other people’s gaze matter. The eyes of our species have evolved to be particularly salient due to the high contrast between the white sclera and the colored iris, a feature not seen in the same degree among other primates (cf. Tomasello et al. 2007). It is of keen importance to us to track other people’s attention, especially when engaged in some form of intercourse – we all know how annoying it is to converse with somebody who is wearing a pair of sunglasses. Even newborns attend preferentially to human faces (cf. Boyd 2005a, p. 152), and so the distortion of faces and eyes are, conceivably, yet another tool available to the artist who wishes to disturb and unsettle; a tool that must be understood in its evolutionary context.

VIII. Tweaked Predators Why is it that hybridism is a feature of the Universal Monster described by Gilmore?17 Why aren’t horror stories simply full of big cats, spiders, and other real (if anachronistic) threats? As Brian Boyd points out: “Works of art die without attention.” (Boyd 2005b, p. 8), and the same goes for fictional monsters. The terrifying crea-

“Can’t Sleep, Clowns Will Eat Me”

349

tures of horror fiction are engaged in a fierce competition for attention, and the most attention-demanding or interesting monster wins this struggle for survival. If cultural concepts are like viruses and in constant competition for host organisms, then it would appear that the by-now common monsters of horror fiction are highly successful cognitive parasites, since they in many cases have lived for several hundred years and have traveled freely across cultural borders. An intriguing finding from the cognitive study of religion is that socalled minimally counterintuitive (or MCI) agents enjoy a certain cognitive advantage. That is, agents that breach one or a few ontological boundaries and violate intuitive assumptions – agents that are “taxonomic anomalies” (Atran and Norenzayan 1992, p. 715) – and which have good explanatory power for apparently inexplicable phenomena are more attention-arresting and more memorable than standard, non-ontology-violating concepts or bizarre ones which have many taxonomic oddities (cf. Boyer 2002; Barrett 2004; Norenzayan et al. 2006). Our basic ontological categories include person, animal, plant, and substance. Creating an MCI agent is easy: switch or delete one or two features from distinct categories – e.g., fashion a person that is able to move through solid objects or a tree with cognition – and you have an interesting concept drawn not from empirical reality, but from a mind primed to make fast and automatic inferences about objects in the world and to extract agency from even minimal cues in the environment. Belief in supernatural agents is not the result of a cognitive failure. It is, rather, the product of normal, automatic cognition; of cognitive machinery which evolved to deal with other challenging aspects of existence, such as predator detection and the problem of inferring what’s on other people’s minds. We simply seem to fashion ghosts and gods as a matter of routine. As Atran and Norenzayan put it, “supernatural agents are readily conjured up because natural selection has trip-wired cognitive schema for agency detection in the face of uncertainty” (Atran and Norenzayan 1992, p. 720). The reason for this too-human tendency to attach agency to the apparently inexplicable – from freak weather incidents to bumps in the night – may have its roots in the problem of predator detection. A rustle in the leaves may and may not signal danger: it’s the wiser choice of action to assume that some bad thing is there, even if it turns out to be wrong (cf. Marks and Nesse 1994). A false negative is better than a false positive, and so a “hyperactive agency detection device” or HADD (Barrett 2004, p. 31) is part and parcel of human cognitive machinery. This device is routinely exploited by horror fiction, which often features glimpsed or intimated monsters in more 17 Several other horror scholars have noted the hybridism or “interstitiality” of horror monsters, e.g., Noël Carroll (1990), who relies on the cultural constructionist theory of disgust proffered by Mary Douglas to explain why “anomalies command attention and elicit curiosity” (p. 195).

350

Mathias Clasen

or less obscured environments, for example at night, something which sets the agency detection device on high alert. As Öhman has demonstrated, “anxiety causes heightened attention to threats in the environment” (Öhman 2000, p. 581). Thus, anxiety engendered by a fiction readily bleeds into the real world. One contemporary reviewer of Stoker’s Dracula noted how, having begun reading the novel in the evening, by “midnight the narrative had fairly got upon our nerves; a creepy terror had seized upon us, and when at length, in the early hours of the morning, we went upstairs to bed it was with the anticipation of nightmare. We listened anxiously for the sound of bats’ wings against the window.” (Anon., quoted in Stoker 1997, p. 364). Another well-developed and oft-used strategy for priming the HADD consists in making the monster’s ontological status within the narrative ambiguous – is there really a harmful agent “out there”?18 As the cognitive devices responsible for producing and entertaining supernatural concepts function subconsciously, we begin to understand why the well-told horror story can make even the most hard-headed skeptic break a sweat. It seems simply to bypass our cognitive defenses. The bump in the night triggers an intuitive “who’s there” response long before it causes rational deliberation and the weighing of evidence regarding a possible impending threat. Apart from more or less exaggerated (usually enlarged) predators, the usual suspects of horror fiction can be categorized as MCI agents: vampires, zombies, werewolves, animated mummies, and ghosts are all ontological bastards. We find ordinarily inanimate objects imbued with malicious will or agency – from cars (Stephen King’s Christine) to industrial laundry machines (King’s “The Mangler”), from houses (Richard Matheson’s “Mad House”) to church organs (Matheson’s “Shock Waves”). The shape-shifting revenant sometimes known as Eva Galli in Peter Straub’s Ghost Story runs counter to what we intuitively expect of human morphology, and the zombies of George A. Romero’s Night of the Living Dead have traded most cognitive functioning for a firm determination to ingest live human tissue, thus largely eliminating cognition from the “person” ontological category and borrowing predation from an “animal” subcategory. From the Holy Ghost to the revenant of Macbeth, from the putative ghosts of “The Turn of the Screw” to their too-real Asian siblings in Ringu, from Beowolf ’s Grendel to the horror of Cloverfield, from Stoker’s Count Dracula to Anne Rice’s tragicomic existentialists (cf., e.g., Rice 1994), our stories brim with counterintuitive, sometimes malicious agents built on, yet also crucially departing from, standard human or predator templates.

18 For example, Henry James turned the screw on agency detection to such an extent that an entire academic sub-industry has been devoted to the problem of deciding whether his ghosts are supernatural or psychological in origin.

“Can’t Sleep, Clowns Will Eat Me”

351

IX. Monstrous Narrative Strategies As Noël Carroll argues, horror stories show not just scary monsters but scared people, as well: “What appears to demarcate the horror story from mere stories with monsters […] is the attitude of characters in the story to the monsters they encounter.” As he points out, the “emotional reactions of characters […] provide a set of instructions or, rather, examples about the way in which the audience is to respond to the monsters in the fiction.” (Carroll 1990, pp. 16f.). In his 1872 book The Expression of the Emotions in Man and Animals, Darwin elaborated on the communicative aspects of the facial expression of emotion (cf. Darwin 1998). As subsequent research has shown, fear travels quickly across individuals via facial expressions and even body postures (cf., e.g., Bannerman et al. 2009). This explains why horror stories tend to dwell on scared people. For example, in The Exorcist (novel and film) we are frequently shown the possessed girl’s mother’s reaction to the horrors of the narrative, prior to being shown the horrors themselves (cf. Kermode 2003, pp. 42ff.). Usually, a monster speaks for itself. By its appearance and behavior, it is clearly dangerous or threatening (to life and limb or to soul and sanity). Yet the audience may know something about the monster which is not immediately deducible from its appearance or behavior. This contextual knowledge may render the monster (even more) monstrous: for example, in the film The Sixth Sense, a boy famously “see[s] dead people.” At one point, he is surprised by the sudden appearance of a very pale, but clearly vivacious, girl. It is the viewer’s knowledge that the girl is dead and not, say, suffering from anemia or acute nausea which makes the scene so disturbing. That the monster is always embedded in and framed by a narrative is a trivial point, but The Blair Witch Project shows how the monster itself can retain its narrative dominance without coming on stage at all, and by dwelling on the portrayal of scared faces, the film also highlights the effectiveness of emotional contagion in horror. Moreover, a range of narrative strategies other than the elaborate description of a monster or a frightened character can be employed to attain the desired effect (or rather, affect). Suspense is the most obvious such tool, and opening a narrative with a passage which establishes the proper atmosphere of anxiety and maybe impending doom is a good example. Such introductions may establish or presage the presence of the narrative’s monstrum. For example, Dan Simmons’ Song of Kali opens with a brief panoramic description of the Calcutta that is to spell death and soul-wrenching despair to the narrator: “Some places are too evil to be allowed to exist. Some cities are too wicked to be suffered. Calcutta is such a place.” (Simmons 2008, p. 1). And the first sentence of the first chapter is an in medias res admonition to the narrator: “‘Don’t go, Bobby,’ said my

352

Mathias Clasen

friend.” (Simmons 2008, p. 2). Thus, the stage is set for a cascade of entirely nasty events. Similarly, the wonderfully composed and enigmatic introduction to Shirley Jackson’s The Haunting of Hill House is designed to plant a seed of unease in the reader’s mind, prefiguring and coloring subsequent events. This introductory passage is non-focalized and like Simmons’, panoramic, offering the reader a detached, “objective” vision: No live organism can continue for long to exist sanely under conditions of absolute reality; even larks and katydids are supposed, by some, to dream. Hill House, not sane, stood by itself against its hills, holding darkness within; it had stood so for eighty years and might stand for eighty more. Within, walls continued upright, bricks met neatly, floors were firm, and doors were sensibly shut; silence lay steadily against the wood and stone of Hill House, and whatever walked there, walked alone. (Jackson 2006, p. 1)

The reader’s attention is forced toward whatever it is that walks alone in Hill House; a creature, presumably, associated with mental disease and darkness, or maybe it’s the insanity stalking the limbic corridors of a sick house. At any rate, the passage is quite disconcerting and clearly aims to establish an atmosphere of apprehension. Opening passages such as these stimulate attention, urge engagement, and create suspense. As Donald Beecher suggests, suspense is “the attentional component […] that keeps the mind excited about its options” (Beecher 2007, pp. 276f.). As he points out, suspense is “an automatic barometer of attention priority in relation to perceived stressors” (Beecher 2007, p. 264), and should be seen in relation to evolved event comprehension systems in our psychology.

X. Why Horror? In The Expression, Darwin related the story of a personal visit to the zoo: I put my face close to the thick glass-plate in front of a puff-adder in the Zoological Gardens, with the firm determination of not starting back if the snake struck at me; but, as soon as the blow was struck, my resolution went for nothing, and I jumped a yard or two backwards with astonishing rapidity. My will and reason were powerless against the imagination of a danger which had never been experienced. (Darwin 1998, pp. 43f.)

As Darwin’s anecdote nicely illustrates, the fear response is largely immune to cognitive control. Conceivably, the horrors of fear fiction pick the locks of the reader’s or viewer’s cognitive defenses, confirming our nightmare that there are monsters lurking in the shadows and grinning clowns in dark alleyways, confirming our suspicions of uncanny causal relations discarded by modern physics.

“Can’t Sleep, Clowns Will Eat Me”

353

Why would anyone want that sort of confirmation and the hair-raising experiences offered by scary entertainment? Of course, there are huge variations in individual preferences for horror stories. But a main motivation for reading and viewing horror fiction probably comes from a desire to experience “extremity of circumstance in perfect safety,” in Peter Straub’s phrase. However, Straub thinks that there is more to horror than vicarious thrills and “artificial” arousal of the autonomous nervous system. In his view, horror fiction is about “discovering one’s ability to feel in certain ways, and deepening and widening one’s emotional experience by that means.” (quoted in Clasen 2009, p. 40). Straub’s view is closely aligned with Joseph Carroll’s conception of literature as a kind of adaptive emotional simulator, a provider of “paradigmatic and emotionally saturated images of the world and of human experience” (Carroll 2006, pp. 42f.).19 By extension, it may be that horror fiction offers us simulated worlds of threat and anxiety in which we can practice adaptive behavior – much like nightmares may function as a kind of threat rehearsal (cf. Revonsuo 2000). What horror teaches is not, as per The Exorcist, to call the local chapter of the Catholic Church in case of possession and to hell with modern medicine; rather, it provides us with emotionally saturated – perhaps, sometimes, over-saturated – images of the world, it teaches us about human relations and about the emotional qualities of experience. In Stephen King’s words, “the primary duty of literature [is] to tell us the truth about ourselves by telling us lies about people who never existed” (King 1983, p. 251). Supernatural horror fiction is by its very nature counter-empirical, yet in one respect even supernatural horror needs to be realistic: in its portrayals of the behavior, psychology, and interactions of its characters. That’s where horror matters; that’s where horror can teach us something truly valuable.

XI. A Biocultural Approach The cognitive-evolutionary approach to horror fiction outlined above is at present rather speculative, but it readily yields testable hypotheses. For example, the neurophysiological signature of the fear response is well understood. With the aid of MR scanning and bio-feedback measurements, one could test whether the response elicited by horror fiction is, indeed, qualitatively similar to the response elicited by real threats. Extensive quantitative literary study would reveal whether a biothematics of horror fiction is viable, and to what extent Gilmore’s universal monster characteristics hold water. Psychological 19 Carroll’s argument is part of a larger argument about the adaptive function of literature. It is notable that Straub’s views implicitly support Carroll’s argument, even though Straub is unaware of the debate within adaptationist literary study.

354

Mathias Clasen

experiments might reveal which personality traits are involved in a preference for and susceptibility to horror fiction, and further on, we may even know the genetic underpinnings of such preferences. Regarding the question of whether horror fiction is adaptive or an exploitation of an adaptation, one might investigate whether regular horror consumers leave more offspring than non-consumers. Put this way, the question sounds ridiculous. And while late-modern horror tales may prepare us for the zombie holocaust, allowing zombie fans to survive and reproduce – a film like Zombieland comes complete with useful survival rules –, most horror stories probably have scant adaptive value, although horror films can be effective dating vehicles for young cinemagoers. At any rate, in ancestral times horror stories may have been adaptive, offering free information about predators and about strategies for predator avoidance, as Michelle Scalise Sugiyama suggests (cf. Scalise Sugiyama 2006). Another strength of the biocultural theory of horror fiction is that it converges with a common-sense understanding of the genre, for example, the kind of general introductions to horror one finds in anthologies or in commentaries by horror writers. Such understandings are usually formulated in a colloquial idiom, rather than Theory-speak or with appeals to arcane psychologies,20 and they invoke a common human nature: human fears are basically common and very old, and the horror genre has probably existed for as long as our species has had the ability and inclination to tell stories.21 At present, the biocultural approach promises to explain the basic structures of horror fiction and the psychological foundations of the genre. Yet to be of extensive use in humanistic horror study, the approach should yield consilient readings of actual horror texts. Such readings have yet to be produced, but I predict that viable Darwinian readings of horror texts should conform to Joseph Carroll’s tenets of adaptationist readings of literature in general. That is, they should “assess each individual literary work or group of works as a peculiar configuration of a specific temperament or individual identity within a specific cultural ecology” and “identify both the individual identity and the cultural ecology as a specific organization of the elements of human nature” (Carroll 2006, p. 46). In other words, such readings 20 For example, Twitchell in his influential study of the genre asserts that the “fear of incest underlies all horror myths in our culture that are repeatedly told for more than one generation” (Twitchell 1985, p. 93). 21 For example, in their introduction to their classic 1944 anthology Great Tales of Terror and the Supernatural, Wagner and Wise claim that the widespread “deep fascination in tales of sheer terror and the supernatural” is “an ancient one – as ancient as the human race”. As they say, “Therein lies its power […] going down to the primitive core of our being.” (Wagner and Wise 1994, p. xiii).

“Can’t Sleep, Clowns Will Eat Me”

355

should incorporate not just an understanding of evolved human nature, but also of the author and the cultural context. It should be biocultural. Take The Exorcist, which seems to encode a pertinent socio-cultural anxiety, namely an explosively growing generation gap in 1970s USA (cf. Skal 2001; Kermode 2003; King 1983). Yet it conspicuously uses strong, relatively context-independent imagery to tell the story (a diseased-looking child, the idea of a spiritual dimension as well as the mind- and body-possessing demon Pazuzu). And significantly, the film as well as the novel continue to attract and affect large audiences, even ones far removed from post-Vietnam North America.22 Another example could be given with reference to Richard Matheson’s 1951 short story “Through Channels.” The story features monsters emerging from a TV to feed on a small party. This would appear to be a metaphorical treatment of a very specific, culturally contingent anxiety derived from the sudden explosion in communication technology and the epidemic spread of TV sets in mid-century USA.23 And yet, a closer analysis of the monsters from the TV suggests that Matheson’s story is not just an interpretation of the possible effect of the developments in mass communication. Description is scant, but the monsters “was [sic] like … bugs, maybe, or maybe … w-worms. Big ones. All mouths. Wide open” (Matheson 2002, p. 57), according to a witness. Conspicuously, then, Matheson is manipulating a context-dependent anxiety, but he chooses to do so metaphorically, by presenting an abstract threat as a supernatural horde of “bugs” or “w-worms.” This, presumably, makes the story more inherently interesting (and its message more edible), and it showcases the potential of fantastic fiction as a kind of double text, one which can be read and enjoyed metaphorically as well as literally. And the fact that Matheson chooses murderous bugs or giant worms as embodiments of this particular evil is testament, again, to the ubiquity of dangerous and tweaked animals in horror fiction, as well as an innate fear of predation which is capitalized upon by scary stories. Horror stories vary within a narrow range because they are designed to target the human mind in specific ways. The human mind, in turn, is designed in a specific, species-typical way by a process of adaptation, and consequently, there are only so many effective strategies and monsters available to horror-mongers. The basic scientific theories and findings necessary to a Darwinian theory of horror fiction are out there, but they have not been applied to horror fiction in a sustained, systematic way: the efforts to construct a consilient theory of horror fiction thus far are in the main brief and 22 The 2001 re-release of The Exorcist draw large audiences around the world: “The Exorcist (1973) – Box office/business,” 6 November 2009: , and Blatty’s 1971 novel has never been out of print. 23 According to one historian, the number of TV sets in North America rose from 500,000 in 1948 to 19,000,000 in 1952 (Halberstam 1993, pp. 185, 195).

356

Mathias Clasen

scattered, even as they are often very intelligent.24 The trick is going to be to construct a biocultural horror theory that engages rigorously with scientific evidence and empirical aspects, and at the same time keeping in view the complexity and richness of its material, that is, the horrifying cinema and literature that so many of us enjoy.

References Anon., “Review of Dracula by Bram Stoker,” in: The Daily Mail (1 June 1897), in: Bram Stoker, Dracula, ed. by Nina Auerbach and David J. Skal. New York: W. W. Norton, 1997, pp. 363–364. Atran, Scott / Ara Norenzayan, “Religion’s Evolutionary Landscape: Counterintuition, Commitment, Compassion, Communion,” in: Behavioral and Brain Sciences 27.6 (2004), pp. 713–770. Bachman, Richard, Thinner, London: New English Library, 1992. Bannerman, R. L. / M. Milders / B. de Gelder / A. Sahraie, “Orienting to Threat: Faster Localization of Fearful Facial Expressions and Body Postures Revealed by Saccadic Eye Movements,” in: Proceedings of the Royal Society B 726.1662 (2009), pp. 1635– 1641. Barber, Paul, Vampires, Burial, and Death, New Haven, CT: Yale UP, 1988. Barker, Clive, “Coming to Grief,” in: Prime Evil, ed. by Douglas E. Winter, New York: Signet/New American Library, 1989, pp. 101–127. Barrett, H. Clark, “Adaptations to Predators and Prey,” in: The Handbook of Evolutionary Psychology, ed. by David M. Buss, New York: John Wiley & Sons, 2005, pp. 200–223. Barrett, Justin L., Why Would Anyone Believe in God?, Walnut Creek, CA: Altamira Press, 2004. Beecher, Donald, “Suspense,” in: Philosophy and Literature 31.2 (2007), pp. 255–279. Blatty, William Peter, The Exorcist, New York: Harper Paperbacks, 1994. Botting, Fred, Gothic, London: Routledge, 1996. Boyd, Brian, “Evolutionary Theories of Art,” in: The Literary Animal, ed. by Jonathan Gottschall and D. S. Wilson, Evanston, IL: Northwestern UP, 2005, pp. 147–176 (= 2005a). –, “Literature and Evolution: A Bio-Cultural Approach,” in: Philosophy and Literature 29.1 (2005), pp. 1–23 (= 2005b). Boyer, Pascal, Religion Explained, London: Vintage, 2002. Bradbury, Ray, “The Fog Horn,” in: American Supernatural Tales, ed. by S. T. Joshi, London: Penguin Books, 2007, pp. 241–249. Cantor, Joanna / Mary Beth Oliver, “Developmental Differences in Responses to Horror,” in: The Horror Film, ed. by Stephen Prince, New Brunswick, NJ: Rutgers UP, 2004, pp. 224–241. Carroll, Joseph, “The Human Revolution and the Adaptive Function of Literature,” in: Philosophy and Literature 30.1 (2006), pp. 33–49. Carroll, Noël, The Philosophy of Horror, New York: Routledge, 1990. 24 Summarized in Clasen 2010.

