Meister Eckhart and Thomas of Erfurt: Modism and the Philosophy of Grammar 9789042939493, 9789042939509, 9042939494

Citation preview

ECKHART: TEXTS AND STUDIES

VOLUME 13

Meister eckhart and Thomas of erfurt modism and the philosophy of grammar EDITED BY

Markus Vinzent and Christopher M. Wojtulewicz

PEETERS

MEISTER ECKHART AND THOMAS OF ERFURT

Eckhart: Texts and Studies EDITED BY

MARKUS VINZENT (King’s College, London & Max-Weber-Kolleg, Universität Erfurt)

ADVISORY BOARD

CHRISTINE BÜCHNER (Fakultät für Geisteswissenschaften, Universität Hamburg)

MARKUS ENDERS (Theologische Fakultät, Universität Freiburg)

GOTTHARD FUCHS (Kultur-Kirche-Wissenschaft, Bistümer Limburg und Mainz)

FREIMUT LÖSER

(Philosophisch-historische Fakultät, Universität Augsburg)

DIETMAR MIETH (Katholisch-Theologische Fakultät, Universität Tübingen)

REGINA D. SCHIEWER (Sprach- und Literaturwissenschaftliche Fakultät, Katholische Universität Eichstätt-Ingolstadt)

LORIS STURLESE (Storia della filosofia medievale, Università del Salento)

RUDOLF K. WEIGAND (Sprach- und Literaturwissenschaftliche Fakultät, Katholische Universität Eichstätt-Ingolstadt)

Eckhart: Texts and Studies VOLUME 󰀁󰀃

Meister Eckhart and Thomas of Erfurt Modism and the Philosophy of Grammar

EDITED BY

MARKUS VINZENT and CHRISTOPHER M. WOJTULEWICZ

PEETERS LEUVEN — PARIS — BRISTOL, CT

󰀂󰀀󰀂󰀀

ISBN 󰀉󰀇󰀈-󰀉󰀀-󰀄󰀂󰀉-󰀃󰀉󰀄󰀉-󰀃 eISBN 󰀉󰀇󰀈-󰀉󰀀-󰀄󰀂󰀉-󰀃󰀉󰀅󰀀-󰀉 D/󰀂󰀀󰀂󰀀/󰀀󰀆󰀀󰀂/󰀁󰀃󰀄 A catalogue record for this book is available from the Library of Congress. © 󰀂󰀀󰀂󰀀, Peeters, Bondgenotenlaan 󰀁󰀅󰀃, B-󰀃󰀀󰀀󰀀 Leuven, Belgium

No part of this book may be reproduced in any form or by any electronic or mechanical means, including information storage or retrieval devices or systems, without prior written permission from the publisher, except the quotation of brief passages for review purposes.

In memoriam P. Prof. Dr. Walter Senner OP, 1948-2020

Table of Contents Abbreviations and Citation Style . . . . . . . . . . . . . . .

IX

Introduction . . . . . . . . . . . . . . . . . . . . . . . . . .

󰀁

Markus Vinzent Personal Pronouns – Thomas of Erfurt and Meister Eckhart in Erfurt and Paris . . . . . . . . . . . . . . . . . . . .

󰀁󰀁

Andrés Quero-Sánchez On Pure Reason, Abstractness, and the Relationship between Oneness and Plurality: Thomas of Erfurt and Eckhart of Hochheim’s Controversial Dialogue in Erfurt at the Turn of the 󰀁󰀄th Century . . . . . . . . . . . . . . . . . . . .

󰀂󰀉

Stephan Grotz Modistik und Metaphysik. Berührungspunkte zwischen der spekulativen Grammatik und Meister Eckharts Metaphysik

󰀅󰀃

Claire Taylor Jones Meister Eckhart and Thomas of Erfurt: the Gospel of John and the Ontology of Nouns and Adjectives . . . . . . . .

󰀆󰀉

Freimut Löser Meister Eckhart, die schuole, die Grammatik und die Bibel

󰀈󰀅

Christopher M. Wojtulewicz Deconstructing Sophisms in Meister Eckhart . . . . . . .

󰀁󰀂󰀁

Gesche Linde Peirce als Modist? Die grammatica speculativa und das Erbe Thomas von Erfurts . . . . . . . . . . . . . . . . . . . .

󰀁󰀄󰀅

VIII

T ABLE

OF CONTENTS

Andrés Quero-Sánchez Ein ,ewig Unwiderlegbares‘. Heideggers Missverständnis der averroistischen Abbildtheorie der Sprache des Thomas von Erfurt in seiner Freiburger Habilitationsschrift (Die Kategorien- und Bedeutungslehre des Duns Scotus) . . . . . Appendix Thomas of Erfurt, Commentary on Porphyry’s ›Isagoge‹ (Commentum in Isagogus Porphirii): Three Selected Passages (Edited by Andrés Quero-Sánchez) . . . . . . . . . . . . Thomas of Erfurt, Kommentar zu Porphyrios’ ›Isagoge‹ (Commentum in Isagogus Porphirii): Edition und deutsche Übersetzung des einleitenden Teils (von Andrés QueroSánchez) . . . . . . . . . . . . . . . . . . . . . . . . . .

󰀁󰀉󰀉

󰀂󰀃󰀇

󰀂󰀆󰀇

Abbreviations and Citation Style The Works of Meister Eckhart Citation of the Latin Works (LW) and German Works (DW): [Abbreviated title of the text] n. [number], LW [volume, fascicle number(s) (if applicable)] [page number(s)], [line number(s)]. Critical Edition Meister Eckhart. Die deutschen und lateinischen Werke, hg. im Auftrag der Deutschen Forschungsgemeinschaft (Stuttgart). Latin Works LW I/󰀁 LW I/󰀂 LW II LW III LW IV LW V LW VI

ed. and (German) trans. Konrad Weiß (󰀁󰀉󰀆󰀄; 󰀁󰀉󰀆󰀅). ed. Loris Sturlese (󰀂󰀀󰀁󰀅). ed. and (German) trans. Albert Zimmermann, Loris Sturlese, Konrad Weiß, Josef Koch, Heribert Fischer (󰀁󰀉󰀉󰀂). ed. Karl Christ, Bruno Decker, Josef Koch, Heribert Fischer, Loris Sturlese and Albert Zimmermann (󰀁󰀉󰀉󰀄). ed. and (German) trans. Ernst Benz, Bruno Decker, Josef Koch (󰀁󰀉󰀅󰀆; 󰀁󰀉󰀈󰀇). ed. and (German) trans. Josef Koch, Bernhard Geyer, Eric Seeberg, Loris Sturlese (󰀂󰀀󰀀󰀆). Indices in opera omnia Magistri Echardi I Die Bibel, ed. Loris Sturlese and Markus Vinzent (󰀂󰀀󰀁󰀅).

German Works DW I ed. and (German) trans. Josef Quint (󰀁󰀉󰀅󰀈; 󰀁󰀉󰀈󰀆). DW II ed. and (German) trans. Josef Quint (󰀁󰀉󰀇󰀁; 󰀁󰀉󰀈󰀈). DW III ed. and (German) trans. Josef Quint (󰀁󰀉󰀇󰀆; 󰀁󰀉󰀉󰀉). DW IV/󰀁 ed. and (German) trans. Georg Steer in collaboration with Wolfgang Klimanek and Freimut Löser (󰀂󰀀󰀀󰀃). DW IV/󰀂 ed. and (German) trans. Georg Steer in collaboration with Wolfgang Klimanek and Freimut Löser (󰀂󰀀󰀀󰀃). DW V ed. and (German) trans. Josef Quint (󰀁󰀉󰀆󰀃; 󰀁󰀉󰀈󰀇).

X

A BBREVIATIONS

AND

C ITATION S TYLE

Abbreviations AE Acta Echardiana BgT Buoch der götlîchen trœstunge Collatio Collatio in Libros Sententiarum In Eccl. Sermones et Lectiones super Ecclesiastici In Ex. Expositio libri Exodi In Gen. I Expositio libri Genesis In Gen. II Liber parabolarum Genesis In Ioh. Expositio sancti Evangelii secundum Iohannem In Sap. Expositio libri Sapientiae Pr. Predigt + Arabic numeral (German sermon) Proc. Col. I Processus Coloniensis I Proc. Col. II Processus Coloniensis II Prolog. gen. in Opus tripartitum Prologus generalis in Opus tripartitum Prolog. in Opus propositionum Prologus in Opus propositionum Quaest. Par. I Quaestio Parisiensis I Quaest. Par. II Quaestio Parisiensis II Quaest. Par. III Quaestio Parisiensis III Quaest. Par. IV Quaestio Parisiensis IV Quaest. Par. V Quaestio Parisiensis V Quaest. Par. VI Quaestio Parisiensis VI Quaest. Par. VII Quaestio Parisiensis VII Quaest. Par. VIII Quaestio Parisiensis VIII Quaest. Par. IX Quaestio Parisiensis IX Quaestio Parisiensis X Quaest. Par. X RdU Rede der underscheidunge Sermo Sermo + Roman numeral (Latin sermon) Sermo die b. Augustini Sermo die beati Augustini Parisius habitus Parisius habitus Super oratione dominica Tractatus super oratione dominica VAb Von abegescheidenheit VeM Von dem edeln menschen

Introduction

I

n the early fourteenth century Erfurt was a city of great intellectual achievement. Not only was it home to Meister Eckhart, but also the last great modist grammarian: Thomas of Erfurt. In fact, the two lived only streets from each other, Eckhart at the Dominican priory with the Predigerkirche, and Thomas at the Schottenkloster. Did they interact with one another? Were they familiar with each other’s texts? Of this we cannot be certain, but there may be indications that the well-known Dominican friar had made use of modist grammatical theory, whether seen as an adoption of it, in adaptation of it, or in criticism of it. The contributions to this volume were given as papers at a workshop in the Max Weber Center for Advanced Social and Cultural Studies at the University of Erfurt, 󰀁󰀄-󰀁󰀅th November 󰀂󰀀󰀁󰀃, under the Arts and Humanities Research Council project at King’s College London (󰀂󰀀󰀁󰀃󰀂󰀀󰀁󰀆) titled ‘Meister Eckhart and the Parisian University in the Early Fourteenth Century: Codex Vaticanus Latinus 󰀁󰀀󰀈󰀆’. The papers advance the question of influence from a range of perspectives, and indicate that the answer to the question still remains open. Eckhart and Thomas of Erfurt – Two Modes of Modism? This volume concentrates mainly on the question of whether Thomas’ speculative grammar influenced Eckhart’s thought. But it also considers whether there are any signs of Eckhart’s influence on Thomas. At the very least, these questions require greater access to the texts of Thomas of Erfurt. Although his Grammatica speculativa is well known, especially among Heidegger scholars, his other texts have yet to be edited and translated. To this end, this volume presents an edition of three selected passages from Thomas’ Commentary on Porphyry’s “Isogoge”, edited by Andrés Quero-Sánchez. The texts deal principally with the problem of the universals: are the universals restricted to the intellect, or do they

󰀂

I NTRODUCTION

exist in extra-mental reality? The status of this problem directly impacts the essential theme of the modistae: what is the relationship between the three modes (of signifying, of intellect, and of being)? In other words, what is the relationship between grammar, ideas in the mind, and extramental reality? The modistae were concerned with universal grammar, and the fundamental relationship between the modi significandi (grammatical structure) and the modi essendi (the shape of reality), arguing that the structure of linguistic formation mirrors the ontological structure of the external world. As Quero-Sánchez argues in his essay ‘On Pure Reason, Abstractness, and the Relationship between Oneness and Plurality: Thomas of Erfurt and Eckhart of Hochheim’s Controversial Dialogue in Erfurt at the Turn of the 󰀁󰀄th Century’, the Commentary on Porphyry’s “Isagoge” suggests that Eckhart and Thomas were of opposing metaphysical positions, and may even have been reacting against one another. The idea of a ‘pure reason’ for Thomas is that which distinguishes God from the creature with respect to epistemology – only God is ‘pure intellect’ because he knows without the mediation of the senses.󰀁 It is the appeal to the senses – to the creature’s way of knowing a particular, existing thing – that is crucial to Thomas’ position. This is because, as QueroSánchez shows, Thomas holds that universals are not known by abstraction only, but in recognising the real relation between the abstract idea and a concrete, particular thing that instantiates it. In other words, there is an essential link between the abstract and the concrete in the formation of a universal. One may contrast this view of Thomas with Eckhart’s understanding of the universals, which tends very much in the direction of pure abstraction, away from concrete reality. To understand this, one first needs to attend to Eckhart’s invocation of the Divine ‘purity of being’ (puritas essendi) in his first Parisian Question.󰀂 One cannot ascribe to God any being, even some maximalised version of creaturely being. And because of God’s totally non-creaturely nature, one may refer to it in any way one likes – “he does not exist” and “he is the purity of being” is to say the same thing. Now insofar as 󰀁. Thomas of Erfurt, Commentum in Isagogas Porphirii, ed. A. Quero-Sánchez, text III, lines 󰀁󰀁󰀆-󰀂󰀅. 󰀂. Quaest. Par. I n. 󰀉, LW V 󰀄󰀅,󰀁󰀀-󰀁󰀁.