“Can’t Sleep, Clowns Will Eat Me”

357

Clasen, Mathias, “A Conversation with Peter Straub,” in: Cemetery Dance 61 (2009), pp. 40–48. –, “The Horror! The Horror!,” in: The Evolutionary Review, ed. by J. Carroll and A. Andrews, Albany, NY: SUNY Press, 2010, pp. 112–119. Cooke, Brett, “The Promise of a Biothematics,” in: Sociobiology and the Arts, ed. by Jan Baptist Bedaux and B. Cooke, Amsterdam, Atlanta, GA: Editions Rodopi B.V., 1998, pp. 43–62. –, “On the Evolution of Interest: Cases in Serpent Art,” in: Evolution of the Psyche, ed. by David H. Rosen and Michael C. Luebbert, Westport, CT, London: Praeger, 1999, pp. 150–168. Curtis, Valerie / Adam Biran, “Dirt, Disgust, and Disease: Is Hygiene in Our Genes?,” in: Perspectives in Biology and Medicine 44.1 (2001), pp. 17–31. Darwin, Charles, The Expression of the Emotions in Man and Animals, ed. by Paul Ekman, Oxford: Oxford UP, 1998. Freud, Sigmund, “The Uncanny,” in: The Uncanny (Das Unheimliche, transl. David McLintock), New York, NY: Penguin Books, 2003, pp. 121–162. Gilmore, David D., Monsters, Philadelphia, PA: University of Philadelphia Press, 2003. Gottschall, Jonathan, “The Tree of Knowledge and Darwinian Literary Study,” in: Philosophy and Literature 27.2 (2003), pp. 255–268. Grammer, K. / B. Fink / A. P. Møller / R. Thornhill, “Darwinian Aesthetics: Sexual Selection and the Biology of Beauty,” in: Biological Reviews 78.3 (2003), pp. 385–407. Halberstam, David, The Fifties, New York: Villard Books, 1993. Irving, Washington, “The Legend of Sleepy Hollow,” in: The Sketch-Book, ed. by Susan Manning, Oxford: Oxford UP, 1998, pp. 291–320. Jackson, Shirley, The Haunting of Hill House, London: Penguin Books, 2006. James, Henry, “The Turn of the Screw,” in: The Turn of the Screw and Other Stories, ed. by T. J. Lustig, Oxford: Oxford UP, 1998, pp. 113–236. James, William, Psychology: The Briefer Course, London: Macmillan and Co., 1920. Kendrick, Walter, The Thrill of Fear, New York: Grove Weidenfeld, 1991. Kermode, Mark, The Exorcist, London: British Film Institute, 2003. King, Stephen, “The Mangler,” in: Night Shift, London: New English Library, 1979, pp. 109–131. –, Danse Macabre, New York: Berkley Books, 1983. –, It, London: New English Library, 1987. –, Christine, London: New English Library, 1990. –, Storm of the Century, New York: Pocket Books, 1999. –, Needful Things, New York: Signet, 2004. Klein, T. E. D., The Ceremonies, London: Pan Books, 1985. Leroux, Gaston, The Phantom of the Opera, New York, NY: Dorset Press, 1988. Levin, Ira, Rosemary’s Baby, New York: Penguin, 1997. Lovecraft, H. P., Supernatural Horror in Literature, New York: Dover Publications, 1973. MacDorman, K. F. / R. D. Green / C.-C. Ho / C. T. Koch, “Too Real for Comfort? Uncanny Responses to Computer Generated Faces,” in: Computers in Human Behavior 25.3 (2009), pp. 695–710.

358

Mathias Clasen

Marks, Isaac M. / Randolph M. Nesse, “Fear and Fitness: An Evolutionary Analysis of Anxiety Disorders,” in: Ethology and Sociobiology 15.5/6 (1994), pp. 247–261. Matheson, Richard, “Mad House,” in: I Am Legend, New York: Tor Books, 1997, pp. 226–260. –, “Through Channels,” in: Nightmare at 20,000 Feet, New York: Tor Books, 2002, pp. 51–58. –, “Shock Wave,” in: Button, Button: Uncanny Stories, New York: Tor Books, 2008, pp. 165–182. McCarty, Michael / Mark McLaughlin, “John Carpenter Looks Back at Halloween on its 25th Anniversary,” in: Science Fiction Weekly 9:339 (2003) [no pagination] 19 May 2006: http://www.scifi.com/sfw/issue339/interview.html. Meyer, Stephenie, Twilight, London: Atom, 2008. National Safety Council, “Odds of Death Due to Injury,” 15 December 2009: . Norenzayan, A. / S. Atran / J. Faulkner / M. Schaller, “Memory and Mystery: The Cultural Selection of Minimally Counterintuitive Narratives,” in: Cognitive Science 30.3 (2006), pp. 531–553. “The Numbers,” 2 November 2009: http://www.the-numbers.com/movies/series/ BlairWitchProject.php. Öhman, Arne, “Fear and Anxiety: Evolutionary, Cognitive, and Clinical Perspectives,” in: Handbook of Emotions, ed. by Michael Lewis and Jeannette M. Haviland-Jones, New York: Guilford Press, 2000, pp. 573–593. Öhman, Arne / Susan Mineka, “Fears, Phobias, and Preparedness: Toward an Evolved Module of Fear and Fear Learning,” in: Psychological Review 108.3 (2001), pp. 483–522. Pinker, Steven, How the Mind Works, London: Penguin Books, 1999. Poe, Edgar Allan, “The Sphinx,” in: The Complete Tales and Poems of Edgar Allan Poe, New York: Penguin Books, 1982, pp. 471–474. Quammen, David, Monster of God: The Man-Eating Predator in the Jungles of History and the Mind, New York: W. W. Norton & Company, 2004. Rakison, D. H. / J. L. Derringer, “Do infants possess an evolved spider-detection mechanism?,” in: Cognition 107 (2008), pp. 381–393. Regal, Brian, “Where Have All the Werewolves Gone: Darwinian Evolution and the Image of the Monstrous,” paper presented at the annual conference of the British Society for the History of Science, University of Leicester, 5 July 2009. Revonsuo, Antti, “The Reinterpretation of Dreams: An Evolutionary Hypothesis of the Function of Dreaming,” in: Behavioral and Brain Sciences 23.6 (2000), pp. 877–901. Rice, Anne, Interview with the Vampire, London: Futura, 1994. Saler, Benson / Charles A. Ziegler, “Dracula and Carmilla: Monsters and the Mind,” in: Philosophy and Literature 29.1 (2005), pp. 218–227. Scalise Sugiyama, Michelle, “Lions and Tigers and Bears: Predators as a Folklore Universal,” in: Anthropology and Social History: Heuristics in the Study of Literature, ed. by H. Friedrich, F. Jannidis, U. Klein, K. Mellmann, S. Metzger and M. Willems. Paderborn: Mentis, 2006, pp. 319–331. Simmons, Dan, Song of Kali, London: Orion Books, 2008.

“Can’t Sleep, Clowns Will Eat Me”

359

Skal, David J., The Monster Show, rev. ed., New York: Faber and Faber, 2001. Spignesi, Stephen J., The Complete Stephen King Encyclopedia, Chicago, IL: Contemporary Books, 1991. Steckenfinger, Shawn A. / Asif A. Ghazanfar, “Monkey Visual Behavior Falls into the Uncanny Valley,” in: PNAS 106.43 (2009), pp. 18362–18366. Stoker, Bram, Dracula, ed. by Nina Auerbach and David J. Skal, New York: W. W. Norton, 1997. Straub, Peter, Ghost Story, London: Warner Books, 1992. Sullivan, Jack, “Editor’s Foreword,” in: The Penguin Encyclopedia of Horror and the Supernatural, ed. by J. Sullivan, New York: Viking Penguin, 1986, pp. viif. Tomasello, M. / B. Hare / H. Lehmann / J. Call, “Reliance on head versus eyes in the gaze following of great apes and human infants: the cooperative eye hypothesis,” in: Journal of Human Evolution 52.3 (2007), pp. 314–320. Tooby, John / Leda Cosmides, “Does Beauty Build Adapted Minds? Toward an Evolutionary Theory of Aesthetics, Fiction and the Arts,” in: SubStance 30.1/2 (2001), pp. 6–27. Twitchell, James B., Dreadful Pleasures, New York, NY: Oxford UP, 1985. Wagner, Phyllis Cerf / Wagner Wise (eds.), Great Tales of Terror and the Supernatural, New York, NY: Modern Library/Random House, 1994. Walpole, Horace, The Castle of Otranto, ed. by W. S. Lewis, Oxford: Oxford UP, 1998. Wiater, Stanley, Dark Thoughts: On Writing, Grass Valley, CA: Underwood Books, 1997. Wilson, Edward O., Biophilia, Cambridge, MA: Harvard UP, 1984. Winston, Robert, Human Instinct, London: Bantam Books, 2002. Winter, Douglas E., “Introduction,” in: Prime Evil, ed. by Douglas E. Winter, New York: Signet/New American Library, 1989, pp. 11–21.

Filmography 30 Days of Night, dir. David Slade, Columbia Pictures, 2007. Blair Witch Project, The, dirs. Daniel Myrick and Eduardo Sánchez, Haxan Films, 1999. Cloverfield, dir. Matt Reeves, Paramount Pictures, 2008. Exorcist, The, dir. William Friedkin, Warner Bros., 1973. Friday the 13th, dir. Sean S. Cunningham, Paramount Pictures, 1980. Gremlins, dir. Joe Dante, Warner Bros., 1984. Halloween, dir. John Carpenter, Compass International/Falcon International, 1978. I Know What You Did Last Summer, dir. Jim Gillespie, Columbia Pictures, 1997. King Kong, dirs. Merian C. Cooper and Ernest B. Schoedsack, RKO Radio Pictures, 1933. Night of the Living Dead, dir. George A. Romero, Image Ten/Laurel Group, 1968. Ringu, dir. Hideo Nakata, Kadokawa Shoten, 1998. Scream, dir. Wes Craven, Dimension Films/Woods Entertainment, 1996. Simpsons, The, dir. Mark Kirkland, “Lisa’s First Word,” episode 10, season 4, 20th Century Fox, 1992. Sixth Sense, The, dir. M. Night Shyamalan. Barry Mendel Prod./Hollywood Pictures/ Spyglass Entertainment, 1999.

360

Mathias Clasen

Texas Chainsaw Massacre, The, dir. Tobe Hooper, Vortex, 1974. Tremors, dir. Ron Underwood, Universal Pictures, 1990. True Blood, dir. Alan Ball, HBO, 2008. Zombieland, dir. Ruben Fleischer, Columbia Pictures, 2009.

„Wir nehmen nicht wahr, wofür wir keine Sensoren haben.“

361

„Wir nehmen nicht wahr, wofür wir keine Sensoren haben.“ Zur Evolution der Geschichte in fiktionaler Literatur Stephanie Catani

Am 7. Januar 1788 verteidigt sich Friedrich Schiller in einem Brief an Gottfried Körner gegen dessen Kritik an der vermeintlich „prosaischen“ historiografischen Tätigkeit Schillers, indem er seinen Begriff einer „schöpferischen“ Geschichtsschreibung darlegt: Deine Geringschätzung der Geschichte kommt mir unbillig vor. Allerdings ist sie willkührlich, voll Lücken und oft sehr unfruchtbar, aber eben das willkührliche in ihr könnte einen philosophischen Geist reitzen, sie zu b e h e r r s c h e n; das leere und unfruchtbare einen schöpferischen Kopf herausfordern, sie zu befruchten und auf dieses Gerippe Nerven und Muskeln zu tragen. (Schiller 1979, S. 2)1

Indem Schiller die Geschichte hier anthropomorphisiert und in das Zeichensystem des menschlichen Körpers übersetzt, macht er ihren prozesshaften, im Verlauf subjektiven Beeinflussungen ausgesetzten Status sichtbar. Geschichte lässt sich mit Schiller nicht als in sich abgeschlossene, linear nachvollziehbare Faktensammlung begreifen, sondern liefert lediglich ein körperloses „Gerippe“, das erst durch den Schöpfungsakt des Historiografen wie des Dichters zum funktionstüchtigen Körper avanciert. Die Literatur- wie Geschichtswissenschaft der letzten Jahre hat die lange Zeit marginalisierte Tätigkeit Schillers als Historiker und Historiograf hervorgehoben, die nun als „entscheidender Schritt in die historiographische Moderne“ (Fulda 2006, S. 135) gewertet wurde (vgl. Prüfer 2003). Denn die Schiller’sche Erkenntnis, dass der historiografische Prozess immer auch ein sinnstiftender ist, reflektiert zum einen bereits den per se polyvalenten Geschichtsbegriff, der sowohl den Kollektivsingular „Geschichte“ als Verdichtung einzelner historischer Ereignisse, die res gestae, wie auch deren nachträgliche Repräsentation, die historia rerum gestarum, meint (vgl. Rüsen 2003, S. 113). Zum anderen antizipiert die bei Schiller formulierte Einsicht, dass dem Weg von den historischen Fakten zur narrativen Repräsentation dieser Fakten ein genuine Unzuverlässigkeit eingeschrieben ist, Resultate des linguistic turn im 20. Jahrhundert, der den Wirklichkeitsbegriff als erst sprach1

Vgl. zu Körners Kritik insbesondere dessen Brief vom 13. Januar 1788.

362

Stephanie Catani

lich repräsentiertes und damit performativ erzeugtes Phänomen begreift. Schillers Modernität, so ist inzwischen herausgestellt worden, liegt mithin darin begründet, die Narrativität der Geschichte von Beginn an reflektiert und den Konstruktionsprozess, dem sie mit ihrer Versprachlichung zugleich unterworfen ist, thematisiert zu haben: „[…] das entschiedene Bekenntnis zur Konstruktivität jeder Historiographie nach Maßgabe des jeweiligen Perspektivpunkts stellt eine epochale geschichtstheoretische Leistung speziell Schillers dar.“ (Fulda 2006, S. 144). Die Geschichtswissenschaft der Gegenwart, allen voran die Geschichtsschreibung, zeigt sich unmittelbar betroffen von der bereits bei Schiller angedeuteten Spannung zwischen vordiskursiver, empirischer Wirklichkeit und wirklichkeitsgenerierender Fiktionalisierung, beruht ihr Selbstverständnis doch auf vermeintlichen Fakten, während sie gleichzeitig auf deren narrative Repräsentation angewiesen bleibt. Wie – so lautet die daraus resultierende geschichtstheoretische Fragestellung – lässt sich auf eine Vergangenheit beziehen, die als objektives Faktum und unabhängig von der Gegenwart, die sich auf sie bezieht, nicht zu rekonstruieren ist? Es ist merkwürdig mit der Vergangenheit. Sie ist vergangen und doch gegenwärtig. Was geschehen ist, ist geschehen und doch können wir uns dabei nicht beruhigen. Immer wieder neu wird sie vergegenwärtigt, gedeutet, umgedeutet, angeeignet, abgestoßen, entfernt, in die Nähe gerückt, vergöttert, verteufelt, verdinglicht, verflüssigt. (Rüsen 2003, S. 17)

Spätestens mit der poststrukturalistischen Erkenntnis, dass eine der Sprache vorgängige Geschichte nur schwer zu haben ist, sind Geschichte und Vergangenheit unsicher geworden und rückt die historische Narration, mithin die Figur des Historikers als Interpret, in das Zentrum geschichtstheoretischen Bewusstseins: In other words, our understanding of past reality is not through its accurate representation as a justified and propositional written rendition of that thing that once was, but is the result of negotiation of what it might mean through its pre-existing narrative meanings that are open to us now. History is not determined by ‚the past‘ but is a far more complex process of over-determination that implicates the historian as its centre. (Munslow 2003, S. 139)2

I. Evolution – Narration – Geschichte Dass genau hier, im Schwellenraum von historischen Fakten und historiografischem Erzählen, eine Anknüpfung an evolutionstheoretische Thesen fruchtbar gemacht werden kann, ist weder Historikern noch Evolutionstheoretikern verborgen geblieben – wenngleich die interdisziplinäre Diskussion vorrangig auf den nordamerikanischen Raum beschränkt bleibt. Der bereits 2

Vgl. hierzu auch Goertz 2001.

„Wir nehmen nicht wahr, wofür wir keine Sensoren haben.“

363

1992 erschienene Sammelband History and Evolution vereint entsprechend Tagungsbeiträge von Geistes- wie Naturwissenschaftlern, die mit der Überzeugung aufzuräumen suchen, dass eine naturwissenschaftlich ausgerichtete Evolutionstheorie und die Geschichtswissenschaft „distinctly separate disciplines“ (Nitecki und Nitecki 1992, S. vii) seien. Als für die hier folgenden Überlegungen aufschlussreich stellt sich insbesondere der Beitrag des Wissenschafts- und Medizinhistorikers Robert J. Richards dar, der die narrative Struktur sowohl historiografischer wie evolutionstheoretischer Texte untersucht und herausstellt, dass beide den Zugang zu einem vergangenen Geschehen bzw. zu historischen Entwicklungslinien erst über eine Perspektive erlauben, die diesem Geschehen zwangsläufig nachgelagert und unweigerlich den Selektionsverfahren desjenigen ausgeliefert ist, der erzählt: First, the historian’s and biologist’s knowledge, ideas, categories, interests, and techniques are formed in the present; only from the present can one regressively move back in time to narrate past events, but always from the perspective of the knowledge, categories, and so on that stand in the future of those events […] Second, the past contains an infinity of events; but to tell a coherent story, the historian, or evolutionary biologist, must select among them. (Richards 1992, S. 29f.)

Mit dem Stichwort der Selektion spricht Richards nicht nur ein Merkmal narrativer Repräsentation an, sondern nennt zugleich einen zentralen Begriff der Evolutionstheorie selbst, dessen Bedeutung für ein historiografisches Erzählen in jüngerer Zeit Karl Eibl herausgestellt hat (vgl. Eibl 2004). Im Folgenden werde ich mit Eibl den Begriff der Selektion als zentrales Schlagwort der biologischen Evolutionstheorie aufgreifen und als Bezeichnung für jenen Filter verstehen, durch den „jede Entwicklung hindurchgegangen ist, gleichgültig, wie dieser Filter jeweils gestaltet war“ (Eibl 2004, S. 36f.). Geschichte lässt sich vor diesem Hintergrund als Resultat eines im weitesten Sinne evolutionären Prozesses begreifen, der spezifischen Selektions- und Modulationsverfahren im Modus der Narration unterworfen ist: Man kann sagen: Auch für Narrationen gilt das Gesetz von Mutation und Selektion. Narrationen müssen sich ändern können, damit sie durch Selektion angepasst werden können; und sie müssen bei aller Veränderung doch mit sich selbst identisch bleiben können. (Eibl 2004, S. 260)

Die vermeintliche Rekonstruktion historischer Fakten versteht sich damit als die Konstruktion einer historischen Wahrheit, die von den Implikationen jener Gegenwart, die sie schöpft, nicht freizusprechen ist. In der Erkenntnis, dass das Gesetz von Mutation und Selektion auch für die historische Narration gilt und diese als Verfahren der Anpassung zu verstehen ist, liegt die besondere Herausforderung der Geschichtswissenschaft begründet. Diese muss sich der Unzuverlässigkeit der Quellen, auf die sich beruft, stellen – zugleich aber auch das eigene historiografische Arbeiten selbstkritisch durchleuchten. Wo die historischen Fakten vom Modus ihrer Repräsentation, der historischen Narration, abhängig sind, wird die quellenkritische Auseinander-

364

Stephanie Catani

setzung mit genau dieser zur existenziellen und zugleich äußerst problematischen Aufgabe der Geschichtswissenschaft: Die grundsätzliche Unzuverlässigkeit ‚objektiver‘ historischer Narration ist den Fachhistorikern vertraut. Deshalb betreiben sie ja Quellenkritik. Nur der Erweiterung des Gedankens auf ihre eigene Geschichtsproduktion begegnen sie manchmal mit Abwehrreflexen. Die Unzuverlässigkeit ist die Kehrseite der immensen Anpassungsleistung unserer Erzählungen. (Eibl 2004, S. 259)

Eibl formuliert hier aus, was der Neurowissenschaftler Wolf Singer im Rahmen seines Eröffnungsvortrags des 43. Deutschen Historikertages 2000 in Aachen anzudeuten versucht hat. In seinem Vortrag lässt Singer sich von der Frage leiten, mit welchem Recht nun gerade ein Vertreter der Hirnforschung zu Themen der Geschichtswissenschaft Stellung beziehen könne und findet, ebenso wie Eibl, eine Antwort im Bereich der Quellenkritik: Was also ist das Besondere an der Geschichtswissenschaft, das die Einmischung der Hirnforschung rechtfertigen könnte. Ich vermute, daß es in den Quellen zu suchen ist, aus denen die Geschichtswissenschaft schöpft. […] Gemeint sind […] die Zeugnisse, die bereits ihrerseits Ergebnis menschlicher Wahrnehmung, Erinnerung und Deutung sind, – die in Bild- und Schriftsprache formulierten Berichte über Vorgefallenes, die Protokolle von Dabeigewesenen, die in Schriften und Bildern festgehaltenen Erinnerungen von Augenzeugen und schließlich die weitererzählten, die zunächst mündlich überlieferten und dann irgendwann festgehaltenen Berichte, die von Menschen verfaßt wurden, die selbst nicht dabei waren. (Singer 2001, S. 18f.)