I NTRODUCTION

󰀃

Divine being is viewed in this light, his intellect is to be seen in the same way (as existence and knowing are one in God).󰀃 God is ‘pure intellect’ (intellectus purus) – his being is nothing other than his knowing.󰀄 Given that Divine being does not belong in the register of creaturely categories whatever, it means concretely that Divine knowing is even ‘higher’ than existence.󰀅 In fact, anything that ‘pertains to the intellect’, Eckhart says, is of a completely ‘different categorisation’ to existence.󰀆 The question is whether all of this applies only to the Divine intellect, or to creaturely intellect also? This is not the same as asking whether the mode of knowing in creatures is the same as in God – to which Eckhart’s answer is definitively no, because our knowledge is derived from existing things (putting existence first), whereas God’s knowledge is the cause of things existing (putting intellect first).󰀇 But if intellect itself is indeed ‘higher’ than existence, it must also be true of the creature’s intellect, regardless of the mode of knowing he or she has. In fact, it may only be presumed to be higher insofar as it absconds the act of understanding – the so-called docta ignorantia – not only by moving away from knowledge of particular things and towards abstractions, but mutatis mutandis in the universally receptive nature of intellect in re. So arises the now hackneyed question of whether Eckhart thinks the intellect in the creature is the uncreated locus connecting him to God – the source of the divinising of creatures, via an Augustinian emphasis on unknowing. The real point of connection between modist theory and Eckhart is whether the latter really adopted a realist view of the world. The modist affirms the relationship, via the mind, between the grammatical structure of language, and the external world. But the intellect, for Eckhart, is the site of ideas that tend away from the reality of the world – it ‘moves towards what is opposite to particular existence’.󰀈 Although this does not necessarily entail that the structure of what is apprehended by the intellect is different to the structure of reality itself, nevertheless Eckhart’s emphasis is decidedly neo-platonic: whatever existence the real world has, it is not the same as that possessed by the intellect. Here the difference 󰀃. Quaest. Par. I n. 󰀁, LW V 󰀃󰀇,󰀄. 󰀄. In Gen. I n. 󰀁󰀆󰀈, LW I/󰀁 󰀃󰀁󰀄,󰀂-󰀅. 󰀅. Quaest. Par. I n. 󰀅, LW V 󰀄󰀂,󰀁-󰀂. 󰀆. Quaest. Par. I n. 󰀇, LW V 󰀄󰀃,󰀆-󰀇. 󰀇. Quaest. Par. I n. 󰀈, LW V 󰀄󰀄,󰀁󰀀-󰀁󰀄. 󰀈. Quaest. Par. I n. 󰀇, LW V 󰀄󰀃,󰀁󰀃-󰀁󰀄.

󰀄

I NTRODUCTION

between the being of the world and the non-being of the intellect receives sharper focus. It is not that the creature’s intellect is ‘nothing’ – ‘the intellect is a power of the soul’, Eckhart says, and therefore ‘it is something, because the soul is truly a being’.󰀉 Instead, it is “on the side” of nothing, so to speak. God’s intellect and being stands transcendently beyond the existence of the world (and so is “no-thing”). Man’s being is part of the world, but his intellect stands on the other side of the existence of the world, tending towards “nothing”. These two “nothings” are like night and day. Whatever we may say of God’s being and intellect – that it is not really being, but something higher than being – we cannot say the same of the creature’s act of understanding. The creature’s act of understanding is the opposite of God’s act of understanding, for it is ‘caused by being’ and ‘descends from being and as a result tends towards non-being’.󰀁󰀀 God’s being and intellect is an apophatic and transcendent reality beyond the world, allowing him to be the cause and source of the world’s being. The creature’s intellect, on the other hand, derives its act of understanding from the world’s being, and so is also beyond it. But this “beyond” is, as it were, the “other side” of the world’s being – in the direction of non-being. Consequently, a ‘universal is created through [an act of] understanding’, and so is ‘not a being’.󰀁󰀁 This would seem to place Eckhart firmly in the realm of nominalism. Still, it does not rule out the possibility of the world’s being impressing itself on the act of understanding. From that impression one might then argue through to the grammatical formation of sentences. But the force of Eckhart’s argument is not at this point realist, and so the old critique of modism rears its head once more: what reason is there to suppose that there exists a real relationship between the world’s being and the grammatical structure of language?󰀁󰀂 This is particularly true if the data of the world’s being is passing through the modi intelligendi, which for Eckhart is tantamount to passing through something almost non-existent, stripping it of all that would correlate the act of understanding with the real thing of which it is a likeness.󰀁󰀃 Eckhart’s view is a highly 󰀉. Quaest. Par. II, n. 󰀇, LW V 󰀅󰀃,󰀆-󰀇. 󰀁󰀀. Quaest. Par. II, n. 󰀁󰀀, LW V 󰀅󰀄,󰀄-󰀅. 󰀁󰀁. Quaest. Par. II, n. 󰀉, LW V 󰀅󰀃,󰀁󰀄. 󰀁󰀂. Mary Sirridge, ‘Thomas of Erfurt’, in Margaret Cameron, Benjamin Hill and Robert J. Stainton (eds), Sourcebook in the History of Philosophy of Language (Cham, 󰀂󰀀󰀁󰀇), 󰀂󰀉󰀅-󰀇, here 󰀂󰀉󰀆f. 󰀁󰀃. Quaest. Par. I n. 󰀇, LW V 󰀄󰀄,󰀁-󰀂.

I NTRODUCTION

󰀅

abstract one: the act of understanding dissolves the particularities of the existing thing in favour of an abstract apprehension of a universal, created by the mind. Strangely, then, Eckhart’s view of the universals and the act of understanding is not ‘platonised’ in the sense that the more abstract the thought, the more perfectly it conforms to ultimate reality (i.e. the real of forms). Instead, abstract creaturely understanding is derived from the world’s being, the latter having a greater and more primary sense of existence. On the one hand abstract thought has a kind of methodological priority in Eckhartian metaphysics (in that it is considered the very essence of the creature’s act of understanding). On the other hand, abstract thought has an objective subservience (i.e. non-being) to the existence of the world. At best we may say that the objective non-being of the creature’s act of understanding serves as an analogical point of reference to the objective ‘purity of being’ that characterises the Divine act of understanding. But in the end all of this passes, as it were, through a Platonic lens, in that God nevertheless remains the only true reality, and the mental world of the creature (the very essence of his consciousness, in fact) has but a shadowy and quasi non-existence. It is worth emphasising that this does not mean Eckhart denies the relationship between grammar and the structure of reality. But it seems clear that, assuming it to be the case, he reaches it by a very different metaphysical route to Thomas of Erfurt. It is thanks to the contributions of Andrés Quero-Sánchez that we may affirm this with greater assuredness. And it is in this light that we may assess the contributions which argue for a “modistic shape” in Eckhart’s thought. Instead of asking whether one influenced the other, we might tentatively propose the possibility of Eckhart’s and Thomas’ grammar as different iterations of a modist worldview more broadly conceived. In other words: are Eckhart and Thomas two “modes of modism”? Contributions to the volume The first essay, by Markus Vinzent, offers both a social and historical background to the relationship between Meister Eckhart and Thomas of Erfurt. Understanding the state of grammatical theories in the late thirteenth and early fourteenth centuries involves, Vinzent shows, considering the

󰀆

I NTRODUCTION

crucial role of Erfurt and its townsmen. From Heinrich of Sonneborn, and Thomas of Erfurt, through to John Aurifaber (not to be confused with his sixteenth century namesake), Erfurt was a place of important grammatical discussion by the turn of the fourteenth century. Not only this, but two of these names – Thomas of Erfurt and John Aurifaber – respectively reflect both the height of modist theory and its critical demise. Vinzent furthers our knowledge of Eckhart’s understanding of the role of the personal pronoun, situating his thoughts on the matter relative to Priscian. In this is found Eckhart’s work on the ‘pure substance’ demonstrated by the Divine use of the personal pronoun in Exodus 󰀃:󰀁󰀄. The sense in which the singularity of substance, signified by the personal pronoun, is true of both the creature and God segues into the essential question of difference between creature and Creator. To appreciate the Eckhartian nature of this distinction one must attend to the role of negation: between the “nothingness” of the creature, and the abundant affirmation that belongs to a God in whom nothingness is itself negated. God is therefore not superabundant being – or a superabundant ‘pure substance’ – if by this one means the polar opposite of a creaturely being that is almost nothing. Instead, the Divine ‘pure substance’ is what is reached through maximising the via negativa of negative, creaturely being. The sense of Divine “nothingness” is not a univocal instance of creaturely “nothingness”, but a maximising of analogical differentiation between the two: Divine “nothingness” is reached, not by moving away from creaturely “nothingness” to an external abundance, but by “passing through” creaturely “nothingness” by way of negation (the negatio negationis). This is the only way to avoid ascribing any creaturely category of superabundance to God, securing instead the apophatic nature of Divine “nothingness”. At this point, God’s being is signalled as absolutely differentiated from creaturely being. This metaphysical view of the world is then exemplified in Eckhart’s understanding of the noun and the verb, making creatures the ‘by-verb’ (bîwort) to the God in whom noun and verb are one and the same (just as his essence and existence are one and the same). Andrés Quero-Sánchez’s essay on the dialogue between Eckhart and Thomas of Erfurt has already been mentioned. Quero-Sánchez makes use of the edition of parts of Thomas’ Commentary on Porphyry’s “Isagoge”, which is given in the appendix to the volume. From this, Quero-Sánchez argues that the metaphysical positions of Eckhart and Thomas are opposed.

I NTRODUCTION

󰀇

More than this, he suggests that Eckhart was probably reacting against the position found in Thomas’ Commentary on Porphyry’s “Isagoge”. To what extent is this personally tied to Thomas? The question remains extant, for as Quero-Sánchez shows, Thomas’ position was not unique (finding it, for example, in the works of Siger of Brabant and Boethius of Dacia). We may add that this is not necessarily the same as suggesting absolute difference between Eckhart’s and Thomas’ grammatical theory. Perhaps it suggests that Eckhart’s theory is not “Thomistic” (i.e. Thomas of Erfurt’s). Quero-Sánchez concludes by saying that, because Thomas of Erfurt makes extensive use of Albert the Great, it is worth considering the extent to which Thomas iterates an Albertian philosophical theology. Stephan Grotz focuses on Eckhart’s use of grammatical forms related to his core thinking on analogy. With the example of Rudolf Carnaps ‘Logik der Syntax’, the author shows that even the most abstract grammatical forms convey meaning and sense. As indicated before, particularly Eckhart’s position that understanding presupposes a radical detachment from all creaturely being (and non-being), yet that such abstraction does not end up in any form of void, but that it is the freeing up from nothingness, makes him a particular student of modism by stretching modism which concentrates on forms to a formal modism where forms alone carry weight. Eckhart’s thinking about analogy is a case in point. Different from other modists, Eckhart is less interested in syntax and the relation between the grammatical elements of a sentence; he does not seek out to what extent adjectives relate to nouns, but he highlights that the form of an adjective is entirely derived from the related form of a noun. Consequently Eckhart develops his own formal syntax which is universal as it does not derive from singular cases, but being purely formal can be applied to all potential individual cases. Claire Taylor Jones argues that Thomas’ understanding of adjectives, and their relation to verbs, can operate as an hermeneutical principle for understanding both Eckhart’s architecture of the soul, and his understanding of justice and the just. Focussing on Eckhart’s exposition of John 󰀁:󰀁, Taylor Jones demonstrates that the relationship between ‘abstract nouns’ (such as ‘justice’) and ‘substantive adjectives’ (such as ‘the just’) can be seen to correspond to the ‘adjectival nouns’ found in Thomas of Erfurt. Taylor Jones argues that the plethora of metaphors Eckhart uses with respect to ‘justice’ and ‘the just’, God and the Word, God and the soul,

󰀈

I NTRODUCTION

are best understood via an appreciation of Thomas of Erfurt’s grammatical theory. Although this not an argument for direct influence per se, it displays a fundamental compatibility between the two figures which ought not to be obfuscated by the question of influence. Freimut Löser concentrates on Eckhart’s biblical exegesis, demonstrating the kind of intensity Eckhart applied to the grammatical nuances he perceived in scripture. Moreover, it is in the relationship between Latin and German that Eckhart’s linguistic theory becomes most apparent. Focusing on his German sermons, Löser demonstrates that, in both translating biblical verses into German and commenting on them, Eckhart is shown to be an exceptional grammarian. Christopher M. Wojtulewicz asks whether the singular use of a sophism (‘if only a father is, then not only a father is’) in Eckhart’s works can tell us anything about his grammatical thinking. Initially, he argues, Eckhart’s deployment of this sophism is unusual. This is because it takes place within the context of a discussion of the Trinity, rather than as a logical exercise. But closer inspection shows the complicated grammatical machinery to which Eckhart was not only sensitive, but subtly using to convey the relationship between language and reality. Instead of making use of analogy to explain the relationship between God and the world, Wojtulewicz contends that Eckhart is in fact exercising an analogy between God and grammar. This goes beyond the question of semantic meaning (without abandoning it), and suggests that the grammatical structure of language itself can analogically reflect God. As such, the use of a sophism in order to uniquely communicate something about the doctrine of the Trinity no longer seems unusual. Two further contributions look to the reception of modism in nineteenth and early twentieth century philosophy. Gesche Linde considers the reception of Thomas of Erfurt in the thought of the nineteenth century philosopher Charles Peirce. At that time Thomas’ work was still presumed to have been authored by Duns Scotus. Although not arguing that Peirce directly depended on Thomas, Linde nevertheless suggests that in the development of his own universal grammar, Thomas’ influence on Peirce can be felt. In his second contribution to the volume, Andrés Quero-Sánchez looks at Heidegger’s habilitation dissertation (‘Habilitationsschrift’), based as it was in part on what turned out to be Thomas of Erfurt’s Grammatica

I NTRODUCTION

󰀉

speculativa. Heidegger was mistaken, Quero-Sánchez argues, in two principal respects. Firstly, Thomas’ text believed to be the work of Duns Scotus (notwithstanding any possible influence of Thomas on Scotus in the early fourteenth century). Secondly, Heidegger’s interpretation was mistaken because Thomas’ grammar is decidedly ‘averroistic’ and so not in accord with the thought of Edmund Husserl and Heinrich Rickert – two figures Heidegger sought to link to Scotus’ (i.e. Thomas’) Grammatica speculativa. Quero-Sánchez concludes with a call not only to study more intensely the influence of Averroes on Thomas and others around the year 󰀁󰀃󰀀󰀀, but also for critical editions of Thomas’ texts to emerge in the coming years. The inclusion of his edition of parts of the Commentary on Porphyry’s “Isagoge” in the appendix launches this laudable call. Acknowledgements The workshop on which this volume is based could not have happened without the generous support of the Arts and Humanities Research Council project at King’s College London (󰀂󰀀󰀁󰀃-󰀂󰀀󰀁󰀆). Our grateful thanks also extend to the generous support and welcome of the Max Weber Center for Advanced Social and Cultural Studies at the University of Erfurt, along with all their interdisciplinary research fellows who assisted the workshop deliberations by their knowledge and presence. This volume advances our knowledge of Eckhart and Thomas of Erfurt; but no advance in discussion would be complete without a delineation of future areas of research. The final and universal import of this volume, therefore, echoes the call for further research into Meister Eckhart, Thomas of Erfurt, and the grammatical theories of the modists, both in their own day and in later reception. Markus Vinzent and Christopher M. Wojtulewicz London, Erfurt, and Leuven, October 󰀂󰀀󰀁󰀉.