Indem Singer die Quellen der Geschichte als Produkte menschlicher Wahrnehmung zum einen und individueller wie kollektiver Erinnerungen zum anderen begreift, entlarvt er sie zugleich auch als Resultat „kognitiver Prozesse in unserem Gehirn“ (Singer 2001, S. 20). Diese der Geschichte zugrunde liegenden und evolutionär begründeten Wahrnehmungs- und Erinnerungsresultate aber seien – so Singer – sicherlich nicht dadurch definiert, dass sie eine möglichst wahrheitsgetreue, objektive Darstellung der Wirklichkeit abgeben, sondern liefern vielmehr eine Konstruktion der Realität, die an das, was wirklich war, nicht zwangsläufig gekoppelt sein muss: Unsere Sinnessysteme wählen aus dem breiten Spektrum der im Prinzip bewertbaren Signale aus der Umwelt einige ganz wenige aus und dabei natürlich solche, die für das Überleben in einer komplexen Welt besonders dienlich sind. Aus diesem wenigen wird dann ein kohärentes Bild der Welt konstruiert und unsere Primärwahrnehmung läßt uns glauben, dies sei alles, was da ist. Wir nehmen nicht wahr, wofür wir keine Sensoren haben, und ergänzen die Lücken durch Konstruktionen. (Singer 2001, S. 20)

Mit Singer lässt sich Geschichte als evolutionärer Prozess begreifen, der nicht allein durch das vergangene Geschehen definiert wird, auf das er sich zu beziehen vorgibt, sondern der auch die Subjektivität menschlicher Wahrnehmungsleistungen, die ihn erst ermöglichen, nicht verschweigt. Geschichte hat demnach die charakteristischen Eigenschaften eines selbstreferentiellen, ja vielleicht sogar evolutionären Prozesses, in dem alles untrennbar mit-

„Wir nehmen nicht wahr, wofür wir keine Sensoren haben.“

365

einander verwoben ist und sich gegenseitig beeinflußt, was die Akteure des Systems, in unserem Fall die Menschen, hervorbringen – ihre Taten, Wahrnehmungen, Erinnerungen, Empfindungen, Schlußfolgerungen und Bewertungen – und natürlich auch die Geschichten, die sie unwissentlich fortwährend erfinden. (Singer 2001, S. 27)

Im Folgenden soll gezeigt werden, dass insbesondere das Feld der fiktionalen Literatur jenen medialen Schauplatz vergegenwärtigt, auf dem der „evolutionäre Prozess“ der Geschichte sowie die damit verknüpfte Konkurrenz von Fakten und Fiktionen, von historischer Wirklichkeit und fiktionaler Wahrheit selbstreflexiv verhandelt werden – allen voran in Texten der Gegenwartsliteratur, die sich auf vermeintlich historische Fakten zu berufen scheinen und in die Nähe des Historischen Romans rücken. Ausgehend von Wilhelms Hauffs Roman Lichtenstein (1826)3, gewissermaßen einem deutschsprachigen Gründungstext des Historischen Romans, soll zunächst kurz die Gattung in ihren Anfängen und damit zu einer Zeit beleuchtet werden, die durch das Bestreben des Historismus um möglichst objektive Erkenntnis geprägt ist. Mit dem Zweifel an dieser Art von Erkenntnis in der Moderne ändert sich auch die literarische Narration der Geschichte und unterliegt schließlich signifikanten Umgestaltungen im Verlauf der Literaturgeschichte. Die Analyse eines Textes der jüngsten Gegenwartsliteratur, Felicitas Hoppes Johanna (2006), kann in diesem Zusammenhang zeigen, wie entscheidend sich Form und Funktion historisch-fiktionalen Erzählens mit dem Wissen um die rhetorische Verfasstheit der Geschichte gewandelt haben. Die Einsicht in die Evolution der Geschichte und die Selektionsverfahren, denen jede historische Narration unterliegt, erweist sich – so die These – mit Blick auf die Literatur des 21. Jahrhunderts als entscheidende metafiktionale und zugleich poetologische Aussage historisch-fiktionalen Erzählens.

II. Im Dienst der „Historischen Wahrheit“: Wilhelm Hauffs Lichtenstein (1826) Mit Hugo Aust lässt sich Wilhelm Hauffs Roman Lichtenstein als „spezifisch deutscher Auftakt“ des historischen Romans im Anschluss an die großen Erfolge des Schotten Walter Scott und als exemplarisches Initial einer Gattung begreifen, die einerseits zu großen Publikumserfolgen im 19. Jahrhundert führte, andererseits zum Gegenstand nachhaltiger literarischer wie literaturwissenschaftlicher Kritik avancierte (vgl. Aust 1994, S. 80). Der Roman ver3

Wilhelm Hauff, Sämtliche Werke in drei Bänden, nach den Originaldrucken und Handschriften, Textredaktion und Anmerkungen von Sybille von Steinsdorff, mit einem Nachwort und einer Zeittafel (in Band III) von Helmut Koopmann. Bd. 1: Romane, München: Winkler, 1970. Nach dieser Ausgabe werden im Folgenden die Zitate mit Seitenangaben direkt im Text nachgewiesen.

366

Stephanie Catani

webt die romantische Liebesgeschichte zweier fiktionaler Figuren mit historischen Ereignissen: den kriegerischen Auseinandersetzungen zwischen Herzog Ulrich von Württemberg und dem Schwäbischen Bund im Jahr 1519. Bereits der Untertitel „Romantische Sage aus der württembergischen Geschichte“ verortet den Text im Spannungsfeld von Fiktionalität und historischen Fakten – einem Grenzbereich, dem der Text insgesamt nicht zu entkommen scheint, den er letztlich jedoch aufzulösen versucht, indem die historische Authentizität des fiktionalen Geschehens behauptet wird. Exemplarisch vergegenwärtigt der Roman damit die von Claudia Stockinger nachgezeichnete „Engführung historiographischer und poetischer Funktionszusammenhänge in der ersten Hälfte des 19. Jahrhunderts“ und zeichnet sich durch ein poetisch-historiografisches Erzählverfahren aus, das romantische wie realistische Anteile gleichermaßen beinhaltet (vgl. Stockinger 2005, S. 52f.). Die Verantwortung einer vermeintlich historischen Wahrheit gegenüber äußert sich im Text allerdings gerade nicht darin, das historische Geschehen den Quellen analog zu erzählen, sondern vielmehr darin, die bisherige Geschichtsschreibung in ihren Schwächen zu überführen und einen „besseren“ Gegenentwurf zu liefern, der insbesondere die Figur Ulrichs betrifft. Insofern ist Stefan Neuhaus zuzustimmen, wenn er feststellt: „Geschichte wird in diesem Roman nicht rekonstruiert, sondern mit Versatzstücken aus der württembergischen Landesgeschichte neu konstruiert“ (Neuhaus 2002, S. 158).4 Bereits in seiner formalen Struktur macht der Roman dieses Selbstverständnis sichtbar, etwa durch seine paratextuellen Signaturen: Neben dem für den frühen historischen Roman typischen Erzählervorwort (vgl. Aust 1994, S. 26), das in die behandelte Historie einführt, finden sich in Fußnoten zum Text Anmerkungen, die mit Detailinformationen zum historischen Hintergrund versorgen (342–347). Die vermeintlich historische Wahrheit wird hier noch als Referenzrahmen des literarischen Textes vorausgesetzt, auf den konsequent Bezug genommen wird. So wird die Person Ulrich von Württembergs explizit nicht als literarische Figur eingeführt, sondern als historische kenntlich gemacht, wenn es in der ersten Anmerkung zur Handlung des Romans heißt: Ulrich von Württemberg, geb. 1487, wurde 1498 in seinem eilften Jahre als Herzog belehnt mit einer Mitregentschaft, welche in seinem sechszehnten Jahr aufgehoben wurde und Ulerich von 1503 an allein regiert. Er starb im Jahr 1550. (342)

4

Ist Neuhaus zuzustimmen, wenn er dem Roman eine Wirkungsabsicht zuspricht, die darauf abzielt, „durch Reflexion einen Erkenntnisgewinn aus dem Gelesenen zu erzielen“ (Neuhaus 2002, S. 158), lässt sich die vermeintliche Dekonstruktion der Herrscherfigur Ulrichs, die Neuhaus zu erkennen glaubt, mit Blick auf die der fiktionalen Handlung eingeschriebenen Rehabilitierungstendenzen die historische Figur betreffend meines Erachtens nur schwerlich halten.

„Wir nehmen nicht wahr, wofür wir keine Sensoren haben.“

367

Der Erzähler stellt den literarischen Text in den Dienst der Geschichte wie der Geschichtsschreibung und misst an der intendierten historischen Erkenntnis seinen Wert. Umso mehr erstaunt es, dass Hauff seinem Roman ausgerechnet ein Zitat aus dem Schiller’schen Wallenstein-Prolog voranstellt: Von der Parteien Gunst und Haß verwirrt Schwankt sein Charakterbild in der Geschichte Doch euren Augen soll ihn jetzt die Kunst Auch Euren Herzen menschlich näher bringen. (7)5

Hauff, der mit Schiller sein Vorgehen zu legitimieren sucht, die literarische Inszenierung als Instrument der Geschichtsvermittlung einzusetzen, unterschlägt dabei, dass Schiller in seinem Wallenstein-Prolog den Begriff der historischen Wirklichkeit in Bezug auf seine Dramen deutlich problematisiert hatte – so jedenfalls legt es der bei Hauff ausgesparte Schluss des Schiller’schen Prologs nahe, der selbstreflexiv die ästhetisch inszenierte historische Wahrheit bereits vorab als Täuschung entlarvt: Und wenn die Muse heut, Des Tanzes freie Göttin und Gesangs, Ihr altes deutsches Recht, des Reimes Spiel, Bescheiden wieder fordert – tadelts nicht! Ja, danket ihrs, daß sie das düstre Bild Der Wahrheit in das heitre Reich der Kunst Hinüberspielt, die Täuschung, die sie schafft, Aufrichtig selbst zerstört und ihren Schein Der Wahrheit nicht betrüglich unterschiebt, Ernst ist das Leben, heiter die Kunst. (Schiller 2004, S. 274)

Damit schreibt Schiller seiner Wallenstein-Trilogie eine metafiktionale Problematisierung ein, die das Spannungsfeld von Geschichte und Literatur gerade nicht zugunsten der historischen Fakten auflöst, sondern die fiktive Wirklichkeit des Dargestellten und damit die Autonomie des literarischen Textes behauptet. Hauff aber legitimiert, im Gegensatz zu Schiller, die literarische Fiktion durch den Verweis auf die historischen Fakten, begreift seinen Roman als Instrument einer Geschichtsschreibung und sucht das Dargestellte aufzuwerten, indem er die historische Verbürgtheit der fiktionalen Handlung auszustellen sucht. Deutlich wird dies durch die häufigen auktorialen Einschübe, in denen der Erzähler seine Quellen offenlegt, etwa wenn er die historische Authentizität eines dargestellten Abendtanzes zu beweisen sucht: Wir waren nämlich in vorliegender Historie bis an dieses Kapitel gekommen, das […] von einem Abendtanze handeln soll; da fiel uns mit einem Male der Gedanke schwer aufs Herz, daß wir ja nicht einmal wissen, wie und was man in jenen Zeiten getanzt habe. […] In dieser Verlegenheit stießen wir auf das sehr selten gewordene Buch: ‚Vom Anfang, Ursprung und Herkommen der Turniere im heiligen römischen Reich. Frankfurt 1564.‘ Wir fanden in diesem teuren Folianten, unter andern 5

Vgl. Schiller 2004, S. 273.

368

Stephanie Catani

trefflichen Holzschnitten einige, die einen solchen Abendtanz vorstellten, wie er zu Zeiten Kaiser Maximilians, etwa ein Jahr vor dieser Historie, gehalten wurde. (47)

Dabei unterschlägt der Erzähler zwar keineswegs die subjektiven Einflüsse, denen die historischen Fakten in der narrativen Retrospektive unterliegen – diese werden jedoch nicht als eine dem Geschichtsbegriff inhärente Problematik aufgefasst, sondern als Fehler einer nicht sachgerechten Geschichtsschreibung gewertet, den es in der Folge auszumerzen gilt. Dadurch verschwinden die Grenzen zwischen literarischem Text und historischem Geschehen sukzessive: Entsprechend verteidigt der Erzähler im Vorwort den literarischen Text nicht nur als Pendant zu, sondern gar als Korrektiv einer Geschichtsschreibung, die bisher – so jedenfalls wird unterstellt – die Figur Ulerichs von Württembergs dämonisiert und an den Fakten vorbei interpretiert habe. Und doch möchte es die Frage sein, ob man nicht in Beurteilung dieses Fürsten nur seinem erbittertsten Feinde Ulerich von Hutten nachbetet, der, um wenig zu sagen, hier allzusehr Partei ist, um als leidenschaftsloser Zeuge gelten zu können […] Wir haben fast alle gleichzeitige Schriftsteller, die Stimmen eines längstvergangenen, vielbewegten Jahrhunderts gewissenhaft verglichen und fanden keinen, der ihn geradehin verdammt. (8)

Die res gestae bleiben hier der empirisch nachweisbare Referenzbereich, der als linear nachzuvollziehendes Geschehen der Vergangenheit möglichst „wahrheitsgetreu“ zu rekonstruieren ist. Verfahren der Selektion und Interpretation, denen die Geschichte im Laufe ihres evolutionären Prozesses, der nicht zuletzt ein sprachlicher ist, unterworfen bleibt, werden ausgeblendet bzw. als korrigierbar begriffen. Hauffs Text entwickelt damit eine Geschichtsauffassung, die sich deutlich von den Überlegungen Leopold von Rankes beeinflusst zeigt, der 1824 seine Geschichten der romanischen und germanischen Völker veröffentlicht und darin für eine historische Methode plädiert hatte, die der unparteiischen Aufdeckung objektiver Realitäten dient: Man hat der Historie das Amt, die Vergangenheit zu richten, die Mitwelt zum Nutzen zukünftiger Jahre zu belehren, beigemessen: so hoher Aemter unterwindet sich gegenwärtiger Versuch nicht: er will blos zeigen, wie es eigentlich gewesen. (Ranke 1824, S. Vf.)

Hauff erweist sich als Zeitgenosse Rankes, wenn er die Einleitung zu seinem historischen Roman mit einer klaren Zielsetzung beschließt, welche die spezifischen Signaturen des literarischen Textes dem Postulat objektiv-historischer Genauigkeit unterordnet: […] darum haben auch wir gewagt, ein historisches Tableau zu entrollen, das, wenn es auch nicht jene kühnen Umrisse der Gestalten, jenen zauberischen Schmelz der Landschaft aufweist, und wenn das an solche Herrlichkeiten gewöhnte Auge umsonst die süße, bequeme Magie der Hexerei und den von Zigeunerhand geschürzten Schicksalsknoten darin sucht, ja wenn sogar unsere Farben matt, unser Crayon

„Wir nehmen nicht wahr, wofür wir keine Sensoren haben.“

369

stumpf erscheint, doch eines zur Entschuldigung für sich haben möchte, ich meine die historische Wahrheit. (12)

Dass die dem Roman eingeschriebene Intention, eine neue historische Interpretation vorzuschlagen, ihr Ziel nicht verfehlt hat, belegt die Rezeption des Romans im 19. Jahrhundert, die seine geschichtsbildende Wirkung dokumentiert: So schreiben historische Auseinandersetzungen mit der Burg Lichtenstein im Anschluss an die Romanveröffentlichung den von Hauff beschriebenen Aufenthalts des Herzogs Ullrichs auf Lichtenstein der Landesgeschichte als Faktum ein (vgl. Gratianus 1844, S. 43; Potthast 2007, S. 116f.). Max Schuster, der 1904 seine äußerst kritische Studie zum „geschichtlichen Kern“ des Romans veröffentlichte, problematisiert die Grenzauflösung zwischen Fakten und Fiktion, wenn er Lichtenstein eine „geschichtsbildende Macht“ zuspricht, die „bis weit in die Kreise der Gebildeten die Geltung von historischen Tatsachen“ (Schuster 1904, S. 9) einnehme.

III. Die Unzuverlässigkeit der Geschichte: Felicitas Hoppes Johanna (2006) Die im frühen historischen Roman noch intendierte „historische Wahrheit“ ist inzwischen nicht nur als Referenzwelt literarischer Texte, sondern auch als unzuverlässiger Bezugspunkt für die Geschichtsschreibung, wie einleitend skizziert, problematisiert worden. Der explizite Gattungsbegriff des Historischen Romans wird heute von Autoren häufig gemieden und taucht vorrangig auf Buchcovern sogenannter Unterhaltungs- und Trivialliteratur auf – dennoch fällt mit Blick auf die Gegenwartsliteratur die ungebrochene Tradition eines fiktionalen historischen Erzählens auf: ablesbar insbesondere an zahlreichen literarischen Erinnerungstexten, in denen die historischen wie politischen Zäsuren deutscher Vergangenheit eingefangen werden. Aber auch Texte jenseits dieser sogenannten Erinnerungsliteratur offenbaren immer wieder ein auffallendes Interesse an historischen Figuren und Stoffen, etwa Antje Rávic Strubels Tupolew 134 (2004), Daniel Kehlmanns Die Vermessung der Welt (2005), Felicitas Hoppes Verbrecher und Versager (2004), Ilija Trojanows Der Weltensammler (2006), Michael Lentz’ Pazifik Exil (2007), Marcel Beyers Kaltenburg (2008) oder Uwe Timms jüngster Roman Halbschatten (2008). Die einleitend skizzierte „Unsicherheit der Geschichte“ verschweigen diese Texte gerade nicht, sondern schreiben sie dem eigenen Erzählen vielmehr offensiv ein. Dabei verhandeln sie bereits jene durch den linguistic turn ausgelösten und durch neurowissenschaftliche wie evolutionspsychologische Forschungsergebnisse intensivierten Diskussionen um die Zuverlässigkeit historischer Repräsentationsverfahren. Diese Verfahren lassen sich von den

370

Stephanie Catani

kognitiven Prozessen in unserem Gehirn, die sie hervorbringen, nicht trennen. Noch einmal mit Wolf Singer: Unser Gehirn wiederum ist Ergebnis eines evolutionären Prozesses, der über zufällige Mutationen und Wettbewerb Strukturen hervorgebracht hat, die sich in ihrem jeweiligen Biotop behaupten konnten. Dies macht zwar wahrscheinlich, daß sich dabei kognitive Systeme herausgebildet haben, die Vorgänge in der Welt draußen möglichst genau zu erfassen erlauben, es ist jedoch keine Garantie dafür, daß die Systeme daraufhin optimiert wurden, eine möglichst objektive Beurteilung der Welt zu liefern. (Singer 2001, S. 20)

Die hier problematisierten, für die „Evolution der Geschichte“ äußerst relevanten Wahrnehmungsprozesse, denen der wirklichkeits- und sinnstiftende historiografische Konstruktionsprozess unterliegt, avancieren in zahlreichen Gegenwartstexten zum eigentlichen Handlungssujet (vgl. Catani 2009). In den Vordergrund dieser historisch-fiktionalen Texten rückt damit eine metafiktionale Auseinandersetzung sowohl mit der Konstruktion (dem doing) wie der Dekonstruktion (dem undoing) der Geschichte durch fiktive Geschichten – wie im Folgenden exemplarisch am Beispiel von Felicitas Hoppes JohannaRoman6 nachvollzogen wird. In einem selbstreflexiven Beitrag über den „Umgang mit literarischen Stoffen“ entzieht Hoppe ihren Roman bereits der Gattung des Historischen Romans und definiert ihn stattdessen als „eine Art historischen Gegenwartsroman“ (Hoppe 2007, S. 63). Damit spricht sie das markanteste Merkmal ihres Textes an: Die bei Hauff noch explizit gemachte Grenzziehung zwischen historischem Geschehen und Erzählergegenwart fällt hier einer Erzählhaltung zum Opfer, die Geschichte als Resultat jener von Eibl wie Singer angesprochenen selektiven Filter und defizitären Wahrnehmungsprozesse sowie den historiografischen als evolutionären Prozess sichtbar macht. Der Roman liest sich als Beispiel jener von Linda Hutcheon bezeichneten Gattung „historiografischer Metafiktion“, die literarische Texte zu beschreiben sucht, in denen Geschichte als eine durch den Text selbst generierte Konstruktion kritisch reflektiert wird (vgl. Hutcheon 1987, S. 12; Hutcheon 1988, S. 5). Radikal wird in diesem Roman mit den Strategien des traditionellen historischen Romans gebrochen, die – wie wir am Beispiel des Hauff ’schen Textes sehen konnten – darauf angelegt waren, eine größtmögliche Nähe zwischen historischen Fakten und fiktionaler Handlung zu evozieren. Bereits der einleitende Satz: „Johanna wurde in der Dreikönigsnacht geboren“ (9) verzichtet auf die Angabe eines konkreten Datums und damit auch darauf, das dargestellte Geschehen als ein explizit vergangenes auszuweisen. Die Erzählergegenwart und die Vergangenheit der erzählten historischen Fi6

Felicitas Hoppe, Johanna. Roman, Frankfurt/M.: Fischer, 2006. Nach dieser Ausgabe werden im Folgenden die Zitate mit Seitenangaben direkt im Text nachgewiesen.