Personal Pronouns – Thomas of Erfurt and Meister Eckhart in Erfurt and Paris MARKUS VINZENT KING’S COLLEGE LONDON – MAX-WEBER-KOLLEG, ERFURT Abstract Thomas of Erfurt and Meister Eckhart were two masters who lived and worked contemporaneously in the early 󰀁󰀄th century at the Thuringian city of Erfurt, Germany. While Eckhart is still remembered amongst philosophers, theologians and people interested in mysticism today, the international fame of Thomas which he enjoyed during his life and which lasted beyond his death is at present mostly reduced to scholarship in the US. Even in his hometown Erfurt, the importance of Thomas is rarely recognised. Nevertheless, Thomas was one of the greatest grammarians of history and certainly one of its early philosophical grammarians. His ‘Speculative Grammar’ served as a philosophical and grammatical textbook in most of the European Universities, and it would be a surprise, if he had not exercised some influence on Meister Eckhart. Likewise, it has long been noted that Eckhart often focuses on grammar when explaining Scripture, for example, and, just like Thomas, saw in grammar more than a linguistic device. The following article, therefore, introduces first the social and historical background of Thomas of Erfurt and Meister Eckhart, against which then their philosophy of grammar on personal pronouns will be placed. I. Erfurt and Paris

E

rfurt in the late 󰀁󰀃th and early 󰀁󰀄th centuries is best compared with Oxbridge today in its trend setting research (at least in some fields) and its combination of schools or colleges with an international presence

󰀁󰀂

M ARKUS V INZENT

of students and staff.󰀁 Especially in its teaching and research on language and grammar Erfurt is at the forefront in the late 󰀁󰀂th, early 󰀁󰀃th centuries, as the great scholar of the theory of language of the Middle Ages, Jan Pinborg has shown. He begins his second part of his opus magnum Die Entwicklung der Sprachtheorie im Mittelalter (󰀁󰀉󰀆󰀇) with Erfurt’s place in the history of grammar: ‘The clash between the rational and nominalist concepts of language in the area of grammar seems first to have taken place in Erfurt; here, at least, we can first grasp it’.󰀂 Erfurt’s foremost, celebrated and venerated professor of grammar in the Arts faculty was Thomas of Erfurt,󰀃 although he is little known today to most of Erfurt’s citizens. Called ‘one of the most famous teachers of Erfurt’ by Sönke Lorenz, the biographer of Erfurt’s schools and university,󰀄 he is regularly connected with the city of Erfurt in our sources. The Magister Thomas of Erfurt,󰀅 lives and works at the school of St. Severus, perhaps also at that of the Scots.󰀆 His name Thomas Erfordensis insinuates that he may have even been born here.󰀇 That he is also sometimes called Thomas Occam raises the question whether he has to be identified with the other Thomas of Occam, a master of arts and cleric of the diocese of Chichester, Surrey, the place where William of Occam came from.󰀈 However all early sources refer to him as Thomas of Erfurt, known as ‘famous rector of Erfurt’, ‘most excellent master of arts’.󰀉 His proximity 󰀁. Although, as the literature below will show, research has been done on the early history of Erfurt University, there is much more to be explored. One of the desiderata, for example, is a close reading of Thyma of Erfurt’s Summa, a collection of fictitious letters for various situations in life; see Sönke Lorenz, Studium generale Erfordense: Zum Erfurter Schulleben im 󰀁󰀃. und 󰀁󰀄. Jahrhundert (Stuttgart, 󰀁󰀉󰀈󰀉), 󰀃󰀂󰀅-󰀇. 󰀂. Jan Pinborg, Die Entwicklung der Sprachtheorie im Mittelalter, Beiträge zur Geschichte der Philosophie und Theologie des Mittelalters XLII 󰀂 (Münster and Kopenhagen, 󰀁󰀉󰀆󰀇), 󰀁󰀃󰀉: ‘Der Zusammenprall zwischen dem Sprachdenken der Realisten und dem der Nominalisten auf dem Gebiete der Grammatik scheint zuerst in Erfurt stattgefunden zu haben; jedenfalls ist er uns hier erstmals greifbar’ (own trans.). 󰀃. Cod. 󰀁󰀄󰀉󰀈 MCXXXVIII of the Metropolitankapitelsbibliothek Prague: ‘venerabilis Magister Thomas’; Clm 󰀇󰀅󰀈󰀉, Staatsbibliothek Munich: ‘Magister Thomas’. 󰀄. S. Lorenz, Studium generale Erfordense (󰀁󰀉󰀈󰀉), 󰀃󰀁󰀂-󰀂󰀇, 󰀃󰀁󰀂. 󰀅. Clm 󰀂󰀂 󰀂󰀉󰀄, Staatsbibliothek Munich. 󰀆. Q. 󰀅󰀁, Erfurt Amploniana, fol. 󰀁󰀀󰀇r: ‘Dicta super Fundamenta puerorum per magistrum Thomam quondam Erfordie existens apud sanctum Severum’; Cod. 󰀁󰀄󰀄󰀁 M. LXXXIV, Metropolitankapitelsbibliothek Prague: ‘Magister Thomas, qui etiam edidit novos modos signifandi regens quondam Erfordii apud S. Severum’; see also Cod. theol. lat. 󰀁󰀇󰀁, fol. 󰀆󰀇v of the Stadtbibliothek, Lübeck; Clm 󰀄󰀃󰀇󰀈, Staatsbibliothek Munich: ‘Regens in Erfordia apud Scotos’. 󰀇. Cod. 󰀆 of the Marienstiftsgymnasium, Stettin. 󰀈. S. Lorenz, Studium generale Erfordense (󰀁󰀉󰀈󰀉), 󰀃󰀁󰀃. 󰀉. IV. Q. 󰀈󰀁b, University Library, Breslau.

P ERSONAL P RONOUNS – T HOMAS

OF

E RFURT

AND

M EISTER E CKHART

IN

E RFURT

AND

P ARIS

󰀁󰀃

to Sigerus de Curtraco (Kortrijk) has made scholars suggest that like Siger he studied at the art’s faculty of Paris around the year 󰀁󰀃󰀀󰀀󰀁󰀀 which is possible – given the sharing of ideas with many other Parisian thinkers. This more excellent grammarian, as he is also called,󰀁󰀁 is, however, only one amongst many other scholars of similar caliber, which underlines the high standard of teaching and research in Erfurt. In the year 󰀁󰀃󰀂󰀄, for example, the chapter of St. Mary at Erfurt decided that it was looking for a new rector, but the candidate had to have attended a University before, most likely meaning that he had to be educated in Paris.󰀁󰀂 How closely connected the various schools of Erfurt were – already a hundred years prior to them being granted the status of a university by Clemens VII on 󰀁󰀉 September 󰀁󰀃󰀇󰀉 – can be seen from the joined ‘Schulordnung’ (school rule) of the year 󰀁󰀂󰀈󰀂 which comprises the schools of the Canons regular of St. Augustin, St. Mary and St. Severus. In this document, the self-description of the schools is that of a ‘communion and consortium of masters of schools and of scholars’.󰀁󰀃 With the added school of the Scots, the four schools of St. Mary, St. Severus, those of the Reglers and the Scots were directed by one superior rector.󰀁󰀄 In addition to these schools of the city, we know of some more important centers of learning, the schools of the Franciscans, the Dominicans, and the Benedictines.󰀁󰀅 Erfurt’s school consortium had frequent relations with the University of Paris, as can be seen by a letter, dated between 󰀁󰀃󰀂󰀈 and 󰀁󰀃󰀃󰀆 written by students of Erfurt to Balduin, archbishop of Trier. The document is issued in the name of ‘master John of Paris and the universitas of students of various nations’ and talkes about ‘our solemn master, the aforementioned John of Paris, who should not be hindered in lecturing, disputating 󰀁󰀀. See S. Lorenz, Studium generale Erfordense (󰀁󰀉󰀈󰀉), 󰀃󰀁󰀂 with reference to C. Verhaak, Zeger van Kortrijk, Commentator van Perihermeneias (Brussels, 󰀁󰀉󰀆󰀄), xxvi, xxix, lxii; see, however, the criticism of this argument by Jan Pinborg, ‘Review of Verhaak’, Scholastik 󰀄󰀀 (󰀁󰀉󰀆󰀅), 󰀅󰀈󰀁-󰀄. 󰀁󰀁. Cod. Q. 󰀂󰀈󰀁, Erfurt Amploniana, fol. 󰀃󰀃r: ‘Explicit modis significandi Thome grammatici excellenter notabilis’. 󰀁󰀂. Stiftsbibliothek of St. Paul, Kärnten, Cod. B. 󰀂󰀁󰀀 (XXXI), fol. 󰀃󰀇v: ‘Item scholasticus debet instituere Rectorem scholarium, qui steterit in studio generali, si haberi potest, et ille iurabit fidelitatem Capitulo’. 󰀁󰀃. ‘Communio et consortium magistrorum scholarum et scholarium’. 󰀁󰀄. Heinrich Denifle, Die Universitäten des Mittelalters I (Berlin, 󰀁󰀈󰀈󰀅), 󰀄󰀀󰀈. 󰀁󰀅. See J. Pinborg, Die Entwicklung der Sprachtheorie im Mittelalter (󰀁󰀉󰀆󰀇), 󰀁󰀃󰀉; J. Theele, Die Handschriften des Benediktinerklosters St. Peter zu Erfurt (󰀁󰀉󰀁󰀆); Ludger Meier, Die Barfüsserschule zu Erfurt (Münster, 󰀁󰀉󰀅󰀈).

󰀁󰀄

M ARKUS V INZENT

and continuing the studies’.󰀁󰀆 Unfortunately we do not know the background of this affair, but it highlights the broad nature of the composition of the student board at Erfurt and the place’s link with Paris. John was famous as author of a number of books, amongst them the Liber de processu naturae, published in Erfurt (Erdfordie publicatus).󰀁󰀇 Around the middle of the 󰀁󰀄th century, Albert of Saxonia, after having received his degrees (licence and master) in Paris in the year 󰀁󰀃󰀅󰀁, where he stayed on at least until 󰀁󰀃󰀆󰀂, seems, then, to have worked at one of the schools at Erfurt in the years 󰀁󰀃󰀆󰀃 and 󰀁󰀃󰀆󰀄, before becoming Professor and Rector of the new University of Vienna (and later bishop of Halberstadt).󰀁󰀈 Like Thomas, and based on him,󰀁󰀉 master Heinrich of Sonneborn taught grammar at Erfurt, here at the school of the Reglers and is mentioned in 󰀁󰀃󰀂󰀉 as ‘rector of the school of the Church of St. Augustin’.󰀂󰀀 More important than Heinrich is Magister John Aurifaber who seems to have aquired his licence in the arts at the University of Paris before coming to Erfurt where we find him around the year 󰀁󰀃󰀃󰀀 as a teacher;󰀂󰀁 he took part in a public disputation about the modist’s position, where he stood against several masters of Erfurt who were arguing the modist’s case. Aurifaber tried to downplay the ‘innovative’ character of the modists and argued that although they dominated the teaching of grammar in Erfurt, ‘in many other parts of the world, as for example in France, the 󰀁󰀆. See the document in S. Lorenz, Studium generale Erfordense (󰀁󰀉󰀈󰀉), 󰀂󰀆󰀃 n. 󰀃: ‘... magister Ihohannes Parrisiensis universitasque studencium varie nacionis ... solempnis magister noster magister Iohannes Parysien[sis] predictus in legendo, disputando ac continuando nobis studium hactenus, qu[em] ad modum fecerit quoad usque, non impediatur’. 󰀁󰀇. Wien, NB, Cod 󰀁󰀃󰀂󰀈, fol. 󰀁󰀀󰀂-󰀉; S. Lorenz, Studium generale Erfordense (󰀁󰀉󰀈󰀉), 󰀂󰀆󰀅 states that this is the only surviving manuscript of this work. On this and further works by John see Martin Grabmann, Thomas von Erfurt und die Sprachlogik des mittelalterlichen Aristotelismus, Sitzungsberichte der Bayerischen Akademie der Wissenschaften, Phil.-hist. Kl. 󰀁󰀉󰀄󰀃,󰀂 (München, 󰀁󰀉󰀄󰀃) and A. Overmann, Urkundenbuch der Erfurter Stifte und Klöster II (Magdeburg, 󰀁󰀉󰀂󰀉), 󰀂󰀀-󰀉. 󰀁󰀈. See M. Grabmann, Thomas von Erfurt (󰀁󰀉󰀄󰀃), 󰀁󰀂, 󰀅󰀁-󰀂. He has been (wrongly) named as author of Thomas’ Speculative Grammar (for example in a Venetian print of the year 󰀁󰀄󰀈󰀀); see also S. Lorenz, Studium generale Erfordense (󰀁󰀉󰀈󰀉), 󰀁󰀆󰀅-󰀈. 󰀁󰀉. His work Gemma regiminis has not been found yet, but two commentaries exist, an anonymous in MS of the Fürstlichen Bibliothek zu Harburg II, 󰀁, 󰀂o, 󰀁󰀀 f. 󰀂󰀀󰀄r-󰀂󰀁󰀉v as Opus super gemmam regiminis, and another, the Expositio super Gemmam regiminis in Staatsbibliothek Munich, Ms. Clm 󰀇󰀅󰀈󰀉, fol. 󰀁󰀄󰀈r-󰀁󰀆󰀇r. 󰀂󰀀. A. Overmann, Urkundenbuch der Erfurter Stifte und Klöster I (Magdeburg, 󰀁󰀉󰀂󰀆), 󰀇󰀇󰀅; S. Lorenz, Studium generale Erfordense (󰀁󰀉󰀈󰀉), 󰀁󰀈󰀄-󰀅. 󰀂󰀁. See Staatsbibliothek Munich, Ms. Clm 󰀃󰀃󰀁, fol. 󰀄󰀇: ‘Explicit tractatus magistri Johannis Aurifabri Erfordiensis de demonstratione excerptus a libro posteriorum’; on his title ‘in artibus licentiatus’ see Leipzig University Library, Cod. 󰀁󰀄󰀄󰀄, fol. 󰀁󰀅󰀂v.

P ERSONAL P RONOUNS – T HOMAS

OF

E RFURT

AND

M EISTER E CKHART

IN

E RFURT

AND

P ARIS

󰀁󰀅

Lombardy and in England and in major parts of Germany, such as in the other part of the Rhine, namely in the entirety of Brabant and the Picardy’ the modist’s position, as he claimed, has already gone out of fashion.󰀂󰀂 It is interesting to see, to what extent masters wanted to be at the forefront of the contemporary discourse and trying to push it further or, conversely, were criticising such innovation like Aurifaber. The debate resulted in Aurifaber’s publication of a work against the modists, based on this disputation, which in a manuscript at the Amploniana Erfurt is bound together with a modistic counter-work by Herzo de Marklingerode, a canonicus of Hildesheim and Halberstadt.󰀂󰀃 Both the disputation and Aurifaber’s work had kicked off the discussion about modist’s grammar, not only here, but in many European places too.󰀂󰀄 Aurifaber himself speaks of many ‘moderni’ who studied the principles of language and came up with the ‘modes of signifying’ (de modis significandi) which he, however, rejected.󰀂󰀅 Herzo, in his anonymous tract, refers to those grammarians of Erfurt who like him objected to Aurifaber, but were believed to be ‘very firm’ in grammar.󰀂󰀆 These few names are only indicative for the importance of Erfurt for the ‘modern’ development of our understanding of grammar in the 󰀁󰀄th century and beyond and it is clear that the major centers for this debate were, indeed, Erfurt and Paris.󰀂󰀇 Pinborg reckons that ‘many 󰀂󰀂. Johannes Aurifaber, Determinatio de modis significandi: ‘Cum etiam hodie salvantur congruitas et perfectio in multis mundi partibus, videlicet in Francia, Lumbardia et in Anglia et in maiori parte Alemanie, scilicet in altera parte Reni, id est in Brabantia et in Piccardia tota’ (󰀂󰀁󰀇,󰀂󰀀-󰀃 Pinborg). 󰀂󰀃. See Q. 󰀂󰀇󰀆 Amploniana, Erfurt, fol. 󰀁󰀃󰀇: ‘Explicit determinacio de modis significandi posita et completa per mag. Io. Aurifabrum anno D. 󰀁󰀃󰀃󰀂 feria 󰀂a. ante diem sanctorum Symonis et Iude Erfordie, scripta Daventrie anno domini 󰀁󰀃󰀃󰀃 in vigilia Michaehelis’; the counter-works are the Sophisma Tantum unum est; another work against Aurifaber is preserved in a manuscript of Mühlhausen, Stadtarchiv, Ms. 󰀆󰀀/󰀂󰀆, the Disputatio Johannis Aurifabri. 󰀂󰀄. See M. Grabmann, Thomas von Erfurt (󰀁󰀉󰀄󰀃), 󰀅󰀄-󰀅; on Aurifaber see S. Lorenz, Studium generale Erfordense (󰀁󰀉󰀈󰀉), 󰀂󰀂󰀄-󰀃󰀉 who distinguishes him from a namesake who lived towards the end of the 󰀁󰀄th century. 󰀂󰀅. Johannes Aurifaber, Determinatio de modis significandi: ‘Circa hanc orationem obmissis aliis queratur de principiis, que moderni ponunt congruitatis et perfectionis, scilicet de modis significandi, utrum sint possibiles ... Circa istam questionem ad alleviandum onus grammaticorum, cum multi sunt grammatici per inventionem modorum significandi necnon cottidie generantur, supposita sincera informatione atque sincera correctione non tamen odiosa sic procedam’ (󰀂󰀁󰀅,󰀁󰀃-󰀂󰀃 Pinborg). 󰀂󰀆. See anon. Sophisma ‘Tantum unum est’ (󰀂󰀃󰀇,󰀂󰀁-󰀂 Pinborg); on the identification of the anonymous with Herzo de Marklingerode see S. Lorenz, Studium generale Erfordense (󰀁󰀉󰀈󰀉), 󰀂󰀁󰀈-󰀂󰀂. 󰀂󰀇. For Paris as origin of term and concept of ‘modus significandi’ (see his concise summary of the history of modism) Heinz W. Enders, Sprachlogische Traktate des Mittelalters und der

󰀁󰀆

M ARKUS V INZENT

writings on grammar which are transmitted in manuscripts of Erfurt, derived from schools of Erfurt’,󰀂󰀈 while in Paris, the modists’ were also hotly debated. Scholars who have studied Thomas of Erfurt’s Speculative Grammar have already noted its dependence on a Parisian authority, Radulphus Brito.󰀂󰀉 A close comparison of the two authors, however, is still a desideratum. The work was not a mere copy of Brito, on the contrary, its concise structure and systematic content made it one of the bestsellers of medieval grammars. Over 󰀃󰀀 manuscripts today are found in Germany (Erfurt, Augsburg, Berlin, Harburg, Lübeck, Mainz, Munich, Stettin), but also in Basel, Cambridge, Klagenfurt, Krakow, London, Oxford, Padua, Prague (󰀁󰀃 manuscripts!), Rome, St. Florian and Wrocław, but the work still awaits its first critical edition.󰀃󰀀 Even worse is the state of research on other works of Thomas. In addition to a metrical Fundamentum puerorum,󰀃󰀁 in which he determined how the modes make sense of the construction,󰀃󰀂 his summarising Compendium,󰀃󰀃 he wrote commentaries on the Isagoge of Porphyry,󰀃󰀄 on the Categories and the Perihermeneias of Aristotle and on the Liber sex principiorum.󰀃󰀅 However, despite his prominence in the field of grammar, Semantikbegriff, Münchener Universitäts-Schriften 󰀂󰀀 (München, 󰀁󰀉󰀇󰀅), 󰀃󰀇-󰀅󰀆, 󰀄󰀃 with reference to Ryszard Gansiniec, Modi significandi, Mysl Filozoficzna 󰀆 (Warsaw, 󰀁󰀉󰀅󰀆), 󰀈󰀀-󰀁󰀁󰀅. 󰀂󰀈. J. Pinborg, Die Entwicklung der Sprachtheorie im Mittelalter (󰀁󰀉󰀆󰀇), 󰀁󰀄󰀁. 󰀂󰀉. Jan Pinborg, ‘Rev. of Bursill-Hall, Thomas of Erfurt’, Lingua 󰀃󰀄 (󰀁󰀉󰀇󰀄), 󰀃󰀇󰀂: ‘long passages of the Grammatica speculativa are simply taken over from Radulphus Brito’. 󰀃󰀀. See S. Lorenz, Studium generale Erfordense (󰀁󰀉󰀈󰀉), 󰀃󰀁󰀇-󰀂󰀁. 󰀃󰀁. See M. Grabmann, Thomas von Erfurt (󰀁󰀉󰀄󰀃), 󰀃󰀃-󰀇; edited by R. Gansiniec, Metrificale Marka z Opatowca i traktaty gramatyczne XIV i XV wieku (Wrocław, 󰀁󰀉󰀆󰀀), 󰀁󰀁󰀀; a commentary to this text still needs to be explored, Ms. Erfurt 󰀄o 󰀅󰀁, f. 󰀉󰀂-󰀁󰀀󰀇. 󰀃󰀂. Cod. 󰀁󰀄󰀄󰀁 M. LXXXIV, Metropolitankapitelsbibliothek Prague: ‘... quod magister Thomas in hoc libello intendit determinare de constructibilibus videlicet quot modis debent fieri sensus constructionem’. 󰀃󰀃. Cod. 󰀁󰀄󰀄󰀁 M. LXXXIV, Metropolitankapitelsbibliothek Prague: ‘Compendium Thome’. 󰀃󰀄. On this see the sample edition of three selected passages by Andrés Quero-Sánchez in this volume and his commentary on these in his contribution ‘On Pure Reason, Abstractness, and the Relationship between Oneness and Plurality’. 󰀃󰀅. See M. Grabmann, Thomas von Erfurt (󰀁󰀉󰀄󰀃), 󰀄󰀂-󰀄; J. Pinborg, Die Entwicklung der Sprachtheorie im Mittelalter (󰀁󰀉󰀆󰀇), 󰀁󰀃󰀃-󰀄. The Commentary on the Isagoge is preserved in Erfurt 󰀄o 󰀂󰀆󰀆 f. 󰀁-󰀇; Leipzig, Univ. 󰀁󰀃󰀅󰀆 f. 󰀁-󰀈; Staatsbibliothek Munich, Clm 󰀄󰀃󰀇󰀈, f. 󰀂-󰀂󰀃; the Commentary on the Categories in Erfurt 󰀄o 󰀂󰀆󰀆 f. 󰀈-󰀂󰀀; Leipzig, Univ. 󰀁󰀃󰀅󰀆 f. 󰀉-󰀁󰀈; Staatsbibliothek Munich, Clm 󰀄󰀃󰀇󰀈, f. 󰀂󰀉-󰀆󰀆; Clm 󰀁󰀄󰀄󰀅󰀈, f. 󰀁󰀁󰀉-󰀃󰀃; the Commentary on the Perihermeneias in Erfurt 󰀄o 󰀂󰀆󰀆 f. 󰀂󰀀-󰀃󰀈; Leipzig, Univ. 󰀁󰀃󰀅󰀆 f. 󰀁󰀈-󰀂󰀈; and the Commentary on the Liber sex principiorum Erfurt 󰀄o 󰀂󰀆󰀆 f. 󰀃󰀉-󰀄󰀆.