„Wir nehmen nicht wahr, wofür wir keine Sensoren haben.“

371

gur werden hier nicht, wie bei Hauff, als voneinander abgrenzbare Ereignisse ausgewiesen. Vielmehr inszeniert der Roman eine Form des Erzählens, die sich unter Rückgriff auf Ergebnisse evolutionstheoretisch begründeter Narratologie als ein, mit Eibl, „komplexer hermeneutischer Vorgang [versteht], bei dem die einzelnen Komponenten ständig in Bewegung gehalten werden, um Erzähltes und Erzählsituation einander optimal anzupassen“ (Eibl 2004, S. 259). Wie nachhaltig die hier erzählte historische Figur der Johanna im Akt ihrer Rekonstruktion der Erzählergegenwart ausgeliefert bleibt, macht der Roman durch seine formale Struktur sichtbar, die zum einen die Chronologie der erzählten Ereignisse aufbricht und zudem verschiedene Interpretationen der Geschichte anbietet, indem neben der Ich-Erzählerin zwei weitere „Johanna-Deuter“ jeweils ihre Version der Historie entwerfen. In ihrem Roman radikalisiert Hoppe die Problematisierung des Geschichtsbegriffs, indem sie mit den drei Hauptfiguren, die nicht zufällig Historiker sind, die akademisch-wissenschaftliche Aufarbeitung von Geschichte sowie das damit verknüpfte Feld der Historiografie und der Quellenkritik mit der fiktionalen Geschichtsarbeit ihres eigenen Textes kontrastiert – und die Unzuverlässigkeit beider unterstreicht. Die von Singer postulierte „Evolution der Geschichte“ mitsamt der ihr eingeschriebenen Unzuverlässigkeit wird durch die drei fiktiven Historikerfiguren – der Ich-Erzählerin, Dr. Peitsche und dem Geschichtsprofessor – sichtbar gemacht. Die Erzählstimme ist die einer jungen Ich-Erzählerin, deren mündliche Doktorprüfung unmittelbar bevorsteht, welche, wie auch die Dissertation selbst, Johanna von Orléans zum Thema hat. Das Verhältnis zwischen Erzählerin und historischer Figur ist ein ambivalentes, das zwischen subjektiver Annäherung und wissenschaftlicher Distanznahme changiert – kenntlich gemacht in einem fließenden Wechsel der verwendeten Tempi, der die historische Figur der Gegenwart der Erzählerin einschreibt und zu einer Ununterscheidbarkeit der Zeitebenen führt. In ihrem Bemühen, wissenschaftliche Distanz zum Untersuchungssujet einzunehmen, scheitert die Erzählerin konsequent und bringt stattdessen die Grenze zwischen historischen Fakten und imaginierter Fiktion, zwischen Vergangenheit und Gegenwart zum Verschwinden: Johanna brennt, und ich sitze im Hörsaal. Kann aber sein, dass auch ich gar nicht anwesend bin, auch ich bin nicht da, sondern liege neben dem Kutscher im Bett und tauche nach Kronen. Johanna brennt, und ich schlafe. (34)

Historische Fakten schleichen sich wie subjektive Erinnerungsfetzen in das Bewusstsein der Ich-Erzählerin ein und stellen – wie die Erinnerungen, denen sie ähneln – ihre genuine Unzuverlässigkeit aus.7 Machte der Erzähler in 7

Die zahlreichen erinnerungs- und gedächtnistheoretischen Untersuchungen innerhalb der Neuro- wie der Kulturwissenschaften haben die Selektions- und Mutationsverfahren identi-

372

Stephanie Catani

Hauffs historischem Roman den Abstand zum Erzählten und auch den eigenen Erkenntnisvorsprung durch auktoriale Einschübe konsequent sichtbar, fehlt es der Ich-Erzählerin hier nicht nur an wissenschaftlicher, sondern auch an emotionaler Überlegenheit der erzählten Figur gegenüber. Die Erzählermonologe avancieren zu ständigen Dialogen mit Johanna, die den Konflikt zwischen Erzählerin und historischer Figur vergegenwärtigen: Johanna. Prahlhans. Aufschneider Gottes. Hast du wirklich geglaubt, du bist seine Tochter? Die Schwester von Jesus? Die Retterin Frankreichs? Die Jungfrau Maria? […] Und wie du dich aufbläst, bis über die Ohren, immer reitend und himmelwärts. (39)

Als fast promovierte Historikern scheint die Erzählerin einer wissenschaftlichen, um historische Präzision und fundierte Quellenkritik bemühten Auseinandersetzung mit Johanna verpflichtet und scheitert an eben diesem Anspruch – auch, weil das Vertrauen in die eigenen Forschungsmethoden fehlt: „Die Forschung ist ewig, sie kommt an kein Ende, sie einigt sich nie. Nicht auf Zahlen und Daten und auch nicht auf Namen.“ (81). Resultat dieser um die Unzuverlässigkeit der Fakten wissenden geschichtswissenschaftlichen Arbeit sind keine Antworten, sondern lediglich Fragen, die an die historische Figur gerichtet werden – und die bereits bei dem „richtigen“ Namen beginnen: Jeanne. Jehanne. Johanna d’Arc. Oder Darc oder Dart? Von mir aus auch Tarc oder Tart oder Day. Oder Jane oder Jan. Warum nicht schlicht und ergreifend DIE JUNGFRAU? (81)

Erschwert wird der Zugang der Ich-Erzählerin zur historischen Figur durch die konkurrierenden Perspektiven zweier Männer, die ihr unterschiedliche Versionen Johannas und zugleich alternative Methoden der wissenschaftlichen Arbeit anbieten: auf der einen Seite der Professor, Doktorvater und „habilitierte Krönungsexperte“, auf der anderen Seite Dr. Peitsche, promovierter Historiker und selbsternannter Johanna-Experte. Die Figur des Professors vergegenwärtigt einen aufgeklärten Quellenpositivismus: Was nicht belegt ist, wird nicht geglaubt und entbehrt damit jeder historischen Grundlage. Entsprechend distanziert ist sein Verhältnis zur Figur Johannas: „Selbstverständlich nimmt er Johanna nicht ernst, denn er weiß genau, wer sie ist. Eine Fußnote in der Geschichte von Karl.“ (41). Die Fakten der Geschichte werden vom Professor nicht in Frage gestellt, lediglich die Möglichkeit, ihnen auf die Spur zu kommen: „Geduld heißt die Devise, standhaftes Zögern, beharrlich die alten Quellen aufsuchen, um zu wissen, was damals wirklich geschah, nicht selten wird man dabei überrascht.“ (73). Damit unterscheidet sich die fiktive Figur des Professors nicht allzu sehr von Hauffs Erzähler, der Zweifel an der Zuverlässigkeit der Getätsstiftender Erinnerungen herausgestellt, von denen allen voran der Geschichtsbegriff abhängig ist (vgl. Welzer 2002; Assmann 2006).

„Wir nehmen nicht wahr, wofür wir keine Sensoren haben.“

373

schichtsschreibung, nicht aber an den Fakten selbst hatte aufkommen lassen. Johanna als überfrachtete Figur, die in unzähligen Mythen, Legenden und stilisierten Heldenerzählungen ihr historisches Gewand verloren hat, weckt das Misstrauen des Geschichtsprofessors: „Reinster und schönster Aberglaube, Lotto und Toto, das betrifft auch die Jungfrau. Auf hundert falsche kommt eine echte.“ (72). Er verteidigt einen Geschichtsbegriff, der die Suche nach dem, was wirklich war, ernst nimmt, und fordert entsprechend hartnäckig eine quellenkritische Auseinandersetzung ein: Damit wir uns hier nicht missverstehen, Chroniken nacherzählen kann jeder, aber damit macht man keine neue Geschichte. Die Geschichte besteht ja nicht nur aus Geschichten, die man leichtfertig nachbeten darf, nur weil sich ein dankbares Publikum findet. Die Geschichte besteht aus Qual und Bemühung, aus Einsicht und Furcht, aus Versuch und Angst, aus Respekt und Eifer, aus Einwand und Schweiß […]. Wenig Feuer, viel Rauch, viel Eitelkeit und wenig Erkenntnis. Und jeden Morgen wieder ein Einwand. Es sei denn, Sie nehmen die Sache leicht und suchen Vergnügen. (74)

Die zweite männliche Hauptfigur, Dr. Peitsche, promovierter Historiker, begegnet als deutlicher Kontrahent des Professors – sowohl in seiner Beziehung zur Figur Johannas als auch in seinem geschichtswissenschaftlichen Selbstverständnis. Eine objektive Auseinandersetzung mit der historischen Figur scheint in seinem Fall unmöglich, denn, so jedenfalls wirft ihm der Professor vor, seine fehlende Distanz verstelle per se den wissenschaftlichen Zugang: In der Wissenschaft geht es um Aufmerksamkeit, nicht um Liebe. Gerade Sie, Spezialist aller Herzen, hätten das eigentlich wissen müssen. […] Sie haben sich hinreißen lassen, Sie haben sich auf eine Seite geschlagen, und Parteilichkeit ist das Schlimmste von allem und unverzeihlich in Ewigkeit. (74f.)

Peitsche kontert, indem er das kritische Johanna-Bild des Professors ebenfalls affektiv motiviert und seine Marginalisierung der historischen Figur als Ausdruck einer emotionalen Abwehrhaltung versteht: „Wie sehr Sie sie hassen. […] Aber das macht nichts. Die Jungfrau ist nicht auf Sie angewiesen. Johanna war allein unterwegs.“ (76). Indem der Text eine emotionale Involviertheit (Dr. Peitsche scheint verliebt, der Professor hasserfüllt, während die Ich-Erzählerin sich zu sehr identifiziert) aller drei Historikerfiguren in ihr Untersuchungssujet, der historischen Figur, nahelegt, wird ein Rezeptionsmodell vorgeführt, dass die vermeintlich wissenschaftliche Quellenaufbereitung ad absurdum führt. Zumindest Hoppes Roman besteht darauf, dass Geschichte nicht objektiv rekonstruiert, sondern höchst subjektiv erzeugt wird, sichtbar gemacht in der affektiven Bindung jeder der Historikerfiguren an die von ihnen interpretierte historische Figur. Damit steuert ihr individueller Rezeptionsvorgang den Prozess der Geschichtsschreibung und beeinflusst das Aussehen der historischen Figur maßgeblich. Der Roman problematisiert da-

374

Stephanie Catani

mit die Unzuverlässigkeit einer historischen Wahrheit, die – weil sie auf Narrationen Einzelner zu unterschiedlichen Zeiten angewiesen ist – die Signaturen (d.h. Selektions- wie Mutationsmerkmale) dieser Rezeption nicht verbergen kann.

IV. „Wie man Geschichte macht, wenn man erzählt“ Die Subjektivität des geschichtsbildenden Prozesses wird in der Figur Peitsches besonders deutlich: Dem vermeintlichen Quellenpositivismus des Professors begegnet er mit einer auf jegliche Distanz verzichtenden geschichtswissenschaftlichen Methode, die den daraus resultierenden Erkenntnisgewinn per se in Frage stellt. Peitsche – ein Wissenschaftler, der keiner ist, der seine Vorträge „flüssig und leicht und ohne Papier“ (58) hält, der „ohne Quellenangaben“ (79) zitiert, der seit Jahren nicht mehr über Johanna schreibt, nur noch über sie redet (16), und der dennoch, darin dem Professor ähnlich, auf der Suche nach der einen, unbestreitbaren und in wenige Worte fassbaren historischen Wahrheit ist. Diese Wahrheit fixiert er auf Mützen, Papiermützen, die er selbst faltet und beschriftet. Die einst im inquisitorischen Akt des Autodafés zur Stigmatisierung der Verurteilten eingesetzten Schandmützen instrumentalisiert Peitsche zu Werkzeugen historischen Erkenntnisgewinns: Jeder historischen Figur teilt er eine Mütze mit einer Aufschrift zu: wenige Worte, die die Fakten ersetzen sollen – das ist die Geschichtsarbeit Peitsches: Lange, endlose Reihen von Mützen. […] Die Mütze Karls mit der Aufschrift DER SIEBTE. Die Mützen Trémiolles mit MESSER UND GABEL. Die Leibwächtermütze von Jean d’Aulon mit der Aufschrift KEIN BLUT, die Mütze des Henkers mit der Aufschrift UM GNADE. (20)

Dass dieses „Lebenswerk“ (22) einer Besessenheit gleichkommt, die den wissenschaftlichen Erkenntnisgewinn im Ansatz verhindert, begreift schließlich auch die Ich-Erzählerin, als sie Peitsches Mützenraum betritt und kaum etwas erkennen kann: Die vor dem Fenster aufeinandergestapelten Mützen verhindern nicht nur jeden Lichteinfall – sondern zugleich jede wissenschaftliche Orientierung (vgl. 22). Die eigentliche Schwäche Dr. Peitsches liegt dabei nicht in seiner emotionalen Bindung an die historische Figur begründet, sondern darin, dieser Emotionalität zum Trotz an einer historischen Wahrheit festzuhalten, die sich auf die wenigen Worte einer Mützenaufschrift reduziert: „Natürlich, rief ich, Sie sind ja verliebt! In die klare Aufschrift, nicht mehr als drei Worte, auch von weitem gut lesbar, die perfekte Faltung.“ (47). Eine einzige, die wichtigste Mütze aber lässt sich nicht falten, lässt sich nicht beschriften: die der Johanna. Ihre Figur verweigert sich der genauen Bezeichnung und lässt sich als historische Figur nicht rekonstruieren.

„Wir nehmen nicht wahr, wofür wir keine Sensoren haben.“

375

In den konkurrierenden und sich widersprechenden Perspektiven der Ich-Erzählerin, Dr. Peitsches und des Professors vergegenwärtigen sich damit jene Filter sinnstiftender Selektion, die nicht nur die Figur Johanna von Orléans, sondern Geschichte grundsätzlich erst produzieren und ihre Zuverlässigkeit, den Kern einer „historischen Wahrheit“ damit bereits in Frage stellen. Dass die Frage „Wer war Johanna?“ keine der Romanfiguren und keine ihrer geschichtswissenschaftlichen Methoden zuverlässig zu beantworten vermag, ist die eigentliche und einzig gültige Erkenntnis der Ich-Erzählerin: „Worauf kommt es in der Geschichte an? Nicht darauf, dass man Geschichten erzählt, sondern, wie man Geschichte macht, wenn man erzählt.“ (47). Spätestens hier werden die selbstreflexiven Bezüge des Romans endgültig aufgedeckt. Der geschichtsbildende, evolutionäre Prozess, das Doing History, mündet bei Hoppe in ein Undoing History, in dem die Grenze zwischen Erkenntnisobjekt und Erkenntnissubjekt, zwischen wirklichkeitsgenerierender Fiktion und subjektiv rekonstruierten Fakten nicht mehr voneinander zu trennen sind.

Literaturverzeichnis Assmann, Aleida, Der lange Schatten der Vergangenheit. Erinnerungskultur und Geschichtspolitik, München: Beck, 2006. Aust, Hugo, Der historische Roman, Stuttgart, Weimar: Metzler, 1994. Catani, Stephanie, „Metafiktionale Geschichte(n). Zum unzuverlässigen Erzählen historischer Stoffe in der Gegenwartsliteratur“, in: Ins Fremde schreiben. Gegenwartsliteratur auf den Spuren historischer und fantastischer Entdeckungsreisen, hg. von Christof Hamann und Alexander Honold, Göttingen: Wallstein, 2009, S. 141–166. Eibl, Karl, Animal Poeta. Bausteine der biologischen Kultur- und Literaturtheorie, Paderborn: Mentis, 2004. Fulda, Daniel, „Schiller als Denker und Schreiber der Geschichte. Historische Gründungsleistung und aktuelle Geltung“, in: Friedrich Schiller. Die Realität des Idealisten, hg. von Hans Feger, Heidelberg: Winter, 2006 (Beiträge zur neueren Literaturgeschichte, Bd. 235), S. 121–150. Goertz, Hans-Jürgen, Unsichere Geschichte. Zur Theorie historischer Referentialität, Stuttgart: Reclam, 2001. Gratianus, Carl Christian, Die Ritterburg Lichtenstein, Landsitz Sr. Erlaucht des Grav Wilhelm von Wirtemberg. Vergangenheit und Gegenwart, Tübingen: Fues, 1844. Hauff, Wilhelm, Sämtliche Werke in drei Bänden, nach den Originaldrucken und Handschriften, Textredaktion und Anmerkungen von Sybille von Steinsdorff, mit einem Nachwort und einer Zeittafel (in Band III) von Helmut Koopmann. Bd. 1: Romane, München: Winkler, 1970. Hoppe, Felicitas, Johanna, Roman, Frankfurt/M.: Fischer, 2006. –, „Auge in Auge. Über den Umgang mit historischen Stoffen“, in: Neue Rundschau 118.1 (2007), S. 56–69. Hutcheon, Linda, „Beginning to theorize postmodernism“, in: Textual Practice 1.1 (1987), S. 10–31.

376

Stephanie Catani

–, A Poetics of Postmodernism. History, Theory, Fiction, New York, London: Routledge, 1988. Munslow, Alun, The new history, London: Longman, 2003. Neuhaus, Stefan, Das Spiel mit dem Leser. Wilhelm Hauff: Werk und Wirkung, Göttingen: Vandenhoeck & Ruprecht, 2002. Nitecki, Matthew H. / Doris V. Nitecki, „Preface“, in: History and Evolution, hg. von M. H. Nitecki und D. V. Nitecki, Albany: State University of New York Press, 1992, S. vii–viii. Potthast, Barbara, Die Ganzheit der Geschichte. Historische Romane im 19. Jahrhundert, Göttingen: Wallstein, 2007. Prüfer, Thomas, Die Bildung der Geschichte. Friedrich Schiller und die Anfänge der modernen Geschichtswissenschaft, Köln u. a.: Böhlau, 2003. Ranke, Leopold von, Geschichten der romanischen und germanischen Völker von 1494 bis 1535. Erster Band, Leipzig, Berlin: Reimer, 1824. Richards, Robert J., „The Structure of narrative explanation in History and Biology“ in: History and Evolution, hg. von Matthew H. Nitecki und Doris V. Nitecki, Albany: State University of New York Press, 1992, S. 19–53. Rüsen, Jörn, Kann gestern besser werden? Essays zum Bedenken der Geschichte, Berlin: Kadmos, 2003 (Kulturwissenschaftliche Interventionen, Bd. 2). Schiller, Friedrich, Werke, Nationalausgabe. Bd. 25: Schillers Briefe 1.1.1788 - 28.2.1790, hg. von Eberhard Haufe, Weimar: Hermann Böhlaus Nachfolger, 1979. –, Sämtliche Werke in fünf Bänden. Bd. 2: Dramen 2, hg. von Peter-André Alt, München: Hanser, 2004. Schuster, Max, Der geschichtliche Kern von Hauffs Lichtenstein, hg. von der württ. Kommission für Landesgeschichte, Stuttgart 1904 (Darstellungen aus der Württembergischen Geschichte, Bd. 1). Singer, Wolf, „Wahrnehmen, Erinnern, Vergessen“, in: Eine Welt – Eine Geschichte? 43. Deutscher Historikertag in Aachen 2000, hg. vom Verband der Historiker und Historikerinnen Deutschlands e.V., München: Oldenbourg Wissenschaftsverlag, 2001, S. 18–27. Stockinger, Claudia, „Verkehrungen der Romantik. Hauffs Erzählungen im Kontext frührealistischer Verfahren“, in: Wilhelm Hauff oder Die Virtuosität der Einbildungskraft, in Verbindung mit der Deutschen Schillergesellschaft hg. von Ernst Osterkamp, Andrea Polaschegg und Erhard Schütz, Göttingen: Wallstein, 2005, S. 52–82. Welzer, Harald, Das kommunikative Gedächtnis. Eine Theorie der Erinnerung, München: Beck, 2002.