P ERSONAL P RONOUNS – T HOMAS

OF

E RFURT

AND

M EISTER E CKHART

IN

E RFURT

AND

P ARIS

󰀁󰀇

all his commentaries remain inedited and are little studied, if at all. Hence, much of what I am saying here with reference to Thomas, will be not more than preliminary. How could Thomas of Erfurt and the modists have influenced Meister Eckhart? First of all, grammar was part of the teaching of the Trivium of the schools and since 󰀁󰀂󰀃󰀁 lectures on Donatus and Priscianus were obligatory.󰀃󰀆 Priscianus was born in Caesarea in today Algeria and taught grammar at Constantinople around the year 󰀅󰀀󰀀 AD. He had published amongst others a famous systematic work, the Institutiones grammaticae on which later authors relied, focussing either on Priscianus maior, books 󰀁-󰀁󰀆 of Priscianus’ Institutiones grammaticae, in which he discussed the parts of the oration, or on Priscianus minor, books 󰀁󰀇 and 󰀁󰀈 where he developed a theory of the construction of speeches, the ‘admissible or grammatically required combinations of the individual parts of the speech’.󰀃󰀇 The Dominican Jordanus of Saxonia (d. 󰀁󰀂󰀃󰀇), first Magister Generalis of the Dominican order after the death of the order’s founder Dominicus had written an influential commentary on Priscianus minor.󰀃󰀈 Eckhart’s interest in grammatical thinking, therefore, is of little surprise, given that he was educated in Erfurt and had become a bachelor at Paris. As will be shown, he adopted grammatical arguments to search for ‘nova’ et ‘rara’.󰀃󰀉 Not only grammar, but also the longing for ‘nova’ places him close to Thomas of Erfurt who had seen himself as an innovator in grammaticis and published his speculative grammar as Novi modi signifiandi. II. Personal Pronouns As mentioned, Thomas of Erfurt is understudied, one of the reasons for putting this volume together. And so is the relation between his thinking 󰀃󰀆. See M. Grabmann, Thomas von Erfurt (󰀁󰀉󰀄󰀃), 󰀆󰀂-󰀃. 󰀃󰀇. Mary Sirridge and Karin Margareta Fredborg, ‘Demonstratio ad oculum and Demonstratio ad Intellectum: Pronouns in Ps.-Jordan and Robert Kilwardby’, in Jakob Leth Fink, Heine Hansen and Ana María Mora-Márquez (eds), Logic and Language in the Middle Ages: A Volume in Honour of Sten Ebbesen, Investigating Medieval Philosophy 󰀄 (Leiden a.o., 󰀂󰀀󰀁󰀃), 󰀁󰀉󰀉-󰀂󰀂󰀀, 󰀂󰀀󰀀. 󰀃󰀈. See Cod. lat. 󰀁󰀂󰀉󰀁, Universitätsbibliothek Leipzig; Cod. 󰀂󰀅󰀄󰀀 Nationalbibliothek Wien; see M. Grabmann, Thomas von Erfurt (󰀁󰀉󰀄󰀃), 󰀇󰀄. 󰀃󰀉. See Eckhart, Prol. gen., n. 󰀂 (LW I 󰀁󰀄󰀉,󰀁).

󰀁󰀈

M ARKUS V INZENT

and Meister Eckhart.󰀄󰀀 Claire Taylor Jones has recently noted: ‘Eckhart scholars cannot be blamed for misssing a connection to Modism and speculative grammar. The field of scholarship on speculative grammar has been very small and the vast majority of medieval sources remain unedited.’󰀄󰀁 She gives as a historical reason that the Modists themselves already had ‘insisted upon the separation between the “business of the philosopher” and the “business of the grammarian”’, although they advocated that one should be an expert in both fields. The second, contemporary reason for neglect is the lack of editions, let alone translations of most of our grammatical treatises.󰀄󰀂 So, Thomas is not the only grammarian of the 󰀁󰀄th century who needs critical study, but it is an entire field which still awaits further exploration. As a result, I refrain from claiming borrowings between Thomas and Eckhart, and only try to situate both thinkers within a broader field of grammatical reflection. ‘The theory of the pronoun develops in tandem with the theory of the noun’.󰀄󰀃 The conceptualization of the noun (nomen), like that of the pronoun, is predominantly rooted in Aristotle and in Priscian’s books 󰀁󰀂 and 󰀁󰀇 of his Institutiones grammaticae. After Anselm and Abelard the thinking about pronouns was particularly developed by the Dominican Robert Kilwardby who resided at the University of Paris, first as a student, and later as teacher of grammar and logic before moving on to Oxford and becoming provincial prior and in the year 󰀁󰀂󰀇󰀂 Archbishop of Canterbury. Eckhart in his Commentary on Exodus seems to know him and to balance him against Albert the Great and his own views.󰀄󰀄 󰀄󰀀. See Susanne Köbele, ‘bîwort sîn: Absolute Grammatik bei Meister Eckhart’, Zeitschrift für Deutsche Philologie 󰀁󰀁󰀃 (󰀁󰀉󰀉󰀄), 󰀂󰀉󰀇-󰀃󰀂󰀆, 󰀁󰀉󰀁: ‘Whoever comes across the phenomenon [of Eckhart’s linguistic arguments], immediately moves on after a sweeping gesture toward the Modistae or medieval linguistic realism’, trans. (adapted) by Claire Taylor Jones, ‘The trouble with verbs: Meister Eckhart and the Tropology of Modistic Grammar’, Mystics Quarterly 󰀃󰀅 (󰀂󰀀󰀀󰀉), 󰀉󰀉-󰀁󰀂󰀆, 󰀁󰀀󰀀. One would also need to compare in detail Thomas’ and Eckhart’s relation to Robert Kilwardby, particularly his Demonstratio ad oculum/Demonstratio ad intellectum, edited in M. Sirridge and K.M. Fredborg, ‘Demonstratio ad oculum and Demonstratio ad Intellectum: Pronouns in Ps.Jordan and Robert Kilwardby’ (󰀂󰀀󰀁󰀃), 󰀂󰀁󰀃-󰀉; 󰀄󰀁. C. Taylor Jones, ‘The trouble with verbs: Meister Eckhart and the Tropology of Modistic Grammar’ (󰀂󰀀󰀀󰀉), 󰀁󰀀󰀁. 󰀄󰀂. C. Taylor Jones, ‘The trouble with verbs: Meister Eckhart and the Tropology of Modistic Grammar’ (󰀂󰀀󰀀󰀉), 󰀁󰀀󰀁. 󰀄󰀃. M. Sirridge and K.M. Fredborg, ‘Demonstratio ad oculum and Demonstratio ad Intellectum: Pronouns in Ps.-Jordan and Robert Kilwardby’ (󰀂󰀀󰀁󰀃), 󰀁󰀉󰀉. 󰀄󰀄. See Anselm, De grammatico; see D.P. Henry, The De Grammatico of St. Anselm: The Theory of Paronymy (Notre Dame, 󰀁󰀉󰀆󰀄), 󰀃󰀉-󰀄󰀁; M. Sirridge and K.M. Fredborg, ‘Demonstratio ad

P ERSONAL P RONOUNS – T HOMAS

OF

E RFURT

AND

M EISTER E CKHART

IN

E RFURT

AND

P ARIS

󰀁󰀉

That the noun had one meaning or signifaction with various consignifications (voces consignificativae) or modes of signifying (modi significandi), such as case, gender, and number,󰀄󰀅 ‘was so frequently invoked and applied by the Nominales that it became an identifying characteristic’ of them in the twelfth century.󰀄󰀆 And yet, at the same time it also became challenged by scholars like Alberic of Paris and his followers, the so-called Albricani󰀄󰀇 ‘who maintained that the oblique cases of a noun were separate nomina’.󰀄󰀈 This latter position stood, of course, in stark contrast to Aristotle who believed that the various cases of a noun did not ‘constitute nouns, but cases of a noun, while the meaning of these cases of a noun is the same as that of the noun proper, but in other respects’.󰀄󰀉 Aristotle himself, therefore, maintained that while we are dealing with one and the same noun, the cases introduce different ‘respects’ or aspects, yet do not substantially alter the meaning of a noun. Although the pronoun is a subform of the noun, it is characterised by specifics that make it different from nouns. As Priscian has already seen, pronouns stand in for nouns, but they also differ from them considerably. Nouns, as we have seen, are regarded as having one particular meaning (even if they can have consignifications within a given context), but they are referring to substance and quality which makes them unique. Thomas of Erfurt explains that ‘grammarians have described the general essential mode of the pronoun by saying that the pronoun signifies substance only or substance without quality’.󰀅󰀀 This means, they can oculum and Demonstratio ad Intellectum: Pronouns in Ps.-Jordan and Robert Kilwardby’ (󰀂󰀀󰀁󰀃); see Eckhart, In Ex. 󰀅󰀄 (LW II 󰀅󰀉,󰀄): ‘Unde totum compositum est unum ens’. 󰀄󰀅. See William J. Courtenay, Capacity and Volition: A History of the Distinction of Absolute and Ordained Power (Bergamo, 󰀁󰀉󰀉󰀀), 󰀄󰀆; see, for example, William of Auxerre, Summa aurea I, tr. 󰀇, c. 󰀁; ed. J. Ribaillier (Paris, 󰀁󰀉󰀈󰀀), 󰀁󰀁󰀅: ‘Ista etiam forma fallit secundum Nominales, qui dicunt quod unum nomen est plures voces’. 󰀄󰀆. W.J. Courtenay, Capacity and Volition (󰀁󰀉󰀉󰀀), 󰀅󰀆 n. 󰀁󰀁. 󰀄󰀇. See Yukio Iwakuma, ‘Alberic of Paris on Mont Ste Geneviève against Peter Abelard’, in Jakob Leth Fink, Heine Hansen and Ana María Mora-Márquez (eds), Logic and Language in the Middle Ages: A Volume in Honour of Sten Ebbesen, Investigating Medieval Philosophy 󰀄 (Leiden a.o., 󰀂󰀀󰀁󰀃), 󰀂󰀇-󰀄󰀇. 󰀄󰀈. W.J. Courtenay, Capacity and Volition (󰀁󰀉󰀉󰀀), 󰀄󰀆. 󰀄󰀉. Aristotle, De interpretatione 󰀂 (trans. my own). 󰀅󰀀. Thomas of Erfurt, Novi modi significandi XXI 󰀃󰀆: ‘Et hunc modum generalissimum essentialem pronominis grammatici expresserunt dicentes, pronomen significare substantiam meram, vel substantiam sine qualitate’ (quoted and trans. here and elsewhere by G.L. Bursill-Hall, Grammatica speculativa of Thomas of Erfurt [London, 󰀁󰀉󰀇󰀂], adapted and sometimes altered; note that Bursill-Hall’s version of the Grammatica has an altered structure and numbering which we follow here only for the sake of reference; I also compare the German translation: Thomas von Erfurt, Abhandlung

󰀂󰀀

M ARKUS V INZENT

stand in for nouns, like personal pronouns, they can, however, also be general and indistinct, such as relative pronouns like ‘who’ (qui, quae, quod). The particular nature of the pronoun has attracted Eckhart’s attention, combined with the grammarian’s ideas that personal pronouns, particularly the first person singular, ‘I’, are discrete, or as Priscian states: ‘“I” is perfect for discreteness’,󰀅󰀁 as ‘the word by itself signifies best absolute person and is most discrete, because when “I speak, the other does not”’.󰀅󰀂 Right in the opening of his detailed explanation of Exod. 󰀃:󰀁󰀄, the famous ‘Ego sum qui sum’, Eckhart begins this part of his Commentary on Exodus with a linguistic note on the pronouns. ‘I am who I am’. Four things one has to note here. First that these three ‘I’, ‘am’, ‘who’, most appropriately stand for God. ‘I’ is the pronoun of the first person. As discrete pronoun it signifies pure substance: pure, I say, without any accidens, without anything alien, substance without quality, without this or that form, without this or that. This, however, is congruent with God, and with him alone who is above accidens, above species, above genus. Him alone, I say. Therefore, he says in the Psalms: ‘I am single’ (Ps. 󰀁󰀄󰀀:󰀁󰀀).󰀅󰀃 To Eckhart, God is not only substance, being, a noun, as this entailed qualities, but the pronoun is the most appropriate expression for God as it signifies ‘pure substance’, or, as he says in his sermo on Jesus Sirach, given at Erfurt, ‘purity of life, “I” signifying pure and undefiled substance’,󰀅󰀄 über die bedeutsamen Verhaltensweisen der Sprache [Tractatus de Modis significandi], übersetzt und eingeleitet von Stephan Grotz, Bochumer Studien zur Philosophie 󰀂󰀇 [Amsterdam und Philadelphia PA, 󰀁󰀉󰀈󰀈]). 󰀅󰀁. Priscian, Instit. gram. XII: ‘perfectum ad discretionem est ego’. 󰀅󰀂. Priscian, Instit. gram. XVII: ‘uerbum per se absolutam magis personam |significat, plerumque discretiuus est, ut ego dico, ille autem non’. 󰀅󰀃. Eckhart, In Ex. n. 󰀁󰀄 (LW II 󰀂󰀀,󰀁-󰀈): ‘“Ego sum qui sum”. Notanda sunt hic quattuor. Primo quod haec tria “ego, sum, qui” propriissime deo conveniunt. Li “ego” pronomen est primae personae. Discretivum pronomen meram substantiam significat: meram, inquam, sine omni accidente, sine omni alieno, substantiam sine qualitate, sine forma hac aut illa, sine hoc aut illo. Haec autem deo et ipsi soli congruunt, qui est super accidens, super speciem, super genus. Ipsi, inquam, soli. Propter quod in Psalmo ait: “singulariter sum ego”’. 󰀅󰀄. Eckhart, Serm. 󰀁 in Eccl. 󰀂󰀄:󰀂󰀃 (LW II 󰀂󰀃󰀂,󰀈-󰀉): ‘Ego: vitae puritas – li ego enim meram quod est puram substantiam significat’; see also Serm. 󰀁 in Eccl. 󰀂󰀄:󰀂󰀃 (LW II 󰀂󰀃󰀅,󰀁󰀄-󰀂󰀃󰀆,󰀁): ‘Sapientia dei notat sui puritatem dicens ego. Li ego enim meram et puram substantiam significat, et. hoc est primum quod in amato quaeritur’ (‘The wisdom of God signifies her own purity saying “I”. Indeed, the “I” signifies unadulterated and pure substance, and this is the first thing which is being