Welterfolge von „All-Age-Titeln“

377

Welterfolge von „All-Age-Titeln“ Evolutionspsychologische Perspektiven auf die Bis(s)-Bestseller (Twilight) von Stephenie Meyer Tina Schneider

Die amerikanische Autorin Stephenie Meyer kann man ohne Übertreibung als Shootingstar der Branche bezeichnen.1 Bis zur Veröffentlichung des ersten Bandes ihrer Vampir-Tetralogie war sie gänzlich unbekannt. Bis(s) zum Morgengrauen (Twilight) erschien das erste Mal 2005 in den USA und ein Jahr später in deutscher Übersetzung.2 Jedes Jahr folgte nun ein weiterer Band dieser Jugendbuchreihe, die zumindest im Umfang (mit rund 500 bis 800 Seiten pro Band) den Harry-Potter-Romanen von Joanne K. Rowling in nichts nachsteht. Bis Ende März 2010 wurden die deutschsprachigen Ausgaben der Romane rund 8 Mio. Mal verkauft, weltweit waren es in demselben Zeitraum über 100 Mio. Exemplare.3 Alleine in den USA übernahmen im Jahr 2008 die vier Bände mit 15 Mio. verkauften Exemplaren die vorderen Plätze der gesamten US-Bestseller-Charts,4 und Stephenie Meyer avancierte damit zur meistverkauften US-Autorin. Die Kinoverfilmungen der einzelnen Romane 1

2

3

4

Bei diesem Beitrag handelt es sich im Wesentlichen um eine sehr komprimierte und in einigen Teilen ergänzte und aktualisierte Zusammenfassung des Kapitels 7.2. „‚Ästhetik des Horrors‘: Die Vampir-Reihe von Stephenie Meyer“ meiner Dissertation (vgl. Schneider 2009, S. 498– 552). Stephenie Meyer, Bis(s) zum Morgengrauen, 2006 (Twilight, 2005); Bis(s) zur Mittagsstunde, 2007 (New Moon, 2006); Bis(s) zum Abendrot, 2008 (Eclipse, 2007); Bis(s) zum Ende der Nacht, 2009 (Breaking dawn, 2008). Die Novelle Bis(s) zum ersten Sonnenstrahl: Das kurze zweite Leben der Bree Tanner gehört trotz der ähnlich lautenden Titelformulierung nicht unmittelbar zu der RomanTetralogie. Meyer hat diesen Text quasi als Spin-off-Produkt hergestellt: Es wird das kurze Leben der Bree Tanner erzählt, einer Jung-Vampirin, die in dem dritten Roman Bis(s) zum Abendrot eine kleine Rolle spielt und am Ende von den Volturis getötet wird. Der Text spielt daher bei der weiteren Untersuchung keine Rolle. Die Verkaufszahlen zum deutschsprachigen Raum stammen von Joachim Kaufmann, Geschäftsführer des Carlsen Verlags (Mail vom 27.8.2010); internationale Verkaufszahlen von John Sellers, abgedruckt in Publisher’s Weekly, 30.3.2010; die Anzahl der Fanclubs stammt aus einem TV-Beitrag des heute journal: Dunja Stamer, „‚Biss…‘ – Warten auf den Einen“, in: ZDF heute journal (15.3.2009). Weitere Ausgaben einzelner Bände befinden sich zusätzlich auf der Top-50-Liste auf den Plätzen 13, 24, 30 und 42. Die Daten wurden von Nielsen BookScan US ermittelt (vgl. International Chart 2009, S. 16).

378

Tina Schneider

verstärkten immer wieder den Abverkauf der Buchtitel und den Hype um die Serie. Folgerichtig wurde Stephenie Meyer von USA Today zum „author of the year“ 2008 gekürt, da ihre Bände innerhalb des Jahres die USA TodayBestsellerliste 18-mal angeführt hatten. Zudem bestätigt die erfolgreiche Film-Version Meyers Status als „pop-culture phenomenon“ (vgl. Schumacher 2008). Meyers Arbeit wird immer wieder mit der von J. K. Rowling gemessen, möglicherweise weil sie derzeit die Einzige ist, die auf dem internationalen Parkett der Kinder- und Jugendliteratur (KJL), zumindest was den ökonomischen Erfolg angeht, ansatzweise in die Fußstapfen der Britin treten könnte. Literarische Vorbilder sind für Meyer wichtig, und daher haben die Werke anderer Autoren einen indirekten Einfluss auf den Plot der VampirSerie oder spielen direkt intratextuell eine Rolle.5 Weiterhin verbindet die beiden erfolgreichen Roman-Serien, dass sie ein breites Altersspektrum in der Rezipientengruppe abdecken, wobei die Harry-Potter-Romane aufgrund ihrer Thematik Leser beiderlei Geschlechts in den Bann ziehen, die VampirRomane hingegen tendenziell nur den weiblichen Teil der Bevölkerung, diesen dafür bis ins höhere Alter (vgl. Bardola 2009, S. 47ff., 110).6 Stephenie Meyer hält die Trennung in Jugendbücher und Erwachsenenbücher, wie sie in einem Interview bekennt, ohnehin für obsolet (vgl. Meyer 2008c). Wenn man von den Metaphern „Vampir“ und „Werwolf“ absieht, eröffnet der Text jedoch nicht die Doppeldeutigkeit, wie sie oftmals in „All-AgeTiteln“ zu finden ist.7 Polyvalenz auf der Diskursebene, die bei den Rowling-Romanen den Erwachsenen eine andere Leseebene zulässt und damit Lesevergnügen bereitet, findet sich in den Meyer-Texten nur sehr vereinzelt. Sprachlich lassen sie wenige „Leerstellen“ offen. Die Mehrfachadressierung erreicht Meyer nahezu allein über das Thema und dessen Ausgestaltung auf der Handlungsebene. Dieses Thema und seine literarische Umsetzung differieren gänzlich von den Harry-Potter-Romanen, selbst wenn beide Serien

5

6

7

Der erste Band der Vampir-Tetralogie ist von Austens Stolz und Vorurteil, der zweite und vierte von den Shakespeare-Werken Romeo und Julia, Der Sommernachtstraum und Der Kaufmann von Venedig und der dritte von Brontës Sturmhöhe inspiriert, welches auch Bellas Lieblingsbuch ist, auf das sie sich mehrfach im Text bezieht (vgl. Meyer 2008a, S. 36f.; Bardola 2009, S. 142ff.). Joanne Stapley hat in einem Aufsatz die Frage diskutiert, ob es sich bei der Twilight-Serie um Jugendliteratur handelt (vgl. Stapley 2009). Diese Frage ist nach neueren Marktforschungsergebnissen absolut berechtigt, denn das Durchschnittsalter einer Bis(s)-Käuferin liegt in Deutschland bei 35 Jahren, einer Bis(s)-Leserin zwischen 10 und 29 Jahren – 93% der Leser sind Frauen und lediglich 7% Männer (Börsenverein des Deutschen Buchhandels / Arbeitsgemeinschaft von Jugendbuchverlagen 2010, S. 29ff.). Zum Thema „All-Age-Literatur“ und ihrer aktuellen Marktbedeutung in Deutschland vgl. Schneider 2011 (im Erscheinen). Ausführlich für den internationalen Bereich Beckett 2009 und Falconer 2009.

Welterfolge von „All-Age-Titeln“

379

unter dem weiten Sujet der fantastischen Literatur subsumiert werden können. Im thematischen Zentrum der Bis(s)-Romane steht die Amour fou zwischen der sterblichen Bella und dem unsterblichen Edward, angereichert mit Spannungselementen, die im Wesentlichen aus dem Verhältnis dieses ungleichen Paares resultieren, ein nicht unüblicher Genre-Mix aus GothicThriller und romantischer Liebesgeschichte.8 Vampire und Werwölfe verleihen der Geschichte eine fantastische Aura. Das fantastische Element tritt in das fiktiv-reale Nordamerika der Jetztzeit in Form von Vampiren und Werwölfen, die keine eigenen Handlungsräume besetzen, sondern inmitten der Menschen leben und agieren, welche sie noch nicht einmal als andersartig, als potenzielle Gefahr identifizieren. Nur Bella und einige wenige andere Menschen kennen dieses Geheimnis, was im Verlauf der Handlung für ein dramaturgisches Spannungsmoment und für Tempo und Verve sorgt. Dadurch, dass die fantastischen Elemente in der fiktiven Realität auftreten, und dadurch, dass Bella Vampire und Werwölfe fast selbstverständlich in ihr Leben und Handeln integriert, gewinnen diese an „realer“ Realität. Das Fantastische besteht nicht mehr in der Existenz von Vampiren und Werwölfen, sondern nur noch darin, dass die Hauptakteurin mit ihnen interagieren darf und die Leserin, die so dicht an Bellas Seite steht, nicht. Bei der Lektüre der Harry Potter-Romane ist sich vermutlich jeder Leser trotz aller Begeisterung bewusst, dass das Zauberinternat Hogwarts und die magische Parallelwelt nicht existieren. Bei Stephenie Meyers Romanen ist das anders: Fast die Hälfte der Fans ist davon überzeugt, dass Vampire unter den Menschen leben, die ebenso freundlich und den Menschen zugetan sein können wie Edwards Familie. Dazu drei repräsentative Stimmen aus einem Internetforum, die eine durchaus nicht unproblematische Aufhebung der Grenzen zwischen Literatur und Wirklichkeit andeuten: – Um ehrlich zu sein, seitdem ich diese Bücher gelesen habe, rechne ich mit allem. (Bardola 2009, S. 182) – Ja, ich glaub an Vampire oder zumindest an vampirähnliche Wesen, denn woher kämen die ganzen Mythen und Geschichten? Irgendeinen halbwegs realistischen Hintergrund müssen diese schon haben. (S. 183) – Und es tut einfach total gut, eine so realistische ‚Vampir-Mensch-Romanze’ zu lesen und einfach mal abzutauchen und danach vom schönen Edward Cullen zu träumen. (S. 189) 8

Isabella Schlinter hat die derzeitige Häufung von Liebesromanzen mit und von Vampiren in der Jugendliteratur in einem Aufsatz thematisiert (vgl. Schlinter 2007). Die Begeisterung für die positiv besetzten, leidenschaftlichen Vampire jenseits der alten Graf Dracula-Metaphorik hat längst auch in der Belletristik für Erwachsene Fuß gefasst in Form des erotischen und oftmals pornografischen Vampir-Romans. Große Buchhandlungen haben, um dieser Nachfrage Rechnung zu tragen, oftmals eine eigene Bücherregal-Rubrik „Vampir-Romane“ eingerichtet.

380

Tina Schneider

Durch die Reduzierung der fantastischen Elemente auf ein Minimum, nämlich auf die Existenz von zwei Arten von „Lebewesen“, und den Verzicht auf sonstigen „Zauber“ vermittelt der implizierte Autor die Botschaft: Es gibt eine Macht / mehrere Mächte, die man vielleicht nicht sieht, nicht sehen kann, die aber trotzdem Einfluss auf den Menschen und sein Leben nehmen kann / können (vgl. auch Williams et al. 2006). Die Bandbreite der evolutionspsychologischen Fragestellungen von Meyers Vampir-Reihe (und vermutlich der meisten Vampir-Geschichten) ist vielfältig, trifft im Kern aber klarer und ungeschminkter als die meisten anderen Texte der KJL das, was Menschen und was die Basis der Evolutionslehre ausmacht: Überleben und Reproduktion, Sexualität und Tod. Damit wird der Vampir, wie Britta Radkowsky es formuliert, zum Gefäß für eigene Ängste und Träume […], Allegorie der Sehnsucht nach Schönheit und Perfektion, Symbol für den Wunsch nach immer währender Liebe, Projektionsfläche für den Willen, Macht über andere zu haben, Metapher für die Nähe zum Tod, Instrument für die Inszenierung der Einsamkeit, Anspielung auf sexuelle Begierden und Sinnbild von Melancholie. (Radkowsky 2005, S. 8)

In Meyers Vampir-Saga sind es die Figuren selbst, die einen interessanten Betrachtungsansatz für die Evolutionspsychologie bieten. Zusammengefasst begegnet man drei gänzlich unterschiedlichen Figurengruppen in den Romanen: den Menschen, den Werwölfen und den Vampiren, wobei letztere Gruppe sich nochmals in „gute“ und „böse“ Vampire aufteilt. Die Menschenwelt wird hauptsächlich von der jugendlichen Protagonistin Bella repräsentiert, für die „guten“ Vampire steht Edward im Zentrum der Geschichte, und Jacob ist die zentrale Werwolf-Figur. Die Faszination, die die Figur des Vampirs und/oder des Werwolfes auf zahlreiche Menschen ausübt, wird im Folgenden anhand von drei Thesen kurz beleuchtet: (I) Partnerselektionsstrategien, dargestellt an der Liebesgeschichte zwischen der sterblichen Bella und dem unsterblichen Edward, (II) „böse“ Vampire als Metapher für ein betrügerisches, ausbeutendes Gruppenverhalten und (III) Vampire und Werwölfe als Symbol für die „tierische“ Seite des Menschen.

Welterfolge von „All-Age-Titeln“

381

I. Partnerselektionsstrategien: Edward als Ideal des männlichen Partners Vorlieben bei der Partnerwahl stehen im engen Kontext mit der Evolutionsgeschichte des Menschen.9 Viele spezifische Vorlieben konnten sich über die Zeit entwickeln, weil eine kluge und umsichtige Partnerwahl entschieden zum eigenen Überleben und dem des Nachwuchses beitrug. Männer produzieren Millionen von Spermien und dies ab der Geschlechtsreife nahezu während ihres ganzen Lebens. Frauen verfügen dagegen über einen begrenzten, nicht erneuerbaren Vorrat von Eizellen. Die intrakorporale Befruchtung sowie die Schwangerschaft und das anschließende Stillen bringen schon ein Ungleichgewicht in die Verteilung der elterlichen Investition. Robert Trivers trifft dazu bereits 1972 zwei grundlegende Aussagen: (1) das Geschlecht, das mehr in den Nachwuchs investiert (in der Regel, doch nicht immer das weibliche Geschlecht), wird bei der Partnerwahl wählerischer sein; und (2) das Geschlecht, das weniger in den Nachwuchs investiert, wird um das andere Geschlecht stärker konkurrieren.10

Völlig losgelöst findet dieser Prozess allerdings nicht statt. Ein zentraler Faktor auf beiden Seiten ist der eigene „Partnerwert“ („mate value“), der je nach Alter, Aussehen und sozialem Status differiert und unterschiedliche Verhaltens- und Entscheidungsoptionen eröffnet.11 Diese Kriterien – einst in vorgesellschaftlichen Strukturen entstanden – sind auch heute noch, trotz signifikant veränderter Rahmenbedingungen, Orientierungsbasis bei der Evaluation potenzieller Partner.12 David Buss fasst zusammen, welche Vorlieben sich universell bei Frauen für die Adaptionsprobleme entwickelt haben: hohe Investitionskraft (Finanzen oder finanzielle Aussichten, Status innerhalb der Gemeinschaft, höheres Alter, Ehrgeiz / Fleiß) und Investitionsbereitschaft (Zuverlässigkeit und Stabilität, Zeichen von Liebe und Bindungswille, positiver Umgang mit Kindern), schützendes und fürsorgliches Verhalten, Kompatibilität in den Werten und der Persönlichkeit und nicht zuletzt Gesundheit Für diesen Punkt wurden Teile aus dem Kap. 3.5. „Sexuelle Selektion und Partnerstrategien“ meiner Dissertation verwendet. Zum besseren Verständnis des fachlichen Kontextes sei ebenso auf Kap. 3.4. „Spezialisierung und Geschlechterunterschiede“ verwiesen (Schneider 2009, S. 189ff., 203ff.). Das Thema der Partnerselektionsstrategien gehört zu den am meisten untersuchten im Bereich der Evolutionsbiologie und Evolutionspsychologie. Eine kleine verwendete Auswahl von Literatur: Hejj 1996; Hassebrauck und Küpper 2002; Buss 2004; Kappeler 2006; Oxford Handbook of Evolutionary Psychology 2007 (bes. Section V „Mating, reproduction and life history“); Voland 2007a; Voland 2009; Diamond 2000. 10 Zitiert nach Buss 2004, S. 155; Original: Trivers 1972. Inhaltlich ebenso Voland 2007a, S. 55ff. 11 „Partnerwert“ bezeichnet keine absolute Größe, sondern entsteht in dem Verhältnis zu anderen Geschlechtsgenossen. Beispielsweise ist es schwieriger in einer dicht besiedelten, medial verbundenen Welt attraktiv zu wirken, als eine von wenigen Frauen unter vielen Männern zu sein, die etwa den Westen Amerikas mitbesiedelten. Im ersteren Fall kann sich der Partnerwert trotz objektiv gegebener Schönheitsmerkmale als geringer darstellen als im zweiten Fall. 12 Vgl. Hejj 1996, S. 14f.; ebenso Buss 2004, S. 182ff., 250f., 518; Menninghaus 2007, S. 243.

9

382

Tina Schneider

(physische Attraktivität, Symmetrie) (vgl. Buss 2004, S. 157f.).13 Die starke weibliche Präferenz für wirtschaftliche Ressourcen bei Männern hat dazu geführt, dass z.B. Werkzeuge und Territorien weltweit von Männern „beschafft, verteidigt, monopolisiert und kontrolliert“ (S. 158f.) werden. Neben den mobilen und immobilen Reichtümern zählen Bildung und Berufsabschlüsse zu den Indikatoren, an denen ein hoher oder potenziell hoher Status abzulesen ist. Ein fleißiges und ehrgeiziges Verhalten deutet ebenfalls darauf hin, dass der Partner Ressourcen akkumulieren kann (vgl. S. 165ff.). Zuverlässigkeit und Stabilität sind wichtige Indizien, dass er sich langfristig und kontinuierlich um die Versorgung der Familie kümmern wird. Daneben sind physiognomische Attribute nicht irrelevant: eine Körpergröße von über 180 cm (in Deutschland) und ein athletischer Körperbau gelten als erstrebenswert, weil sie einst den Schutz der Familie sicherten.14 Ein guter Gesundheitszustand ist beiden Geschlechtern wichtig. Hinweise darauf liefert die Symmetrie des Gesichts und Körpers. Männlich aussehende Gesichter werden von Frauen als attraktiver eingestuft, obwohl ein hoher Testosteronspiegel für das Immunsystem eher belastend ist, d.h. sie können sich gesundheitlich diesen „Luxus“ leisten (vgl. S. 170ff.).15 Eine ausgeprägte Muskulatur zeugt von Kraft und Schnelligkeit. Edward, das Subjekt von Bellas Begierde, korreliert in hohem Maße mit diesen Attributen. Äußerlich fallen er und seine Familie, die Cullens, durch ihre überirdische Schönheit, durch ihre ästhetische Art der Fortbewegung, durch spezielle Augenfarben und ihre blasse kalte Haut auf. Ihr Verhalten, sich als „Vegetarier“ von Tier- und nicht von Menschenblut zu ernähren, macht sie zudem zu Philanthropen. Die Lebensweise der Cullens scheint je-

13 Vgl. auch Hejj 1996, S. 52; Gottschall 2004. 14 Guido Heineck hat zum Thema Körpergröße und Gehalt eine interessante Studie vorgelegt, in der er bei deutschen Männern eine direkte Korrelation zwischen Körpergröße und Gehalt nachweisen konnte. Groß gewachsene Männer werden als besonders leistungs- und durchsetzungsstark wahrgenommen (zumindest in den alten Bundesländern). Bei Frauen gilt diese Systematik nicht. Hier spielt vor allem Attraktivität und emotionale Intelligenz eine Rolle (vgl. Heineck 2005). Auch in der größten Industrienation der Welt scheinen diese Faktoren implizit eine zentrale Rolle zu spielen: Die Mehrheit der Spitzenmanager der Fortune-500-Liste sind nicht nur weißer Hautfarbe und männlichen Geschlechts, sondern sieben Zentimeter größer (1,82 m) als der Durchschnitts-US-Amerikaner (1,75 m). Auf den Verdienst wirkt sich auch in den USA die Körpergröße aus: Bereinigt um Geschlecht und Hautfarbe bringt sie 310 USD pro Zentimeter mehr auf das Konto (vgl. Gladwell 2007, S. 93f.). 15 Die Anfälligkeit für Prostatakrebs scheint mit dem Testosteronniveau zu korrelieren. Philippe Rushton zitiert eine Studie mit „zwei parallelisierten Gruppen von 50 schwarzen und 50 weißen männlichen Universitätsstudenten in Kalifornien“, bei der festgestellt wurde, dass „die Testosteronniveaus bei Schwarzen um 19 Prozent höher lagen als bei Weißen. […] Die Häufigkeit des Prostatakrebs liefert einen indirekten Hinweis. Zahlreiche medizinische Untersuchungen zeigen, daß asiatische Bevölkerungen weniger als die Hälfte der US-Häufigkeit erleiden, während US-Schwarze ein wesentlich höheres Risiko haben als US-Weiße.“ (Rushton 2005, S. 228).