P ERSONAL P RONOUNS – T HOMAS

OF

E RFURT

AND

M EISTER E CKHART

IN

E RFURT

AND

P ARIS

󰀂󰀁

or, as in the First Parisian Question God is not of a ‘being that is congruent with creatures, unless it is in God as in the cause’, but he is ‘purity of being’, as expressed in the ‘I am who I am’.󰀅󰀅 In our Exodus passage, Eckhart details this by pointing out that this substance has no accidens, nothing alien, quality, form or particularity. Even more important to him, however, as we will see, is the idea that the personal pronoun of the first person signifies not only ‘pure substance’, but one that is both indistinct or indetermined and at the same time discrete. Such a simple and equally complex ‘I’ is by its very nature not only self-referential, but rather stands in as reference for ‘pure substance’, the principle of signification and consignification, an ‘I’ which allows and comprises a ‘you’ and all other pronouns, nouns and verbs, an indeterminate pronoun which is discrete only with regards to anything that it is not. A few chapters later in his Commentary on Exodus, Eckhart comes back to his explanation of Exod. 󰀃:󰀁󰀄 and explicates what this ‘I’ means with regards to self-being as being the fullness of being, of being all beings and of all beings being itself: This, however, belongs properly to God, and solely to God, as above in Book three of Exodus: ‘I am who I am’. ‘I’, he says discretely: alone single, as the Psalm [says]: ‘I am single’. He said, however, ‘I am who I am’, first, because he himself is the fulness of being and fully is, second, because he himself is nothing else, but pure being. From which one concludes that affirmation which consists in being and identity of the terms, coincides properly with God. What, namely, is so much the same as being and being: ‘I am who I am’? Because no other proposition is more true than that which predicates self-identity. Anything beyond God, inasmuch as what is beyond being, exists and does not exist, and negates to itself to be something else, as it is below being and beyond being, and therefore negation coincides with sought in that which is loved.’); see on this also Andrés Quero-Sánchez in this volume ‘On Pure Reason, Abstractness, and the Relationship between Oneness and Plurality’. 󰀅󰀅. Eckhart, Quaest. Par. I n. 󰀉 (LW V 󰀄󰀅,󰀆-󰀁󰀅): ‘principium nunquam est principiatum, ut punctus nunquam est linea. Et ideo cum deus sit principium vel scilicet ipsius esse vel entis, deus non est ens vel esse creaturae; nihil quod est in creatura, est in deo nisi sicut in causa, et non est ibi formaliter. Et ideo cum esse conveniat creaturis, non est in deo nisi sicut in causa, et ideo in deo non est esse, sed puritas essendi. Sicut quando quaeritur de nocte ab aliquo, qui vult latere et non nominare se: quis es tu? respondet: “ego sum qui sum”, ita dominus volens ostendere puritatem essendi esse in se dixit: “ego sum qui sum”. Non dixit simpliciter “ego sum”, sed addidit: “qui sum”. Deo ergo non competit esse, nisi talem puritatem voces esse’.

󰀂󰀂

M ARKUS V INZENT

it. Of being itself, however, is not any other being negated, as for example of ‘animal’ is this animal, a lion, is not negated. Therefore, no negation, nothing negative coincides with God, except the negation of negation which the one negative saying signifies: ‘God is one’ (Deut. 󰀆:󰀄; Gal. 󰀃:󰀂󰀀). Negation of negation, indeed, is purest and fullest affirmation: ‘I am who I am’. Beyond himself ‘he returns in a full return’, on himself he leans, he is by himself, he is himself being. Therefore, no negation coincides with God: ‘He cannot negate himself’ (󰀂Tim. 󰀂:󰀁󰀃). Being cannot negate to be itself being: ‘nothing deserts itself’. Nothing, therefore also, can negate itself, according to what follows: ‘The first is rich by itself’. Again, also, nothing can negate itself, according to that: ‘He operates all in all’ (󰀁Cor. 󰀁󰀂:󰀆). ‘In all’, he says, because he negates to nobody; ‘all’, he said, because he negates nothing. As, therefore, being itself nothing is negated, so it does not negate to anybody being itself – it cannot negate itself – and it negates nothing. It accepts freely, it gives freely.󰀅󰀆 Eckhart uses the same reference Psalmtext ‘I am single’ to explain the discreteness of the personal pronoun ‘I’. But he sees the need to further detail what is meant by it. On the premise of personal pronouns being both, ‘pure substance’ and discrete, discreteness only refers to itself being nothing, but itself. Because this self-identical ‘self’, however, is not beyond or below God and being, but a divine ‘I’, its descreteness does not exclude anything. While simple negation is associated with creaturely beying, God’s nothingness is that of the divine ‘pure substance’, not a 󰀅󰀆. Eckhart, In Ex., n. 󰀇󰀄 (LW II 󰀇󰀆,󰀁󰀃-󰀇󰀇,󰀁󰀂): ‘Hoc autem proprie dei est et solius dei, supra tertio, scilicet huius Exodi: “ego sum qui sum”. “Ego” inquit discretive: solus singulariter, Psalmus: “singulariter sum ego”. Ait autem: “sum qui sum”, tum quia ipse est plenitudo esse et plenum esse, tum quia ipse nihil est aliud nisi purum esse. Concluditur igitur quod affirmatio, consistens in esse et identitate terminorum, deo proprie competit. Quid enim tam idem quam esse et esse: “sum qui sum”? Nulla enim propositio propter hoc est verior illa, in qua idem praedicatur de se ipso. Omne citra deum, utpote citra esse, est ens et non ens, et negatur sibi aliquod esse cum sit sub esse et citra esse, et ideo ipsi congruit negatio. Ipsi autem esse non negatur aliquod esse, sicut animali non negatur hoc animal, puta leo. Nulla ergo negatio, nihil negativum deo competit, nisi negatio negationis, quam significat unum negative dictum: “deus unus est”, Deut. 󰀆; Gal. 󰀃. Negatio vero negationis purissima et plenissima est affirmatio: “ego sum qui sum”. Super se ipsum “redit reditione completa”, sibi ipsi innititur, se ipso est, ipsum esse est. Nulla ergo negatio deo congruit: “se ipsum negare non potest”, Tim. 󰀂. Esse non potest negare esse se ipsum esse: “nihil se ipsum deserit”. Propter quod etiam nulli se negare potest, secundum illud: “primum dives est per se”. Iterum etiam nihil negare potest, secundum illud: “operatur omnia in omnibus”, 󰀁 Cor. 󰀁󰀂. “In omnibus” inquit, quia nulli negat; “omnia” ait, quia nihil negat. Sicut ergo ipsi esse nihil negatum est, sic et ipsum esse nulli se negat – “se ipsum negare non potest” – et nihil negat. Gratis accipit, gratis dat’; see also ibid., n. 󰀂󰀆󰀄 (󰀂󰀁󰀃,󰀁-󰀁󰀀); n. 󰀂󰀇󰀆 (󰀂󰀂󰀂,󰀁󰀁).

P ERSONAL P RONOUNS – T HOMAS

OF

E RFURT

AND

M EISTER E CKHART

IN

E RFURT

AND

P ARIS

󰀂󰀃

negative nothingness, but the negation of any negativity,󰀅󰀇 and, therefore, sheer abundance, an ‘I’ which, as mentioned before, is ‘you’, ‘he’, ‘she’, ‘it’, is ‘we’, ‘you’ and ‘they’. Even the ‘one negative saying’, namely that ‘God is one’ (Deut. 󰀆:󰀄 and Gal. 󰀃:󰀂󰀀) is that of the negation of negation, hence fullest affirmation. God’s oneness is not one that excludes trinity or even multiplicity, on the contrary, it includes all-ness, everything, because God cannot negate himself and can therefore not negate to be anything nor does it reject anybody being itself, namely being God. The all-embracing and all-giving idea of ‘I’ is enhanced through the second pronoun which Eckhart highlights in his explanation of ‘I am who I am’, namely the pronoun ‘who’. He writes in his earlier passage on Exod. 󰀃:󰀁󰀄: Then, the term ‘who’ is an infinite name. Infinite and immense being, however, solely convenes to God.󰀅󰀈 As the Grammarians have taught him, ‘who’ (or qui) indicates the ‘infinite and general substance’, so Priscian.󰀅󰀉 Eckhart agrees, ‘who’ signifies ‘infinite and immense being’, in which, as he states in his Latin Sermo VIII, he sees the highest love and the dignity of the soul which God has assumed in man when mention of ‘a certain man’ is made in Luke 󰀁󰀄:󰀁󰀆. Building on Priscian to Eckhart ‘certain’ (quidam) derives from ‘quis’ or ‘qui’, ‘who’ and, repeating himself, he states: ‘This signifies infinite substance’, and he adds an image which he borrows from John Damascene: ‘God is “a sea of infinite substance who holds everything”’.󰀆󰀀 Finally he comes to the verb ‘sum’ for the explanation of which he can come back to Priscian, but may also have been inspired by Thomas 󰀅󰀇. See on the negation of negation chapter 󰀂 of Tamar Tsopurashvili, Sprache und Metaphysik: Meister Eckharts Prädikationstheorie und ihre Auswirkung auf sein Denken, Bochumer Studien zur Philosophie 󰀅󰀂 (Amsterdam and Philadelphia, 󰀂󰀀󰀁󰀁), 󰀂󰀇-󰀃󰀄 (unfortunately, the author does not refer to the pronoun ‘I’). 󰀅󰀈. Eckhart, In Ex. n. 󰀁󰀄 (LW II 󰀂󰀀,󰀁󰀄-󰀅): ‘Rursus li “qui” nomen est infinitum. Infinitum autem esse et immensum soli deo convenit’. 󰀅󰀉. Priscian, Instit. gram. XIII: ‘“Quis” ... generalem et infinitam substantiam, quae pertinet ad universarum rerum genera et species et partes demonstrat ... sic etiam infinitam et generalem substantiam, quae est in hoc nomine, hoc est “quis” vel “qui” et “quae” ex eo componuntur, in hoc esse dicimus qualitatem’. 󰀆󰀀. Eckhart, Serm. VIII n. 󰀉󰀅 (LW IV 󰀉󰀁,󰀇-󰀁󰀀): ‘nota caritatem maximam et animae dignitatem quam assumpsit deus. Homo, inquit, quidam. a “quis” vel “qui” descendit, quae significant substantiam infinitam. Est autem deus “pelagus substantiae infinitae” habens omnia.’

󰀂󰀄

M ARKUS V INZENT

of Erfurt. To Priscian verbs are volatile, and Thomas is even more explicit. Dealing with verbs, he notes that their ‘essential active mode of signifying is derived from the property of it, namely the property of its nature which is flux and succession and opposed to entity whose property is that of state and permanence’.󰀆󰀁 However, there is a single exception to flux and opposition to permanence, and that is the verb ‘I am’, ‘sum’. This verb, as Priscian already stated, is already by the Greeks called ‘ὑπαρκτικόν’, what is ‘suppositum’, so that he wants to call it a ‘substantivum’, hence a noun, ‘because of all [verbs] it is always most perfect and misses nothing’.󰀆󰀂 And Thomas uses the reference to God’s being (Deus est) and the being of the intellect (intelligencia est) that even verbs correspond to their suppositum, hence derive ‘from the property of determined essence’.󰀆󰀃 Similarly, Eckhart understands ‘I am’: Now the term ‘I am’ is a substantive verb. A verb, as in John 󰀁: ‘God was the verb’; and substantive, as in Hebr. 󰀁: ‘who carries all by the word of his virtue’.󰀆󰀄 Different to his predecessors, however, Eckhart, again, stresses that the substantivity of this verb ‘is’ is not expressed through its capacity to combine nouns, pronouns, participles and definitions,󰀆󰀅 or that it expresses the substantial or essential nature of the divine, but substantiveness of the ‘verbum’ is taken literally as God being ‘sub’ and ‘standing’, being active, 󰀆󰀁. Thomas of Erfurt, Novi modi significandi XXV 󰀄󰀅: ‘Notandum est quod modus significandi activus per modum esse oritur a proprietate rei, quae est proprietas ipsius esse, scilicet proprietas fluxus et successionis, quae opponitur proprietate entis, quae est proprietas habitus et permanentis’. 󰀆󰀂. Priscian, Inst. gram. VIII: ‘sum uerbo, quod ὑπαρκτικόν Graeci uocant, quod nos possumus substantiuum nominare; id enim omnium semper est perfectissimum, cui nihil deest’. 󰀆󰀃. Thomas of Erfurt, Novi modi significandi XXV 󰀄󰀆: ‘a proprietate essentiae determinatae’. 󰀆󰀄. Eckhart, In Ex. n. 󰀁󰀄 (LW II 󰀂󰀀,󰀁󰀄-󰀅): ‘Adhuc li “sum” verbum est substantivum. Verbum: “deus erat verbum”, Ioh. 󰀁; substantivum: “portans omnia verbo virtutis suae”, Hebr. 󰀁’. 󰀆󰀅. See Abaelardus, De dictionibus definitis, in id., Dialectica, tract. I, lib. III, vol. III, ed. L.M. de Rijk (Assen, 󰀁󰀉󰀅󰀆), 󰀁󰀃󰀄: ‘Sola ita, memini, grammaticorum sententia nullam secundum signifationem differentiam in nuncupativo et substantivo verbo accipere, sed eamdem in utroque sententiam proferri volunt, ut nihil aliud “ego nuncupor Petrus” quam “ego sum Petrus” intelligatur; hoc tamen “secundum institutionem inventionis” ad differentiam dicunt, quod nuncupativum, licet substantivi significationem habeat, non tamen constructionem ipsius ubique servat. Illud enim omnibus vel nominibus vel pronominibus vel participiis vel definitionibus praedicatis potest copulari, hoc autem solis propriis nominibus concedunt coniungi’; see T. Tsopurashvili, Sprache und Metaphysik (󰀂󰀀󰀁󰀁), 󰀂󰀂-󰀃.