Welterfolge von „All-Age-Titeln“

383

doch in Meyers Vampir-Welt (bis auf eine weitere Familie in Alaska) die Ausnahme darzustellen (vgl. Meyer 2006, S. 305; Meyer 2007, S. 426). Das Verhalten der Vampire wird in den Romanen mehrfach mit dem von Raubtieren verglichen, die über exzellente Sinne und Instinkte verfügen und über eine Dimension von Kraft und Schnelligkeit, die Vergleiche aus dem Tierreich suchen. Ihre Schönheit und ihre Anmut machen sie für ihre potenzielle Beute ausgesprochen attraktiv, denn ihre Form der Reproduktion besteht im Beißen eines Menschen, der sich, sofern er stark genug ist und nicht daran zugrunde geht, selbst in einen Vampir verwandelt.16 Edwards Schwester, die Vampirin Alice, klärt Bella auf: Wie alle anderen Raubtieren sind wir im Übermaß mit Fähigkeiten und Waffen ausgestattet, viel üppiger als eigentlich notwendig: die körperliche Stärke, die Geschwindigkeit, die scharfen Sinne, abgesehen von zusätzlichem Wahrnehmungsvermögen wie bei Edward, Jasper oder mir. Dazu kommt, dass wir äußerlich attraktiv auf unsere Beute wirken, genau wie Fleisch fressende Pflanzen. (Meyer 2006, S. 428)

Die Dreiecksbeziehung zwischen Bella und Edward und Bella und ihrem Werwolf-Freund Jacob verleiht den Romanen zusätzlich Spannung und Reiz, denn die Leserin schwankt ebenso wie die Protagonistin zwischen dem belesenen, mehrsprachigen, musikalischen und reichen Edward, der zwar kalt ist, aber eine „Seele“ aus Gold sein eigen nennt (vgl. Meyer 2006, S. 24, 485), und dem großen, starken und sehr männlichen Gefährten, der sie unkompliziert und humorvoll durchs Leben begleitet und heißblütig in der Liebe reagiert.17 Jacob gegenüber betont Bella Edwards Vorteile: ‚Ich liebe ihn [Edward; T. S.]. Nicht weil er schön oder weil er reich ist.‘ Ich sagte es voller Verachtung. ‚Mir wäre es lieber, er wäre keins von beidem. Das würde den Abstand zwischen uns verringern – wenn auch nur ein kleines bisschen, denn er wäre immer noch der liebste, selbstloseste, klügste und netteste Junge, den ich je kennengelernt habe.‘ (Meyer 2008a, S. 115)

Und über Jacob und seine männlich kraftstrotzende Anziehungskraft reflektiert Bella: Jacob hatte sich in den letzten acht Monaten ganz schön gemacht. Die Phase, in der sich die weichen Muskeln eines Kindes zur festen, schlaksigen Statur eines Teenagers formen, lag hinter ihm; unter der rostbraunen Haut seiner Arme und Hände traten die Sehnen und Adern hervor. Sein Gesicht war immer noch so hübsch, wie ich es in Erinnerung hatte, doch die Züge waren härter geworden – die Wangenknochen traten stärker hervor, das Kinn war kantiger geworden, das Runde, Kindliche war aus seinem Gesicht verschwunden. (Meyer 2007, S. 134)

16 Das Beißen und Aussaugen der Tiere durch die „vegetarisch“ lebenden Cullens hat nur eine tödliche Wirkung auf die Opfer; sie verwandeln sich nicht analog zu den gebissenen Menschen in Tier-Vampire. 17 Katja Mellmann hat sich in einem lesenswerten Aufsatz zum Thema der Spannung, die u.a. eben auch als Begleiterscheinung von „libidinös-konsumtiv ausgerichteten Emotionen“ (Mellmann 2007, S. 265) auftreten kann, geäußert.

384

Tina Schneider

Bella entscheidet sich für Edward – aus evolutionspsychologischer Sicht bei einer langfristigen Partnerwahl eine kohärente Entscheidung. Intelligenz, Bildung, Reichtum deuten nicht nur in Vampir-Sozietäten auf einen hohen gesellschaftlichen Status hin; kommen ein elegantes und fantastisches Aussehen, Charakterstärke und altruistische Verhaltensmerkmale hinzu, ist der männliche Idealpartner nicht zu verbessern.18 Edward und seine Familie gehören zu den wenigen Ausnahmen der Vampir-Welt, die eher wie eine moderne amerikanische Familie agieren, von christlich-konservativen Wertmaßstäben geleitet: gegenseitiges Vertrauen und Unterstützung, Anerkennung der individuellen Besonderheiten und Fähigkeiten sowie eine lebenslange (und bei Untoten bekommt dies eine andere Dimension als bei Sterblichen), treue, glückliche Paarbindung. Ihrem eigentlich „tierischen“ Wesen haben sie ein strenges Korsett übergestreift, lediglich gespeist von einem überdimensional starken Willen, denn ihre Verhaltenstendenz, Menschen nicht zu beißen und auszusaugen, entspricht nicht ihrer Natur.19

II. „Böse“ Vampire als Parasiten der Gesellschaft Zu den negativ dargestellten Vampiren gehört, neben den nomadisch-marodierenden Vampir-Banden und anderen Clans, vor allem die regierende Volturi-Familie, die im italienischen Volterra residiert. Die Volturi-Sippe hält einem Vergleich mit den Corleones in Mario Puzos Der Pate stand, nur dass ihr Einflussbereich noch uneingeschränkter und weltumspannender ist. Sie treten als alte herrschende „Familie“ auf, die sich normalerweise in das Leben und Handeln anderer Vampir-Familien nicht einmischt, sofern diese nicht gegen das Hauptgesetz, das unauffällige Bewegen in der Menschenwelt, verstoßen. Greifen sie ein, was häufig bei Jung-Vampiren passiert, die sich in den 18 Um Edwards Reichtum und den seiner Familie zu dokumentieren, greift die Autorin gerne auf Insignien der westlichen Wohlstandsgesellschaft zurück: schnelle und teure Autos. Als Bellas alter Chevy Pickup nur noch verschrottet werden kann, erhält sie zu ihren Menschenzeiten ein „before-car“, das Sondermodell „Guardian“ von Mercedes, das sich normalerweise nur arabische Diplomaten leisten können. Nach ihrer Verwandlung in eine Vampirin steht bedingt durch ihre Unsterblichkeit Sicherheit nicht mehr im Fokus bei Edwards Autowahl. So bekommt sie von ihm einen Ferrari als „after-car“ geschenkt (vgl. Meyer 2006, S. 5ff.; 630). Die Autorin teilt die Leidenschaft für schnelle, sportliche Autos und favorisiert wie Edwards „Schwester“ Alice einen Porsche. In einem Interview mit MTV Movie News bestätigt sie: „I’m waiting for the right Porsche 9. [She laughs.] That’s really my car – I love Porsches. I’m kind of a silver-car person, but I think with the Porsche, you would have to go red.” (Carroll 2007). 19 Katri Lehtinen bezeichnet daher auch die Ernährung der Vampire nicht als das Teuflische (denn sie muss als natürlicher Bestandteil ihres Wesens gesehen werden), sondern die Art und Weise, wie die Nahrung gewonnen wird. Sie führt mehrere moderne Beispiele der Vampir-Literatur an, in der die Protagonisten bewusst eine nichtgewalttätige Variante wählen, um an menschliches Blut heranzukommen (vgl. Lehtinen 2004).

Welterfolge von „All-Age-Titeln“

385

ersten paar Jahren nach ihrer Verwandlung schwer kontrollieren können, so endet dies für die Betroffenen in der wahrhaftigen Endlichkeit.20 Trotz aller Verliebtheit ist sich Bella im Klaren, zu welchen Handlungen Vampire fähig sind – von den Cullens und wenigen anderen abgesehen. Aufgeklärt werden die vampirischen Verbrechen selten, bzw. Menschen müssen als Sündenböcke ihren Kopf dafür hinhalten. Der Mythos Vampir (und der vergleichbarer anderer Untoter und Wiedergänger) blickt auf eine lange Tradition zurück.21 Die literarische Verarbeitung des Themas begann allerdings erst im 19. Jahrhundert.22 Noch immer steht Dracula (1897) von Bram Stoker als Inbegriff dieses Genres.23 Ein einheitliches Vampir-Bild gab und gibt es nicht, und die literarische Zeichnung der Vampir-Figuren differierte zusehends von den folkloristischen Vorstellungen.24 Selbst die literarische Vampir-Gestalt ist nicht homogen, 20 Barbara Strauch hat ausgeführt, dass Impulssteuerung und -hemmung erst ab 25 Jahren voll ausgeprägt sind. Darüber hinaus wird risikoreiches Verhalten mit einem Dopaminschub belohnt. Insofern kongruiert die fehlende Selbstkontrolle der Jung-Vampire durchaus mit der von Teenagern und jungen Twens (vgl. Strauch 2003, S. 52ff.). 21 Tony Thorne vertritt wie die meisten Kenner des Vampir-Mythos die Auffassung, dass „der Prototyp des blutsaugenden Dämons in nahezu allen menschlichen Gesellschaften präsent ist und seine Entsprechung in so weit entfernten Kulturkreisen wie denen Mittelamerikas, Westafrikas und Südostasiens“ hat (Thorne 2002, S. 18; vgl. Borrmann 1999, S. 42ff.). Ob der Mythos bereits in prähistorischen Zeiten zu finden sei und seinen „Ursprung in der menschlichen Psychologie“ (Thorne 2002, S. 71) habe, kann mit Bestimmtheit nicht gesagt werden. Claude Lecouteux ist ebenfalls überzeugt, dass der Vampir „Teil einer verkannten Geschichte der Menschheit“ ist und „in einem komplexen Zusammenhang von Manifestationen des Todes und des Lebens“ erscheint (Lecouteux 2001, S. 15). Marco Frenschkowski legt hingegen Wert darauf, dass es sich nicht um eine anthropologische Universalie handelt: „Der Vampir ist gerade kein ‚Menschheitsglaube‘. Er ist ein Stück slavischer und – wohl erst davon abgeleitet – neugriechischer (und rumänischer) Folklore, die sozusagen ‚Karriere‘ gemacht hat. Viele Völker kennen angrenzende Motive: aber eben nur angrenzende. Eine falsche ‚Archetypisierung‘ des Motivs verhindert die eigentlich spannenden kulturgeschichtlichen Fragen: Warum nämlich der Vampirglaube gerade da entsteht, wo er entsteht.“ (Frenschkowski 2005, S. 59). Frenschkowskis Differenzierung mag literaturwissenschaftlich ihren Reiz haben, erscheint aber bei einer evolutionspsychologischen Fragestellung wenig hilfreich, da es gerade darum geht, ultimate Erklärungen für ein weltweit auftretendes Phänomen zu finden – was der VampirMythos unbestritten ist – und sich nicht mit proximativen kulturellen Überformungen aufzuhalten. Für eine umfassende Bibliografie wissenschaftlicher Vampir-Literatur vgl. Hövelmann 2007. 22 Wem die exakte Urheberschaft für das Genre zugeschrieben wird, darüber besteht in der Forschung keine Einigkeit, ob es nämlich John William Polidoris The Vampyre (1816) ist oder Gottfried August Bürgers Ballade „Leonore“ (1773). 23 In Breaking Dawn bezieht sich Meyer in einer kurzen Episode auf den Dracula-Mythos, als Jacob sich über zwei rumänische, von ihrem Verhalten und Auftreten nicht in die amerikanische Gruppe passende Vampire, die die Cullens gegen die Volturis unterstützen wollen, lustig macht: „Dracula One and Dracula Two are creep-tacular“ (Meyer 2008b, S. 631; „creep-tacular“: Portemanteau-Wort, so etwa wie „schreck-takulär“). 24 Zu dem Themenkomplex der historischen Entstehung des Vampir-Bildes in der Bevölkerung und seiner literarischen Verarbeitung finden sich die meisten Arbeiten. Zu einer der ersten umfassenden zählt Copper 2007. Lecouteux (2001) konzentriert sich in seiner fundierten Un-

386

Tina Schneider

vielmehr kann man einen Paradigmenwandel erkennen, von einem in Schrecken versetzenden Monster zu einem empfindsamen, „sozial“ strukturierten Wesen. Der Vampir-Mythos wurde vermutlich während der Pestepidemien geboren, als Scheintote mangels medizinischer Differenzialdiagnostik und bedingt durch die Notwendigkeit, sich der Ansteckungsherde rasch zu entledigen, beerdigt wurden (vgl. Jarrot 1999, S. 46; Benecke et al. 2004).25 Handelte es sich anfangs um die Vorstellung, die „Toten“ entstiegen des Nachts ihrem Grab und verbreiteten unter den Sterblichen Krankheiten, Tod oder materielle Schäden, so wandelte sich die Vampir-Figur im 19. Jahrhundert zu einem Adeligen, der abgeschieden in einem alten Schloss haust, in einem Sarg schläft und sich – wenn greifbar – vom Blut unschuldiger junger Mädchen und Frauen ernährt.26 Im 20. Jahrhundert vollzog sich dann der Wandel zu einer bürgerlichen Gestalt, die durchaus einem geregelten (oftmals in der Nacht ausgeübten) Beruf nachgeht und mitten unter den Menschen, bis zu einem gewissen Maße sogar sozial integriert, lebt. Die berufliche Aktivität und die soziale Anerkennung dienen klar als Tarnung seines eigentlichen Wesens und machen seine Existenz vielleicht noch erschreckender.27 Die Metaphern des Vampirismus umfassen daher die ganze Bandbreite der Betrüger und Trittbrettfahrer einer Gesellschaft: ein „Leben“ ausschließlich auf Kosten anderer, kein Verbrauch eigener körperlicher Ressourcen bedingt durch den nicht vorhandenen Energiehaushalt, krebsgeschwürartige Verbreitung (z.B. von Seuchen, von Epi- und Pandemien), sadomasochistische und sich selbst aufgebende Sexualität und durch die Unsterblichkeit eine niemals endende Ausbeutung. Nicht umsonst werden Politiker, Wirtschaftsmogule oder Verbrecher, die tatsächlich oder vermeinttersuchung vor allem auf die Metamorphose des Vampir-Mythos sowie auf die unterschiedlichen historischen und regionalen Ausprägungen. Ken Gelder (1994) zeichnet die narrativen Spuren des Vampir-Mythos nach, belässt es bei der Analyse aber im Wesentlichen bei den Klassikern des Genres, im letzten Kapitel ergänzt um ein paar aktuellere „Vampir-Blockbuster“ wie z.B. Stephen Kings Salem’s Lot (Brennen muss Salem). 25 Lecouteux zitiert Léon Gozlan, der 1861 in einem seiner Romane ausführt, dass die Anzahl der vermeintlichen Vampire besonders hoch in Zeiten von Epidemien und Seuchen waren, was nicht verwundert, denn ein geeigneter Sündenbock musste für die dramatisch hohen, damals medizinisch nicht nachvollziehbaren Todesfällen gefunden werden (vgl. Lecouteux 2001, S. 170). 26 Daneben kam durch das Blutsaugen an Männern durch männliche Vampire eine homoerotische Komponente mit ins Spiel. Mehrheitlich scheint es zumindest für die literarischen Vampir-Gestalten keinen ernährungstechnischen Unterschied zu machen, ob weibliches oder männliches Blut konsumiert wird. Auch die Blutgruppe spielt im Gegensatz zur Realität keine Rolle, jedenfalls wird sie nicht als relevanter Faktor erwähnt. 27 Carsten Gansel hat bereits auf die Modifikation der Raummotive in der fantastischen Literatur hingewiesen: „Es erfolgt zunehmend eine Einbettung des Phantastischen in großstädtische Lebensräume. Nicht mehr abgelegene Burgen, sondern die Straßen und Städte sind die Aktionsräume für phantastische Ereignisse. Mit der Hereinnahme der Großstädte bekommt der Schauer eine neue Dimension. Das Phantastische durchzieht eine alltägliche Welt und soll vom Leser aufstörend zur Kenntnis genommen werden.“ (Gansel 2001, S. 95).

Welterfolge von „All-Age-Titeln“

387

lich breite Bevölkerungsgruppen ausbeuten, als „Blutsauger“ tituliert. Der Kulminationspunkt der Vorstellung vom Vampir als Ausbeuter der Menschheit findet sich im Werk von Karl Marx: Die das Kapital generierende Arbeiterschaft wird von der Kapital haltenden herrschenden Klasse ausgesaugt und nur der Sozialismus vermag diesem Vampirismus ein Ende zu bereiten (vgl. Borrmann 1999, S. 143ff.). Der Horror aus der Vampir-Literatur generiert sich nicht nur aus der Tatsache, was und wie Vampire sind, sondern im Wesentlichen daraus, dass sie im Gegensatz zu anderen gefährlichen Gestalten kaum identifiziert werden können. Ihr menschenähnliches Aussehen, der mehrheitlich nomadische Lebenswandel und die überlegte Intelligenz machen es schwierig bis unmöglich, sie als Parasiten der Gesellschaft zu entlarven. Bestimmte physiologische Prozesse und ihr metabolischer Status weisen bei Meyers Vampiren auf die Andersartigkeit hin, die bei einem einmaligen oder bei seltenem und wenig körperbetontem Kontakt kaum auffallen dürfte: die kalte, aber unter Sonnenlicht glitzernde Haut, das Fehlen des Herzschlags und der Notwendigkeit zu atmen (obwohl sie es tun, um besser riechen zu können; vgl. Meyer 2006, S. 354), die außerordentliche Schnelligkeit, Geschicklichkeit und Stärke, die ausgeprägten Sinnesorgane und die Unfähigkeit zu schlafen. Besonders augenfällig dürfte über einen Zeitraum hinweg der fehlende Alterungsprozess sein. Vampire kopieren menschliche Verhaltensmuster, wobei die Tatsache, dass sie äußerlich nicht altern, sie spätestens alle paar Jahre zu einem Wohnortwechsel zwingt, um unter den Menschen kein Aufsehen zu erregen. Nach den Vorstellungen der Soziobiologie und evolutionären Psychologie basieren interpersonale Handlungen auf dem Prinzip der Reziprozität. Da dieser Austausch oder die Gegenleistung selten zeitlich kongruent ablaufen, muss der Gebende, der in Vorleistung geht, möglichst sicherstellen, dass seine Tat tatsächlich „entlohnt“ und er nicht ausgebeutet wird. Menschen haben sich im Laufe der Evolution Mechanismen zu eigen gemacht, die es ihnen ermöglichen, mit diesem „adaptiven Problem“ umzugehen. Eine lange persönliche Kenntnis des Gegenübers und häufiger Kontakt können solche Stabilitätsfaktoren sein (vgl. Voland 2007a, S. 18ff.; Buss 2004, S. 335ff.). Derart kontinuierliche Kontakte mit Menschen als Stabilitätsfaktoren werden von Meyers Vampiren gemieden, da nur eine exzellente Tarnung den Fortbestand des Vampirismus garantiert und Unauffälligkeit das Erfolgsprinzip des vampirischen Überlebens in der Gesellschaft ist. Die Tarnung gewährt zusätzlich die Möglichkeit, sich weitgehend ungeniert und unerkannt zu „vermehren“, ein Problem, das nicht nur den einzelnen Menschen in Mitleidenschaft zieht, sondern die gesamte Sozietät, wie es Clemens Ruthner zutreffend formuliert:

388

Tina Schneider

Besteht doch die wahre Gefährdung durch den rumänischen Vampirgrafen nicht allein in der Usurpation einzelner Frauenkörper, sondern in der unheimlich effektiven Fortpflanzung der Untoten via Biß. Aus individueller (krypto-)sexueller Belästigung und parasitärer Ausbeutung wird kollektive Gefährdung. Dies läßt befürchten, daß gemäß der Darwin’schen Lehre vom ‚survival of the fittest‘ die Vampirspezies eines Tages die Menschheit verdrängen wird – eine Horrorvision Stokers, die mit einem um 1900 vorherrschenden Kulturpessimismus und Sozialbiologismus korrespondiert (Ruthner 2005, S. 30f.).