P ERSONAL P RONOUNS – T HOMAS

OF

E RFURT

AND

M EISTER E CKHART

IN

E RFURT

AND

P ARIS

󰀂󰀅

supporting, carrying, giving and embracing, expressed by the nature of the verb ‘I am’. This idea of a self-communicating ‘I’, Eckhart broadens in another of his Latin sermons, where he defines what he means by a ‘verbum substantivum’: ‘Under’ (‘sub’) notes humility ..., ‘standing’ (‘stantivum’) derives from stability. Of the earth, namely, which ‘stands in eternity’ (Eccl. 󰀁[:󰀄]) it is said in the Psalm [󰀁󰀀󰀃:󰀃]: ‘You have grounded your earth on stability’. Third, the art of communication is expressed in the ‘verb’, as, namely, the verb alone manifests the speaker and communicates what is in him. The example is the uncreated verb itself through which the Father communicates and transfers everything.󰀆󰀆 The substantive verb is an appropriate term for God which is better than any noun, because it does not take him ontologically or essentially alone, but signifies him as being fully dynamically a being beyond itself, or even better he is verb because he is active by expressing his own essence in self-communicating his being to everything else that therefore is. In his Commentary on Wisdom Eckhart produces a highly sophisticated play of words with reference to Rev. 󰀁󰀉:󰀁󰀃 (‘nomen eius verbum dei’ – ‘His noun is a verbum of God’). This verse shows to him the double nature of the substantive verb. As the verb means motion, while the noun means ‘no-motion’, God’s noun is a verb, because the predicated noun, ‘God’s motion is without motion’, is bound together with the substantive verb ‘movere’, that ‘God moves without being moved’.󰀆󰀇 Already Claire Taylor Jones has brought this passage together with that of Eckhart’s vernacular homily 󰀉 where he states that ‘God called himself a word. Saint John said “in the beginning was the word”, and meant that one should be a 󰀆󰀆. Eckhart, Serm. XII/󰀁 n. 󰀁󰀂󰀃 (LW IV 󰀁󰀁󰀇,󰀁󰀀-󰀁󰀁󰀈,󰀃): ‘Haec autem tria notat li “estote”, quod est verbum substantivum. Li enim “sub” notat humilitatem, Petri 󰀃: “humiliamini sub potenti manu dei”. Li autem “stantivum” a stando dictum notat stabilitatem. De terra enim quae “in aeternum stat”, Eccl. 󰀁, in Psalmo dicitur: “fundasti terram super stabilitatem suam”. Tertium, scilicet communicabilitas, notatur in “verbo”. Verbum enim solum manifestat dicentem, et quae in eius sunt animo communicat. Exemplum in ipso verbo increato per quod pater communicat et transfundit omnia’. 󰀆󰀇. Eckhart, In Sap. n. 󰀁󰀂󰀉 (LW II 󰀄󰀆󰀇,󰀁-󰀃): ‘Et hoc est quod Apoc. 󰀁󰀉 dicitur: “nomen eius verbum dei” – verbum enim cum motu significat, nomen sine motu; verbum ergo dei nomen est, quia motus dei est sine motu et movere sine moveri’; see the interpretation by C. Taylor Jones, ‘The trouble with verbs: Meister Eckhart and the Tropology of Modistic Grammar’ (󰀂󰀀󰀀󰀉), 󰀁󰀁󰀂.

󰀂󰀆

M ARKUS V INZENT

by-word by the word’.󰀆󰀈 Eckhart had learned from both Priscian and Thomas that the ‘adverb’ ‘determined the verb’ not in an accidental way, but in a ‘specific essential’ one,󰀆󰀉 hence the better translation of ‘bîwort’ would not be ‘by-word’, but ‘by-verb’. As we now know, the second part of ‘by-verb’, namely ‘verb’, here, means a particular verb, namely the verb which is a noun, or a substantive verb. Yet, this form of equation is best captured in the concept of the ‘adverb’ as ‘by-verb’ meaning that the noun is signified as powerful and active and the signifying verb understood as substantive, so that signified and signifying terms are the same and mutually exchangeable, while different with regards to the mode of signification. To exemplify this concept, Eckhart in his homily 󰀉 points to the adverb ‘quasi’. In its lexical content of ‘just as’ and in its grammatical mode of signifying the verb, the word expresses, as Eckhart further explains with the example of the ‘free star’, the planet Venus. As Venus precedes the rising sun, but is still visible after the sun has disappeared in the night, hence has different modes with regards to the sun, but as Venus is always in aequidistance to the sun with regards to all other stars, in the same way Eckhart sees the relation between God and man as a ‘quasi’ ad-verbial relation. We need to conclude that as God’s ‘noun’ is a ‘verb’, the verb understood as a ‘by-verb’, so is man a ‘by-verb’ to this ‘verb’. Of course, in this reverse and complex thinking, Eckhart goes beyond the grammarians’ theories that were available to him. As can be seen, Eckhart and grammar is a field of its own and needs further research. One could point to more references in Eckhart to the grammatical traditions of antiquity or to Thomas of Erfurt. And it may not be a surprise that Eckhart’s Commentary on Exodus is the core text to his reflection of grammatical topics. In n. 󰀅󰀅, building on Aristotle’s De interpretatione and Boethius, he differentiates between vox, conceptio and res, a little later he speaks about the ‘modum significandi’,󰀇󰀀 but, as stated earlier, it is not my interest here to make genealogical links 󰀆󰀈. Eckhart, Pr. 󰀉 (DW I 󰀁󰀅󰀅,󰀁-󰀃): ‘Got nante sich selber ein wort. Sant Johannes sprach: “in dem anevange was daz wort”, und meinet, daz man bî dem worte sî ein bîwort’. 󰀆󰀉. Thomas of Erfurt, Novi modi significandi XXXVI 󰀇󰀀-󰀁: ‘Licet adverbium dicatur adiectivum verbi, secundum Priscianum, hoc est ideo, quia adverbium, secundum omnes species eius, determinat verbum, sed non participium ... significatio non est modus accidentalis adverbio sed essentialis specialis’; see Priscian, Inst. gram. XV 󰀁. 󰀇󰀀. See Eckhart, In Ex. n. 󰀇󰀈 (LW II 󰀈󰀁,󰀃-󰀁󰀂).

P ERSONAL P RONOUNS – T HOMAS

OF

E RFURT

AND

M EISTER E CKHART

IN

E RFURT

AND

P ARIS

󰀂󰀇

between the two Erfurt masters. Instead, I wanted to show, how deeply Eckhart built his core theological thinking on prepared grounds, within shared streets, and still develops his recognizable theological profile.

On Pure Reason, Abstractness, and the Relationship between Oneness and Plurality: Thomas of Erfurt and Eckhart of Hochheim’s Controversial Dialogue in Erfurt at the Turn of the 󰀁󰀄th Century ANDRÉS QUERO-SÁNCHEZ, REGENSBURG

I. Introduction

I

n 󰀁󰀉󰀁󰀆, Martin Heidegger published his second thesis at the University of Freiburg, his Habilitation, entitled Die Kategorien- und Bedeutungslehre des Duns Scotus (Duns Scotus’ Theory of the Categories and of Meaning). It was the interpretation of a Latin treatise, which was considered, at that time, to be a work by John Duns Scotus: the Tractatus de modis significandi, that is On the Modes of Signifying. Just seven years after the publication of Heidegger’s thesis, Martin Grabmann managed to show that this treatise was not written by Scotus, but by Thomas of Erfurt, a Master of Arts at the School of St. Severus and the Schottenkloster of St. Jacob in Erfurt.󰀁 Now, since the philosophical positions that we find in this treatise are quite different from those which characterise Scotus’ writings, one might ask how it could happen that Scotus came to be accredited as the author of this work. I think, the answer to this question 󰀁. For an extensive discussion on Heidegger’s Habilitation see Andrés Quero-Sánchez, ‘Ein ,ewig Unwiderlegbares‘. Heideggers Missverständnis der averroistischen Abbildtheorie der Sprache des Thomas von Erfurt in seiner Freiburger Habilitationsschrift (Die Kategorien- und Bedeutungslehre des Duns Scotus)’, in the present volume, 󰀁󰀉󰀉-󰀂󰀃󰀆. You will also find in this volume the key-study on the relationship between Thomas of Erfurt and Meister Eckhart by Markus Vinzent, ‘Personal Pronouns – Thomas of Erfurt and Meister Eckhart in Erfurt and Paris’. See also Dietmar Mieth, Meister Eckhart (Munich, 󰀂󰀀󰀁󰀃), 󰀉󰀀-󰀈.

󰀃󰀀

A NDRÉS Q UERO -S ÁNCHEZ

is as follows: Thomas was magister, as I have said, at the Schottenkloster, that is, apud Scotos, and the expression we find in some manuscripts, Magister apud Scotos,󰀂 became over the course of history – surely not surprisingly – Magister Duns Scotus. Tradition also knows another title for Thomas’ Treatise on the Modes of Signifying, namely Grammatica speculativa, that is, Speculative Grammar. It seems this was not the original title of the work; nevertheless, as I have recently shown, it is an appropriate title.󰀃 The term ‘speculative’ (speculativus) is ultimately derived from the verb speculor, meaning to ‘observe’, ‘consider’, or ‘contemplate’, and used in this context as a translation for the Greek adjective θεωρητικός [theôrêtikós], as opposed to πρακτικός [praktikós], the adjective used by Aristotle to refer to the ‘practical’ sciences. A speculative Grammar, according to Thomas of Erfurt, as well as to Boethius of Dacia, upon whom he is ultimately dependent, is not a practical but a theoretical science. This means we should explain the different modes of signifying and the grammatical structures of language not by referring to our actions, or to things we do, but to things we know, that is, by referring to the knowledge of how reality is. Grammatical structures correspond with or even reflect the structures of the given reality. Both authors are telling us, therefore, that the ontological structure of the world itself is the fundamental principle of Grammar: of speculative – that is: the world just as it is ‘observing’, ‘considering’ or ‘contemplating’ (speculari) – Grammar. Let me quote the crucial passage by Thomas of Erfurt in this context: Such concepts or such active modes of signifying are not mere fictions. That is why any active mode of signifying must be originated from a property of reality. [...]. [...] giving to a linguistic expression a meaning as an active mode of signifying, the mind must [therefore] be induced by a certain property of reality itself. To any active mode of signifying corresponds therefore a property of reality or a mode of reality.󰀄 󰀂. See for example the manuscript in Munich, Bavarian State Library (Bayerische Staatsbibliothek), Clm. 󰀄󰀃󰀇󰀈, fol. 󰀁r: (annoted by a coeval hand, probably by the scriptor of the manuscript himself): ‘Commentum Magistri Thomae in Isagogas Porphirii. Commentum Magistri Thomae in Praedicamenta Aristotelis’. A later hand then adds to this: ‘[...] in Erfordia apud Scotos quandoque regentis’. 󰀃. See A. Quero-Sánchez, ‘Ein ,ewig Unwiderlegbares‘’ (in this volume), 󰀂󰀂󰀀-󰀉. 󰀄. See Thomas of Erfurt, De modis significandi, in Fernández M. García (ed.), B. Ioannis Duns Scoti Doct. Subtilis O.F.M. Grammaticae speculativae nova editio (Quaracchi, 󰀁󰀉󰀀󰀂), ch. 󰀂, no. 󰀆,󰀄-󰀁󰀉,

T HOMAS

OF

E RFURT

AND

E CKHART

OF

H OCHHEIM

󰀃󰀁

And this thesis was also essential for Boethius of Dacia: For the modes of signifying [...] are taken from the modes of understanding [...]. The modes of understanding are themselves taken from the characteristic modes of reality – otherwise they would be mere fictions created by the mind, but this seems not to be possible.󰀅 II. ‘Averroistic’ Realism Boethius of Dacia, along with Siger of Brabant, are known as the major representatives of the so-called ‘Averroism of the 󰀁󰀃th century’, the concept ‘Averroistic’ being, however, a very controversial one.󰀆 We find the fundamental ‘Averroistic’ thesis – the thesis of the identity of being (esse) and essence (essentia) – in both Siger of Brabant and Boethius of Dacia. This thesis is crucial to understand, as I will show in what follows, not only the speculative grammar of Thomas of Erfurt, but also his entire philosophy, especially his Commentary on Porphyry’s Isagoge. The thesis is mainly conceived as a critique of Henry of Ghent’s idealistic metaphysics.󰀇 According to Henry, we must take into consideration not only the esse p. 󰀂a: ‘cum huiusmodi rationes, sive modi significandi activi non sint figmenta, oportet omnem modum significandi activum ab aliqua rei proprietate radicaliter oriri. Quod sic patet; quia cum intellectus vocem ad significandum sub aliquo modo significandi activo imponit, ad ipsam rei proprietatem aspicit, a qua modum significandi activum originaliter trahit; quia intellectus cum sit virtus passiva, de se indeterminata, ad actum determinatum non vadit, nisi aliunde determinetur. Unde cum imponit vocem ad significandum sub determinato modo significandi activo, a determinata rei proprietate necessario movetur; ergo cuilibet modo significandi activo correspondet aliqua proprietas rei, seu modus essendi rei’ (own trans. here and later where not otherwise indicated). 󰀅. See Boethius of Dacien, Modi significandi sive quaestiones super Priscianum maiorem, ed. J. Pinborg and H. Roos, CPhD 󰀄 (Copenhagen, 󰀁󰀉󰀆󰀉), q. 󰀁,󰀃󰀈-󰀅󰀂, pp. 󰀆-󰀇: ‘Aliquis est grammaticus in habendo grammaticam. Ipsam autem nullus habere potuit ante suam generationem. Ideo qui invenit eam, non fuit grammaticus, sed erat philosophus proprias naturas rerum diligenter considerans. Modi enim significandi tam essentiales quam accidentales, tam generales quam speciales a modis intelligendi accepti sunt, et quanta est differentia inter modos significandi, tanta est differentia inter modos intelligendi, a quibus accepti sunt. Modi autem intelligendi accepti sunt a propriis modis essendi rerum. Aliter enim essent figmenta intellectus, quod non videtur possibile. Et quanta est differentia inter istos modos intelligendi, tanta necessario debet esse inter modos essendi rerum, a quibus accepti sunt. Modi autem essendi appropriati rebus diversis cognoscuntur ex propriis rerum naturis, quas per se considerare non potest grammaticus, sed metaphysicus’. 󰀆. For an extensive discussion on this see Andrés Quero-Sánchez, ‘Individuum, Modernität und Aufklärung im Denken Meister Eckharts und Sigers von Brabant’, in Freimut Löser and Dietmar Mieth (eds), Religiöse Individualisierung in der Mystik: Meister Eckhart, Heinrich Seuse, Johannes Tauler, MEJb 󰀈 (Stuttgart, 󰀂󰀀󰀁󰀄), 󰀁󰀁-󰀅󰀃, 󰀁󰀃-󰀄󰀇; id., Über das Dasein: Albertus Magnus und die Metaphysik des Idealismus, MEJb.B 󰀃 (Stuttgart, 󰀂󰀀󰀁󰀃), 󰀂󰀆-󰀈 and 󰀁󰀉󰀂-󰀂󰀀󰀇. 󰀇. See on this A. Quero-Sánchez, Über das Dasein (󰀂󰀀󰀁󰀃), 󰀁󰀉󰀂-󰀂󰀀󰀇.