Die Überlegungen von Ruthner sind zwar nachvollziehbar, denn die Vampire sind den Menschen in nahezu allen Disziplinen überlegen, aber nicht bis zu Ende gedacht: Der Parasit achtet darauf, seine potenziellen Wirte nur insoweit zu schädigen, dass diese sein Parasitentum in der Summe verkraften können, sonst beraubt er sich selbst seiner Nahrungsquelle und (im Falle der Vampire) sogar seiner Reproduktionsmöglichkeit. Diese Selbstkontrolle entspricht der evolutionär stabilen Strategie und garantiert ein langes, in diesem Fall sogar ewiges Leben. Zeigen sich Vampire unmäßig bei ihrer Blutbeschaffung, dann erregen sie nicht nur unerwünschte Aufmerksamkeit, sondern dezimieren die Zahl ihrer Ressourcen überproportional und erhöhen damit gleichzeitig ihre eigenen Nahrungskonkurrenten, indem sie neue Vampire zeugen. Evolutiv würde sich also ein Gleichgewicht zwischen Vampiren und Menschen einpendeln, außer Vampire modifizieren ihre Ernährungsgewohnheiten. Die Cullens haben sich hervorragend in die menschliche Gesellschaft eingefügt und agieren wie gänzlich normale, unauffällige Kleinstädter: Der Vater Carlisle arbeitet als Arzt im städtischen Krankenhaus, die „Kinder“ besuchen die Schule und lieben wie alle Teenager schnelle Autos, lässige Klamotten und coole Musik. Ihren Reichtum demonstrieren sie – abgesehen von den Autos – in der Öffentlichkeit nur wenig und versuchen bei den Mitbewohnern von Forks keinen Neid zu schüren. Von Edward wissen wir, dass er aufgrund seiner außergewöhnlichen Fähigkeit, die „inneren Stimmen“ der Menschen zu hören, für seine Familie eine Art Wächterfunktion einnimmt, um diese vor der Enttarnung zu schützen. Ganz anders die herrschende Volturi-Familie: Die Volturis tarnen sich, indem sie öffentliche Auftritte meiden. Die Stadt verlassen sie so gut wie nie und lassen sich „ihre Nahrung [sprich: Menschen; T. S.] von außen bringen, manchmal von weit her. Auf diese Weise haben die Wachen etwas zu tun, wenn sie nicht gerade Abtrünnige liquidieren oder Volterra vor Verrat schützen“ (Meyer 2007, S. 428f.). Mit einem solchen Verhalten gelingt es den Vampiren über einen langen Zeitraum hinweg, sich vor einer Entdeckung und möglicherweise konzertierten Ausrottungsaktion zu schützen. Die uns in der Literatur begegnenden Vampire treiben Intrige, Betrug und Täuschungen auf die Spitze, da diese ihr Daseinsprinzip bilden. Es geht den Vampiren nicht um eine Vernichtung der Menschen, denn davon hätten

Welterfolge von „All-Age-Titeln“

389

sie à la longue keine Vorteile, sondern um deren immerwährende Ausbeutung – eine Situation, die wesentlich dramatischer ist, weil die Vampir-Herrschaft nicht, wie etwa die eines Politikers, irgendwann zu einem natürlichen Ende kommt. Nur die geschickte Dissimulation der Vampire lässt die menschlichen Figuren in den Romanen weiterhin ruhig und ahnungslos durchs Leben wandeln (vgl. von Matt 2002, S. 8f.; Simonis 2005, S. 193). Unter den Vampiren herrschen, ähnlich mafiösen Strukturen, ein Ehrenkodex und interne Spielregeln, deren oberstes Gebot der absolute Gehorsam ist. Bestrafungsaktionen fallen unmittelbarer und härter aus als in einer demokratischen Gesellschaft mit einer Jurisdiktion. Betrug, Intrige und Parasitentum gegenüber den anderen (in diesem Fall den Menschen) werden sanktioniert, gruppeninternes Betrügen und „Trittbrettfahren“ werden, so widersinnig vordergründig das erscheinen mag, bestraft. Das Prinzip des reziproken Altruismus gilt also ebenso für die Vampir-Welt.

III. Über das „Tier“ im Menschen Sich die Freiheit zu nehmen, seinen Trieben und Instinkten nachzugehen, soziale Reputation, Pflichten, Normen und Verantwortung hintanzustellen, hat für den Menschen – zumindest als theoretisches Modell – etwas BerückendFaszinierendes. Dies mag einerseits daran liegen, dass man es hier mit einem universell gültigen Muster zu tun hat, das alle Menschen aus allen Kulturkreisen und zu jeder Zeit vereinigt, und andererseits daran, dass dieses Prinzip in hominiden Gesellschaften bis auf Einzelfälle nie durchgängig praktiziert werden könnte und wird. Vampirismus verweist, so wie andere Monstertheorien, auf die evolutiven Vorläufer der Menschheitsgeschichte und betont die nach wie vor vorhandene animalische Komponente des Menschen, oder, wie es der Hirnforscher Gerhard Roth ausdrückt: „[D]er Mensch ist ja auch ein Raubtier. Da kommt die unterste Sohle zum Vorschein, wie Freud das so treffend ausgedrückt hat.“ (Roth 2007).28 Gleichzeitig entwickelten sich über Jahrtausende hinweg soziale Strukturen, die den Menschen existenzielle Überlebens- und Reproduktionsvorteile verschafften. Das Sozietätsprinzip war aber nicht „umsonst“ zu bekommen, da sich eine Ansammlung von ausschließlich triebgesteuerten, egoistischen Individuen schwerlich gemeinsamen Zielen unterordnen und – wenn nötig – die eigenen Befindlichkeiten zurückstellen würde. Die phylogenetisch neuere Kapazität, in einer Gruppe agieren zu können, sich altruistisch und empathisch zu verhalten, machte Ho-

28 Vgl. auch Brittnacher 1994, S. 219; Schlinter 2007, S. 23; zum Thema unterschiedliche Formen der Triebsteuerung bei den Geschlechtern vgl. Baron-Cohen 2004; Brizendine 2007; BischofKöhler 2004.

390

Tina Schneider

miniden zu erfolgreichen Teamplayern. Dennoch existiert der andere Teil nach wie vor und fordert seinen Tribut.29 Ein zentraler inhaltlicher Fokus beim Vampirismus hängt mit dem Blutsaugen zusammen. Norbert Borrmann erinnert daran, dass das „Vampirprinzip“ ein grundmenschliches Prinzip ist. Das Baby, das sich in seinen ersten Lebensmonaten ausschließlich über das Saugen an der Mutterbrust (oder mittlerweile der Flasche) ernährt, legt den Grundstein für ein später zwar abgeschwächtes, aber immer noch zentrales orales Verhalten (vgl. Borrmann 1999, S. 9ff.). Die Lust, etwas in den Mund zu nehmen, es zu schmecken und gegebenenfalls zu schlucken, hält ein Leben an. Das Saugen des Blutes ist weit mehr als reine Nahrungsaufnahme, es greift auf die orale Phase frühkindlicher Versorgung zurück, die sich in sexuellen Handlungen – angefangen beim Kuss bis hin zum Oralverkehr – stetig wiederholen. „Blut ist ein ganz besondrer Saft“, so begründet Mephisto Faust gegenüber die Tatsache, dass er ihre Abmachung nicht mit Tinte und Feder unterschrieben sehen will, und demonstriert hiermit die jahrtausendwährende Bedeutsamkeit des Blutes für Menschen und Nicht-Menschen (Goethe 1895, S. 67).30 Speichel oder andere Sekrete erreichten niemals auch nur ansatzweise eine vergleichbare Wichtigkeit. Blut wurde mit Identität, mit Familienoder engsten Freundschaftsbanden, mit Erbrecht und im Dritten Reich mit „Reinheit“ oder „Unreinheit“ gleichgesetzt (Blutlinien, Blutsbrüder, „arisches Blut“, „Blutschande“, „Blut und Boden“). Blutzirkulation verhieß Leben, alles andere war der Tod. Erst die Genetik und die Erkenntnisse der Neurologie haben Blut auf einen weniger bedeutsamen Platz verwiesen. Da dieses Wissen jedoch erst seit ein paar Jahrzehnten existiert, konnte sich die Idee der eminenten Bedeutung des Blutes über Jahrtausende verfestigen – u.a. auch deswegen, weil die Medizin keine Hilfe bei eklatantem Blutverlust kannte und es so eine sichtbare Korrelation zwischen Blut und Leben und Blutverlust und Tod gab, während anderes Organversagen schwer von außen zu erkennen war. Daher kann und muss das Bluttrinken als ein elementar archaischer Akt verstanden werden, der einerseits Leben spendet und andererseits Macht und Einfluss über den anderen generiert (vgl. Meurer und Richarz 2005, S. 22; Thorne 2002, S. 178ff.). Klassischerweise beißt ein Vampir sein Opfer in die Kehle und an keine andere Körperstelle, um seinen Blutdurst zu stillen, die zentrale Stelle, die sich auch Raubtiere aussuchen, wenn sie ihre Beute erlegen wollen. Die Arteria carotis liegt relativ nah 29 Hintergrundinformationen und Sekundärliteratur zu dem Themenkomplex: Schneider 2009, Kap. 3.2. „Die Entwicklung zum Homo sapiens und seine neurologische Ausstattung“ , S. 160ff., sowie Kap. 3.7. „Soziale Gemeinschaften“, S. 232ff. 30 Ausführliches zum Thema Blut findet sich in Bradburne 2001. Die inhaltliche Bandbreite des Bandes reicht von Blutmetaphorik in der christlichen Ikonographie über die Heiratspolitik der Habsburger bis hin zu Blutkrankheiten. Zeitlich wird der Bogen von der Antike bis zur Gegenwart geschlagen.

Welterfolge von „All-Age-Titeln“

391

an der Hautoberfläche und führt hinreichende Mengen Blut, so dass nach dem Zubeißen eine schnelle und zielsichere Bewegungsunfähigkeit des Opfers gegeben ist. Zudem übernimmt die Kehle in den Gruppen der Felidae und Caniden eine Signalfunktion: Wird sie bei (spielerischen) Auseinandersetzungen innerhalb der Spezies gezeigt, deutet das auf Unterwerfung und Kapitulation hin und löst bei dem überlegenden Part eine Beißhemmung aus. Vampire sind Metaphern des Blutsaugens, sie verheißen den irdischen Tod und gleichzeitig das ewige Leben – allerdings in einer höchst unchristlichen Variante. Die eigene Sterblichkeit wird durch das Geben des eigenen Bluts überwunden, und der Angst vor dem Ende ein lustvoller Konterpart entgegengesetzt. Die Vorstellung, sich das ewige Leben – besser noch die ewige Jugend – sichern zu können, wurde in zahlreichen Variationen literarisch verarbeitet. Vampire „leben“ das ewige Leben vor und werden daher ambivalent rezipiert: als Schreckensgestalten, als todbringende Untote und Verdammte, die sich Herrschaft über Mensch und Tier verschaffen, und als Türöffner für das ewige Leben, als Verführer, als Sinnbild einer „verzehrenden“ Leidenschaft und Sexualität.31 Der laszive, männermordende „Vamp“ lehnte daran seine Bezeichnung an. Aus menschlich-sterblicher Perspektive üben sie einen ungeheuren Reiz aus. Den eigenen animalischen Trieben freien Lauf zu lassen, ohne an langfristige Partnerselektionsstrategien zu denken und ohne sich über mögliche Konsequenzen den Kopf zu zerbrechen, fasziniert Männer wie Frauen gleichermaßen. Ein Vampir ist nie ein adäquater Partner, daher stellt sich eine solche Option erst gar nicht, er oder sie sind nie als potenzielle/r Vater / Mutter des eigenen Nachwuchses gedacht (bzw. können normalerweise keinen zeugen oder gebären), sie leiden nicht unter Liebe und Eifersucht, man kann sie nicht verletzen oder missbrauchen. Kurz: Man kann als Mensch in der (sexuellen) Begegnung mit dem Vampir seine verhaltensregulierenden Mechanismen quasi „ausschalten“ und sich gänzlich der eigenen Libido hingeben. In der weltlichen Literatur wird der Preis, den man dafür zu bezahlen hat, meistens nicht als zu hoch für die Gegenleistung Lust und ewiges Leben eingeschätzt. Selbst der Schmerz, den man durch den Biss eines Vampirs erleidet, löst bis zu einem gewissen Maß Lust aus – keine literarische Verbrämung oder reine Sadomaso-Fantasie, sondern anscheinend biologische Realität.32 Sich mit einem Vampir einzulassen, bedeutet also auch, sein 31 Der Themenkomplex Vampire und Sexualität im engeren und weiteren Rahmen wird von nahezu jeder Untersuchung zu diesem Thema behandelt (vgl. Meurer und Richarz 2005; Jones 2005, S. 226ff.; Brittnacher 1994, S. 117ff., 181ff.; Ruthner 2005, S. 33ff.; Thorne 2002; Lecouteux 2001; Gelder 1994; Borrmann 1999, S. 224ff.). 32 Forscher um David Borsook haben bereits 2001 festgestellt, dass schmerzhafte Stimuli (in dem Versuchsfall war es Temperatur) dieselben Gehirnstrukturen aktivieren wie Vergnügen bereitende (vgl. Borsook et al. 2001).

392

Tina Schneider

ungeschminktes Ich, sein Alter Ego, das weder vernünftig und überlegt noch altruistisch und willensstark ist, ans Tageslicht (passender: an den Mondschein) zu lassen. De l’Autre à un autre soi-même, so der Titel der Dissertation von Sabine Jarrot (1999): Der Vampir wandelt sich von dem anderen Wesen zu einem anderen Teil des eigenen Ich. Dies sichert der Vampir-Literatur über Epochen hinweg eine begeisterte Leserschaft, die ebenso gerne bereit wäre, das gesellschaftlich gepflegte Korsett fallen zu lassen, ungehemmt, ja hemmungslos zu sein und ihre tierischen Instinkte, die ebenfalls – wenn auch überdeckt – sehr menschliche sind, virtuell „auszuleben“.33 Noch animalischer als der Vampir, der „Snob unter den Monstern“ (Brittnacher 1994, S. 130)34, präsentiert sich der Werwolf, der ein für einen gewissen Zeitraum transformierter Mensch ist und kein Untoter. Die sexuelle Konnotation des Werwolf-Mythos hebt das Hemmungslos-Bestialische noch stärker hervor als dies beim Vampir-Mythos der Fall ist. Kann man den Vampir noch als Feingeist in Fragen der Erotik bezeichnen, hält sich der Werwolf nicht mit Umwegen oder langem Vorgeplänkel auf. Sexuelle Begierden werden schneller, härter und unmittelbarer ausgelebt als bei einem Vampir, selbst wenn Jacob, Meyers Werwolf-Protagonist, nur zu den zahmeren Jung-Werwölfen gehört. Schon die unterschiedliche Körpertemperatur, bei dem Werwolf um die 42° Celsius (vgl. Meyer 2007, S. 343), bei dem Vampir eiskalt, indiziert die Variationsbreite der Heißblütigkeit.35 Diese Situation spiegelt sich in einigen Handlungselementen der Beziehung von Bella zu ihrem Werwolf-Freund Jacob wider, in denen beide nur noch hormongesteuert handeln und ihre regulierenden Steuerzentren im präfrontalen Kortex, die empathisch ausgerichtete Theory of Mind, scheinbar ausgeschaltet haben. Diese für den rational agierenden Menschen fast erschreckende Vision hat gleichzeitig eine bestechende Komponente: Alle Zwänge werden – zumindest imaginativ – abgeworfen, und zurück bleibt der nackte, atavistisch triebhafte Mensch, dessen Handlungen sich ebenso den moralischen Kategorien entziehen wie die der Tiere oder Pflanzen. Sie fühlen sich frei im ursprünglichsten aller Sinne. Monstergeschichten sprechen von der Sehnsucht nach einer archaischen Kraft, die es erlaubt, sich anzueignen, was man begehrt, den zivilisationsgeschichtlich nur un33 Vgl. Simonis 2005, Kap. 6: „Deviante Liebe und Sexualität, Tabubrüche, Metamorphosen, Grenzüberschreitungen und Passageriten in der phantastischen Literatur“ , S. 163ff.; McMahon 2010, S. 119–132; Voland 2007b. 34 Brittnacher erwähnt, dass sich unter den literarischen Vampir-Figuren rund 70% Aristokraten befinden und weitere 20% Mitglieder des gehobenen Bildungsbürgertums wie Ärzte, Architekten oder Börsenmakler. In der Bis(s)-Reihe ist es zumindest bei den „guten“ Vampiren nicht anders: Carlisle praktiziert als Arzt, Edward hat anscheinend ebenfalls zwei medizinische Abschlüsse, die er allerdings aufgrund seines jugendlichen Aussehens praktisch nicht nutzen kann (vgl. Brittnacher 1994, S. 130). 35 Heather Schell hat einen interessanten Aufsatz vorgelegt, in dem sie über die in Literatur und Film dargestellte Maskulinität von Werwolfmännern räsoniert (vgl. Schell 2007).

Welterfolge von „All-Age-Titeln“

393

terdrückten, nicht wirklich beseitigten Einverleibungsgelüsten rabiat zum Ausdruck zu verhelfen. Sie fassen die Sehnsucht ins Wort, moralische Aporien, soziale Konflikte und unvermeidliche Kompromißbildungen nicht länger hinnehmen zu müssen, sondern durch Möglichkeiten brachialer Konfliktlösung ersetzen zu können. (Brittnacher 1994, S. 219)

Die von Hans Richard Brittnacher gelieferte prägnante Zusammenfassung der Gründe für die unbedingte Attraktivität dieses Genres stimmt lediglich in einem Punkt mit den Erkenntnissen der heutigen Forschung nicht überein: Die das Verhalten steuernden menschliche Kräfte sind nicht nur Produkt eines ontogenetischen Zivilisationsprozesses, sondern können neurologischen Korrelaten zugeordnet werden, was konkret bedeutet, dass der Mensch mit beiden Aspekten auf die Welt kommt, dem archaisch-triebhaften und dem regulierend-vorausschauenden. Normalerweise werden diese divergierenden Verhaltenstendenzen nicht nach außen hin sichtbar, das Verhalten erscheint in sich kongruent, da der Konflikt personenimmanent abläuft, selten verbalisiert oder ausgelebt wird. Dennoch kennen Realität und Literatur eine bemerkenswerte Fülle von Fällen, in denen Menschen bzw. Figuren à la Dr. Jekyll und Mr. Hyde mehrere Aspekte ihres Charakters und Verhaltens unabhängig voneinander zum Ausdruck bringen. Triebhafte Exzesse virtuell auszuleben, ohne Sanktionen oder negative Konsequenzen befürchten zu müssen, scheint glücklicherweise die Menschen, abgesehen von wenigen Ausnahmen, ähnlich zu befriedigen wie ein reales Erleben, vielleicht sogar noch mehr, weil immer das Bewusstsein der eigenen Sicherheit gegeben ist. Die „Altmeister“ der Evolutionspsychologie, John Tooby und Leda Cosmides, vertiefen diesen Aspekt, indem sie in der hominiden Evolutionshistorie Ursachenforschung betreiben. Sie vermuten, dass zahlreiche Adaptionen in der heutigen Welt überflüssig (und zuweilen auch schädlich) und daher oftmals schwer zu erklären sind, weil sie sich in einer konkreten (nicht mehr gegebenen) situativen Umwelt entwickeln konnten, in der sie ihren Trägern zu einem Überlebens- oder Reproduktionsvorteil verhalfen. Dies würde beispielsweise auch der Überrepräsentation bestimmter Elemente in populären Medien entsprechen wie „attacks by predatory nonhumans, chase scenes, physical violance and blood revenge“ (Tooby und Cosmides 2001, S. 22), alles Aspekte aus der Evolutionsgeschichte, denen sich über Jahrtausende hinweg Jäger- und Sammler-Kulturen ausgesetzt sahen. So könnte die Abscheu-Liebe für King Kong, mutierte Rieseninsekten, gigantische Haie oder anthropomorphe Gestalten, die aber letztlich von ihrem Wesen wenig oder nichts mit menschlichem Verhalten und Denken gemein haben, erklärt werden. Vampire und Werwölfe zählen eindeutig in diese Kategorie. Nur bleibt die Frage bestehen: Hat sich die Adaption, sich mit solchen „Lebewesen“ zu beschäftigen, entwickelt, weil es tatsächlich Tier- und / oder Menschenähnliche dieses Ausmaßes und dieser Gefährlichkeit gab oder handelt

394

Tina Schneider

es sich um das, was die Psychologen als „supra-normalen Stimulus“36 bezeichnen? Brittnacher fasst zutreffend zusammen, dass Darwins Evolutionstheorie zu einem anderen Selbstverständnis des Menschen und seiner psychischen Konstitution geführt hat: Mit dem Darwinismus wird die Welt wieder Natur, er ist die biologistische Bestätigung von der Vorstellung eines entgötterten, ausschließlich physischen Universums. Der Darwinismus rehabilitiert mit dem Tier, das dem Menschen artverwandt ist, auch das Tier im Menschen. Zwar gewinnt das Monstrum nicht an ästhetischer Dignität, wohl aber an Selbstverständlichkeit. (Brittnacher 1994, S. 194)

Im Fall von Edward und Jacob gewinnen die „Monster“ sogar an ästhetischer und ethischer Dignität.

Literaturverzeichnis Barber, Paul, „The real vampire: Forensic pathology and the lore of the undead“, in: Natural History 99/10 (1990), S. 75–82. Bardola, Nicola, Bestseller mit Biss. Liebe, Freundschaft und Vampire – alles über die Autorin Stephenie Meyer, München: Heyne, 2009. Baron-Cohen, Simon, Vom ersten Tag an anders. Das weibliche und das männliche Gehirn, Düsseldorf: Walter, 2004. Beckett, Sandra, Crossover Fiction. Global and Historical Perspectives, New York: Routledge, 2009. Benecke, Mark et al., Natürliche Leichenerscheinungen als Ursprung des Vampirglaubens, Abstract Nr. 47, Frühjahrstagung der Deutschen Gesellschaft für Rechtsmedizin, Juni 2004. Bischof-Köhler, Doris, Von Natur aus anders. Die Psychologie der Geschlechtsunterschiede, Stuttgart: Kohlhammer, 22004. Borrmann, Norbert, Vampirismus oder die Sehnsucht nach Unsterblichkeit, Kreuzlingen, München: Hugendubel/Diederichs, 1999. Börsenverein des Deutschen Buchhandels e.V. / Arbeitskreisgemeinschaft von Jugendbuchverlagen e.V. (in Zusammenarbeit mit GfK und Sinus) (Hg.), Kinder- und Jugendbücher. Einblicke in die Lebens- und Lesewelten relevanter Zielgruppen, 2010. Borsook, David et al., „Reward Circuitry Activation by Noxious Thermal Stimuli“, in: Neuron 32 (2001), S. 927–946. Bradburne, James, Blut. Kunst, Macht, Politik, Pathologie, München: Prestel, 2001. Brizendine, Louann, Das weibliche Gehirn. Warum Frauen anders sind als Männer, Hamburg: Hoffmann & Campe, 2007. Brittnacher, Hans Richard, Ästhetik des Horrors. Gespenster, Vampire, Monster, Teufel und künstliche Menschen in der phantastischen Literatur, Frankfurt/M.: Suhrkamp, 1994. Buss, David, Evolutionäre Psychologie, 2., aktualisierte Auflage, München: Pearson Studium, 2004. 36 Vgl. Nesse und Williams 1997, S. 172f.; Schwab 2004, S. 157ff.; Schwender 2001; Eibl 2004; Jones 2005; Voland 2007b.

Welterfolge von „All-Age-Titeln“

395

Carroll, Larry, „‚Twilight‘ Tuesday: Stephenie Meyer Says She May Revisit ‚Twilight‘ Universe Someday“, 5.8.2007: www.mtv.com/movies/news/articles/1592141/story. jhtml. Copper, Basil von, Der Vampir in Legende, Kunst und Wirklichkeit [1973], Leipzig: Festa, 2007. Diamond, Jared, Warum macht Sex Spaß? Die Evolution der menschlichen Sexualität [1998], München: Goldmann, 2000. Dunbar, R. I. M. / Louise Barrett (Hg.), Oxford Handbook of Evolutionary Psychology, New York: Oxford University Press, 2007. Eibl, Karl, Animal Poeta. Bausteine einer biologischen Kultur- und Literaturtheorie, Paderborn: mentis, 2004. Falconer, Rachel, The Crossover Novel. Contemporary Children’s Fiction and Its Adult Readership, New York: Routledge, 2009. Frenschkowski, Marco, „Keine spitzen Zähne. Von der interkulturellen Vergleichbarkeit mythologischer Konzepte: das Beispiel des Vampirs“, in: Poetische Wiedergänger. Deutschsprachige Vampirismus-Diskurse vom Mittelalter bis zur Gegenwart, hg. von Julia Bertschik und Christa Agnes Tuczay, Tübingen: Francke, 2005, S. 43–59. Gansel, Carsten, Moderne Kinder- und Jugendliteratur. Ein Praxishandbuch für den Unterricht, Berlin: Cornelsen, 22001. Gelder, Ken, Reading the Vampire, London: Routledge, 1994. Gladwell, Malcolm, Blink! Die Macht des Moments, München: Piper, 2007. Goethe, Johann Wolfgang von, Faust I, in: Goethes Werke. Bd. 3, Gera: C. B. Griesbach, 1895. Gottschall, Jonathan et al., „Sex differences in mate choices criteria are reflected om folktales from around the world an in historical European literature“, in: Evolution and Human Behavior 25/2 (2004), S. 102–112. Hassebrauck, Manfred / Beate Küpper, Warum wir aufeinander fliegen. Die Gesetze der Partnerwahl, Reinbek: Rowohlt, 2002. Heineck, Guido, „Up in the Skies? The Relationship between Body Height and Earnings in Germany“, in: Labour: Review of Labour Economics and Industrial Relation 3 (2005), S. 469–489. Hejj, Andreas, Traumpartner. Evolutionspsychologische Aspekte der Partnerwahl, Berlin, Heidelberg: Springer, 1996. Hövelmann, Gerd, „Wissenschaftliche Vampir-Literatur. Eine bibliographische Heimsuchung“, in: Zeitschrift für Anomalistik 7 (2007), S. 205–235. Housel, Rebecca / Jeremy Wisnewski (Hg.), Die Philosophie in „Twilight“, Weinheim: Wiley-VCH, 2010. International Chart, „US Bestsellers. Meyer takes bite out of US“, in: The Bookseller, 9.1.2009, S. 16. Jaffé, Philip D. / Frank DiCataldo, „Clinical vampirism: blending myth and reality“, in: Bulletin of American Academy of Psychiatry and the Law 22/4 (1994), S. 533–544. Jarrot, Sabine, Vampire: de L’Autre à un autre soi-même. L’étude des mutations des caractéristiques du vampire littéraire du XIXe au XXe siècle comme appréhension de l’évolution de la société, Lille: Atelier National de Reproduction des Thèses, 1999. Jones, Gerard, Kinder brauchen Monster. Vom Umgang mit Gewaltphantasien [2003], Berlin: Ullstein, 2005.

396

Tina Schneider

Kappeler, Peter, Verhaltensbiologie, Heidelberg: Springer, 2006. Lecouteux, Claude, Die Geschichte der Vampire. Metamorphose eines Mythos, Düsseldorf, Zürich: Patmos/Artemis & Winkler, 2001. Lehtinen, Katri, „Twentieth-Century Vampire Literature: Intimation of Evil and Power“, in: This Thing of Darkness. Perspectives on Evil and Human Wickedness, hg. von Richard Paul Hamilton und Margaret Sönser Breen, Amsterdam, New York: Rodopi, 2004, S. 1–19. Matt, Peter von, Ästhetik der Hinterlist. Zur Theorie und Praxis der Intrige in der Literatur, München: Carl Friedrich von Siemens Stiftung, 2002. McMahon, Jennifer: „Ein Idol im Zwielicht: die fatale Anziehungskraft von Vampiren“, in: Die Philosophie in „Twilight“, hg. von Rebecca Housel und Jeremy Wisnewski, Weinheim: Wiley-VCH, 2010, S. 119–132. Mellmann, Katja, „Vorschlag zu einer emotionspsychologischen Bestimmung von ‚Spannung‘“, in: Im Rücken der Kulturen, hg. von Karl Eibl, K. Mellmann und Rüdiger Zymner, Paderborn: Mentis, 2007, S. 241–268. Menninghaus, Winfried, Das Versprechen der Schönheit [2003], Frankfurt/M.: Suhrkamp, 2007. Meurer, Hans / Klaus Richarz, Von Werwölfen und Vampiren. Tiere zwischen Mythos und Wirklichkeit, Stuttgart: Franckh-Kosmos, 2005. Meyer, Stephenie, Bis(s) zur Mittagsstunde, Hamburg: Carlsen, 2007. –, Bis(s) zum Abendrot, Hamburg: Carlsen, 2008 (= 2008a). –, Breaking Dawn, London: Little, Brown and Company, 2008 (= 2008b). –, „Cover Girl Stephenie Meyer. An Interview (Part One),“ in: All things girl (19.5.2008), 31.3.2009: http://allthingsgirl.net/everythinggirl/sacrifice-mayjune-2008/cover-girlstephenie-meyer-an-interview-part-onewith-deb-smouse/ (= 2008c). –, Bis(s) zum Morgengrauen [2006], Hamburg: Carlsen, 2008 (= 2008d). –, Bis(s) zum Ende der Nacht, Hamburg: Carlsen, 2009. –, Bis(s) zum ersten Sonnenstrahl: Das kurze zweite Leben der Bree Tanner, Hamburg: Carlsen, 2010. Nesse, Randolph M. / George C. Williams, Warum wir krank werden. Die Antworten der Evolutionsmedizin, München: C.H. Beck, 1997. Radkowsky, Britta, Moderne Vampyre. Mythos als Ausdruck von Persönlichkeit, Neusäß: Ubooks, 2005. Roth, Gerhard, „Das Ich ist eine Einbahnstraße“, in: Spiegel 35 (2007), S. 127. Rushton, J. Philippe, Rasse, Evolution und Verhalten. Eine Theorie der Entwicklungsgeschichte, Graz: Ares, 2005. Ruthner, Clemens, „Untote Verzahnungen. Prolegomena zu einer Literaturgeschichte des Vampirismus“, in: Poetische Wiedergänger. Deutschsprachige Vampirismus-Diskurse vom Mittelalter bis zur Gegenwart, hg. von Julia Bertschik und Christa Agnes Tuczay, Tübingen: Francke, 2005, S. 11–41. Schell, Heather, „The Big Bad Wolf: Masculinity and Genetics in Popular Culture“, in: Literature and Medicine 26/1 (2007), S. 109–125. Schlinter, Isabella, „Begehrt und bedroht – die untoten Geliebten“, in: 1001 und 1 Buch 1 (2007), S. 22f.

Welterfolge von „All-Age-Titeln“

397

Schneider, Bettina Franziska, Zwischen Klassiker und Bestseller – erfolgreiche Kinder- und Jugendliteratur in evolutionspsychologischer Perspektive, Gießen 2009 (Giessener Elektronische Bibliothek 2010: http://geb.uni-giessen.de/geb/volltexte/2010/7818/). Schneider, Tina, „Von ‚Harry Potter‘ zu ‚House of Night‘ – All Age in aller Munde: aktuelle Marktentwicklung in der Kinder- und Jugendliteratur“, in: Zwischen didaktischem Auftrag und grenzüberschreitender Aufstörung? Aktuelle Entwicklungen in der (deutschsprachigen) Kinder- und Jugendliteratur, hg. von Carsten Gansel und Pawel Zimniak, Heidelberg: Winter (im Erscheinen, voraussichtlich 2011). Schumacher, Rob, „Author of the year. Stephenie Meyer“, in: USA Today (28.12.2008), www.usatoday.com/life/books/2008-12-17-meyer-10picks_N.htm. Schwab, Frank, Evolution und Emotion. Evolutionäre Perspektiven in der Emotionsforschung und der angewandten Psychologie, Stuttgart: Kohlhammer, 2004. Schwender, Clemens, Medien und Emotionen: evolutionspsychologische Bausteine einer Medientheorie, Wiesbaden: Deutscher Universitätsverlag, 2001. Sellers, John, „New Stephenie Meyer Novella Arriving in June“, in: Publisher’s Weekly (30.3.2010), http://www.publishersweekly.com/pw/by-topic/childrens/childrensbook-news/article/42636-new-stephenie-meyer-novella-arriving-in-june.html. Simonis, Annette, Grenzüberschreitungen in der phantastischen Literatur, Heidelberg: Winter, 2005. Stamer, Dunja, „,Biss…‘ – Warten auf den Einen“, in: ZDF heute journal (15.3.2009), 16.3.2009: www.zdf.de/ZDFmediathek/content/714858?inPopup=true. Stapley, Joanne, „What is young adult fiction?“ in: Young Adult Fictions Assignment, 12.3.2009: http://novelnovicetwilight.files.wordpress.com/2008/07/young-adultfictions-assignmen.pdf. Strauch, Barbara, Warum sie so seltsam sind. Gehirnentwicklung bei Teenagern, Berlin: Berlin Verlag, 2003. Thöne, Leonie Viola, Die Figur Edward Cullen. Moderner Mormonen-Missionar oder VampirRomantiker?, Moers: Edition Wissenschaft, 2009. Thorne, Tony, Kinder der Nacht. Die Vampire sind unter uns, Berlin: Rütten & Loening, 2002. Tooby, John / Leda Cosmides, „Does Beauty Build Adapted Minds? Toward an Evolutionary Theory of Aesthetics, Fiction, and the Arts“, in: SubStance. A review of theory and literary criticism 94/95 (2001), S. 6–27. Trivers, Robert, „Parental investment and sexual selection“, in: Sexual selection and the descent of man: the Darwinian pivot 1871–1971, hg. von Bernard G. Campbell, Chicago: Aldine, 1972, S. 136–179. Tuczay, Agnes (Hg.), Poetische Wiedergänger. Deutschsprachige Vampirismusdiskurse vom Mittelalter bis zur Gegenwart, Tübingen: Francke, 2005. Voland, Eckart, Die Natur des Menschen. Grundkurs Soziobiologie, München: C.H. Beck, 2007 (= 2007a). –, „Virtuelle Welten in realen Gehirnen. Evolutionspsychologische Aspekte des Umgangs mit Medien“, in: Zeitschrift für Literaturwissenschaft und Linguistik 146 (2007), S. 7–22 (= 2007b). –, Soziobiologie. Die Evolution von Kooperation und Konkurrenz, Heidelberg: Spektrum Akademischer Verlag, 32009.

398

Tina Schneider

Williams, Emyr / Mandy Robins / Laura Picton, „Adolescent television viewing and belief in vampires“, in: Journal of Beliefs & Values: Studies in Religion & Education 27/2 (2006), S. 227–229.

List of Contributors

399

List of Contributors Verzeichnis der Beiträgerinnen und Beiträger BRIAN BOYD is University Distinguished Professor of English at the University of Auckland, New Zealand. ist Professor am Department of English der University of Auckland, Neuseeland. OLAF BREIDBACH is Professor of the History of Science and Director of the Institute for the History of Medicine, Science and Technology at Friedrich Schiller University Jena, Germany, as well as Director of the Museum Ernst-HaeckelHaus in Jena, Germany. ist Professor für Geschichte der Naturwissenschaften und Direktor des Instituts für Geschichte der Medizin, Naturwissenschaft und Technik der Friedrich-Schiller-Universität Jena, Deutschland, sowie Direktor des Museums Ernst-Haeckel-Haus in Jena, Deutschland. JOSEPH CARROLL is Curators’ Professor of English at the University of Missouri, St. Louis, USA. ist Professor am Department of English der University of Missouri, St. Louis, USA. STEPHANIE CATANI is Lecturer of German at the University of Bamberg, Germany. ist wissenschaftliche Mitarbeiterin am Lehrstuhl für Neuere deutsche Literaturwissenschaft an der Otto-Friedrich-Universität Bamberg, Deutschland.

400

List of Contributors

ROBERT CHARLIER is Assistant Lecturer of German Literature at the University of Potsdam, Germany. ist Literaturwissenschaftler in Berlin, Deutschland, und Lehrbeauftragter am Institut für Germanistik der Universität Potsdam, Deutschland. MATHIAS CLASEN is a PhD student at the English Department of Aarhus University, Denmark. ist Doktorand am English Department der Universität Aarhus, Dänemark. BRETT COOKE is Professor of Russian at Texas A&M University in College Station, USA. ist Professor für Russisch an der Texas A&M University in College Station, USA. KARL EIBL was, until 2008, Professor of German at Ludwig-Maximilians-Universität in Munich, Germany. war bis 2008 Professor für Neuere deutsche Literatur an der Ludwig-Maximilians-Universität München, Deutschland. FELIX FREY is Lecturer in the Department of Communication and Media Sciences at the University of Leipzig, Germany. ist wissenschaftlicher Mitarbeiter am Institut für Kommunikations- und Medienwissenschaft der Universität Leipzig, Deutschland. CARSTEN GANSEL is Professor of German as well as Literature and Media Didactics at Justus-Liebig-Universität in Gießen, Germany. ist Professor für Neuere Deutsche Literatur und Literatur- und Mediendidaktik an der Justus-Liebig-Universität Gießen, Deutschland.

List of Contributors

401

CHRISTIANE HEIBACH is Associate Professor of Literature and Media Studies at the University of Arts and Design in Karlsruhe, Germany. ist Privatdozentin für Medien- und Literaturwissenschaft und forscht derzeit an der Staatlichen Hochschule für Gestaltung in Karlsruhe, Deutschland. NORMAN KASPER is Lecturer of Comparative Literature at Martin-Luther-University in Halle, Germany. ist wissenschaftlicher Mitarbeiter am Lehrstuhl für Allgemeine und Vergleichende Literaturwissenschaft der Martin-Luther-Universität in Halle, Deutschland. WOLFRAM R. KELLER is Assistant Professor of English at Humboldt University in Berlin, Germany. ist Juniorprofessor für Englische Literatur an der Humboldt-Universität zu Berlin, Deutschland. KATJA MELLMANN is Lecturer (Dilthey Fellow) at the German Department of Georg-August-University in Göttingen, Germany. ist wissenschaftliche Mitarbeiterin (Dilthey Fellow) am Seminar für deutsche Philologie der Georg-August-Universität Göttingen, Deutschland. ANJA MÜLLER-WOOD is Professor of Anglophone Cultures at Johannes Gutenberg University in Mainz, Germany. ist Professorin für Anglophone Kulturen an der Johannes GutenbergUniversität Mainz, Deutschland. JÖRG THOMAS RICHTER is a researcher at the Center for Literary and Cultural Research in Berlin, Germany. ist wissenschaftlicher Mitarbeiter am Zentrum für Literatur- und Kulturforschung Berlin, Deutschland.

402

List of Contributors

JUDITH P. SAUNDERS is Professor of English at Marist College in Poughkeepsie/New York, USA. ist Professorin am English Department des Marist College in Poughkeepsie/New York, USA. TINA SCHNEIDER is a literary studies scholar and literary critic. ist Literaturwissenschaftlerin und -kritikerin. MICHAELA SCHRAGE-FRÜH is Lecturer of English Studies at Johannes Gutenberg University in Mainz, Germany. ist wissenschaftliche Mitarbeiterin am Department of English and Linguistics der Johannes Gutenberg-Universität Mainz, Deutschland. DIRK VANDERBEKE is Professor of English Literature at Friedrich Schiller University Jena, Germany, and at the University of Zielona Góra, Poland. ist Professor für englische Literaturwissenschaft an der Friedrich-SchillerUniversität Jena, Deutschland, und an der Universität Zielona Góra, Polen.