󰀃󰀂

A NDRÉS Q UERO -S ÁNCHEZ

existentiae of things, that is, not only the way of being characteristic of actually existing things, but also, or even first, their esse essentiae, that is, a kind of being which is not only prior but also entirely independent from – or, as Henry explicitely says, ‘indifferent’ with regard to – existence at all. This is precisely the thesis that the ‘Averroistic’ thinkers are criticising.󰀈 Let me quote a crucial passage in this context, taken from a quaestio of Siger of Brabant entitled: ‘Whether the sentence: “Man is an animal” would be true, if no man existed’ (Quaestio utrum haec sit vera: Homo est animal, nullo homine existente). Since essential being is as such entirely independent from existence, an idealistic thinker should answer this question in an affirmative manner. Siger’s opinion is, of course, the opposite one: They [that is, Henry of Ghent and his disciples] say that even if no man existed, man would ‘be’, namely having an essential being, in virtue of which man is an animal, so that the sentence: ‘Man is an animal’ would be true, the sentence however: ‘Man is [that is, exists]’ would be false. For the verb ‘is’ used in an absolute sense [that is not merely as a linking verb or copulative] means ‘exists’. Now, this is not a good argument, because there is not any essential being of man, when man does not exist at all. Because in order to ‘be’ in an essential manner, man must be an existing thing.󰀉

We find the same metaphysical position in the writings of Boethius of Dacia: ‘Man and animal’, he writes, ‘are changeable and corruptible beings [...], so that with the expressions “man” and “animal” we cannot form any sentence expressing a proposition that is unchangeable and necessarily true’. If man ceased to exist, then the sentence: “Every man is necessarily an animal” (Omnis homo de necessitate est animal) would be false.󰀁󰀀 Even the sentence: “A man is a man” would be false, if there were 󰀈. On Henry’s idealistic metaphysics see ibid. 󰀅󰀁-󰀁󰀅󰀃. 󰀉. See Siger of Brabant, Quaestio utrum haec sit vera: Homo est animal, nullo homine existente, in B. Bazán (ed.), Écrits de logique, de morale et de physique, Philosophes médiévaux 󰀁󰀄 (Louvain and Paris, 󰀁󰀉󰀇󰀄), 󰀅󰀄,󰀅󰀂-󰀉󰀉: ‘[...] dixerunt quod ipsa esset vera, sed isti diversimode dixerunt, quia dixerunt quod, quamquam nullus homo sit in esse actuali, homo tamen est in esse essentiae, et quia esse essentiae et definitivum ponit animal de ipso, vera est haec: homo est animal; falsa tamen ista: homo est, eo quod “est”, secundario adiacens, praedicatur esse actuale. // Sed hoc non valet, quia non potest remanere homo in esse essentiali quin remaneat in esse actuali, nam ad esse essentiale hominis pertinet actualitas essendi’. 󰀁󰀀. See Boethius of Dacia, Sophisma ‘Omnis homo de necessitate est animal’, in Sten Ebbesen and Jan Pinborg, ‘Studies in the Logical Writings attributed to Boethius de Dacia’, CIMAGL 󰀃

T HOMAS

OF

E RFURT

AND

E CKHART

OF

H OCHHEIM

󰀃󰀃

no man at all’, ‘for’, as Boethius states, if man ceased to exist, then this sentence (namely ‘a man is a man’) ‘would express only a structure in the language, not having any corresponding structure in reality’ (compositio sermonis, cui nulla in re respondet compositio).󰀁󰀁 We have therefore to refer thought to reality, in order to make it acceptable as right or real thought. Otherwise it would not be right thinking but mere fiction. This is the position we find taken by Siger of Brabant, Boethius of Dacia and Thomas of Erfurt. But this, of course, is not the position of Meister Eckhart: ‘The sentence “Man is an animal”’, Eckhart explicitly says in his Commentary on Wisdom, ‘would also be true, if no man at all existed’ (nullo homine exsistente est haec non minus vera: “homo est animal”).󰀁󰀂 And Eckhart further adds to this: ‘For either something is not a man or, if it is a man, it is also an animal’ (aut enim non est homo aut est animal, si est homo).󰀁󰀃 Albert the Great and Thomas Aquinas also think the sentence ‘man is an animal’ would be true even if no man at all existed. But according to them, this is the case only because there is God as the eternal guarantor of the validity of the concept: because there is an eternal reality, namely God, guaranteeing reason – as His most proper being – for eternity.󰀁󰀄 But this is clearly not the case with Meister Eckhart. God is certainly righteousness or reason itself. But, according to Eckhart, you don’t define righteousness by knowing what God as a given individual being is, but, on the contrary, you must verify whether a given individual being traditionally called ‘God’ should really be considered, and then accepted as the true God; and you have to do so by comparing this given individual with righteousness or reason itself, to which he needs to conform in order to be properly God. That is what Eckhart means when he states in his well-known first Parisian Question ‘that God is reason (󰀁󰀉󰀇󰀀), 󰀁󰀃-󰀆, 󰀁󰀄,󰀄󰀄-󰀆: ‘Homine autem corrupto non est essentia hominis plus quam erat ante suam generationem, et hoc solum esset essentia hominis in potentia. Ideo homine corrupto propositio non est necessaria nec per se nec vera’. See also ibid. 󰀁󰀆,󰀁󰀁󰀅-󰀂󰀆; id., Quaestiones super Sophisticos Elenchos, q. 󰀉󰀄, ed. S. Ebbesen, CPhD 󰀂 (Copenhagen, 󰀁󰀉󰀆󰀁), 󰀃󰀁,󰀇󰀂-󰀅. 󰀁󰀁. See Boethius of Dacia, Sophisma ‘Omnis homo de necessitate est animal’, 󰀁󰀅,󰀉󰀂-󰀁󰀆,󰀉󰀅: ‘dico quod ista “homo est homo” nullo homine existente non solum potest esse falsa, sed est falsa, quia haec est solum compositio sermonis, cui nulla in re respondet compositio’. 󰀁󰀂. Meister Eckhart, In Sap., n. 󰀂󰀀 (LW II 󰀃󰀄󰀂,󰀁-󰀂). 󰀁󰀃. Meister Eckhart, In Sap., n. 󰀂󰀀 (LW II 󰀃󰀄󰀁,󰀉). 󰀁󰀄. See A. Quero-Sánchez, Über das Dasein (󰀂󰀀󰀁󰀃), 󰀂󰀀󰀅-󰀆.

󰀃󰀄

A NDRÉS Q UERO -S ÁNCHEZ

and rational-being, and that rational-being is the foundation of being’.󰀁󰀅 God is certainly rational-being, but it is his being-rational that makes him be ‘God’, not the other way round, that is, it is not his being-God that makes him rational. We find two passages in Eckhart’s German sermons, where this position is expressed in a radical way. In German Sermon 󰀂󰀆 he asks: ‘What is truth?’. He then answers this question as follows: ‘The truth is so precious, that, if God turned away from the truth, I would stick to the truth und would leave God. For God is the truth’.󰀁󰀆 ‘To the just man’, Eckhart states in the German Sermon 󰀆 in a similar manner, ‘justice is so important, that if God were not just, he would not care a fig about God’.󰀁󰀇 III. Thomas of Erfurt and Eckhart of Hochheim: A Controversial Dialogue Was there any relationship between Thomas of Erfurt and Eckhart of Hochheim? Both lived in Erfurt at the same time. Eckhart, the latter as General Master of the Dominican Order in Saxonia, from 󰀁󰀃󰀀󰀃 to 󰀁󰀃󰀁󰀀, Thomas during this time as Professor of Philosophy, Master of Arts, at the School of St. Severus and the Schottenkloster of St. Jacob in Erfurt.󰀁󰀈 As I have recently shown, it seems to be the case that Thomas of Erfurt is reacting with his understanding of the word class ‘pronoun’ at Eckhart’s misuse of the corresponding passage on this word class in the Speculative Grammar of Boethius of Dacia (composed in Paris ca. 󰀁󰀂󰀇󰀀), which both Eckhart and Thomas of Erfurt, of course, knew very well.󰀁󰀉 In the present article, I want to discuss three further aspects which clearly show, not only that Thomas’ and Eckhart’s respective metaphysical positions – their respective understanding of being – are in opposition to each other, but also that they were probably aware of – and maybe even explicitly reacting to – each other. These three aspects are the following: (a) the question 󰀁󰀅. Meister Eckhart, Quaest. Paris. I, n. 󰀄 (LW V 󰀄󰀀,󰀆-󰀇): ‘quod deus est intellectus et intelligere et est ipsum intelligere fundamentum ipsius esse’. 󰀁󰀆. Meister Eckhart, Pr. 󰀂󰀆 (DW II 󰀂󰀄,󰀁󰀀-󰀂󰀅,󰀂): ‘Waz ist diu wârheit? Wârheit ist als edel, wære, daz sich got gekêren möhte von der wârheit, ich wölte mich an die wârheit heften und wölte got lâzen, wan got ist diu wârheit’. 󰀁󰀇. Meister Eckhart, Pr. 󰀆 (DW I 󰀁󰀀󰀃,󰀁-󰀂): ‘Den gerehten menschen den ist alsô ernst ze der gerehticheit, wære, daz got niht gereht wære, sie enahteten eine bône niht ûf got’. 󰀁󰀈. See in this volume M. Vinzent, ‘Personal Pronouns’, § 󰀁 (Erfurt and Paris). 󰀁󰀉. See A. Quero-Sánchez, ‘Ein ,ewig Unwiderlegbares‘’ (in this volume), 󰀂󰀂󰀉-󰀃󰀅.

T HOMAS

OF

E RFURT

AND

E CKHART

OF

H OCHHEIM

󰀃󰀅

about the relationship between Oneness and Plurality; (b) the question about the attachment of reason to the given reality; and finally (c) the question about the nature of pure reason. III.A. The Universal and the Question about the Relationship between Oneness and Plurality The priority of thought, that is, of concept or of essential being, over the reality of the different concrete things that ‘are’ merely ‘there’, characterises, as I have just explained, Eckhart’s metaphysics. This also means the supremacy of the universal, that is, of the general or abstract concept, which is common to all particular things partaking of it. Meister Eckhart expresses this metaphysical position again and again by using theological language, in both his Latin and his German works, for example in his Commentary on John’s Gospel: ‘God, the Word [that is Jesus Christ], assumed the nature of man, but not the characteristic individuality [of any particular man]’.󰀂󰀀 This means the priority of the universal, which is as such ‘one’, over the plurality of the particular things. A given particular man has to realise the universal, that is, the nature of man as a rational being, in order to properly ‘be’; he not only has to be a particular but also a universal being. The ‘plurality’ of things which ‘are’ in the proper sense, are – at the same time – ‘one’, namely insofar as they exist in accordance to the oneness expressed by the concept. And this is what the word ‘universe’ (uni-versum) means, Eckhart says; it means ‘“the one” (unum) [that is, God], “turned” (versum)’ to all the things he produces, namely insofar as the totality of things which properly ‘are’, are not only a plurality, but also ‘one’: Anything produced by the ‘One’, God, is itself ‘One’. According to this, we have formed the word ‘universe’ (universum), so that we can say: ‘universum’, that is, ‘the “One” “turned”’ [to all the things he produces]. For the being or the essence of God as well as his property of being the Father, that is, as well as his property of being ‘One’, is found in all things which howsoever proceed from him.󰀂󰀁 󰀂󰀀. See Meister Eckhart, In Ioh., n. 󰀂󰀈󰀉 (LW III 󰀂󰀄󰀁,󰀅-󰀆): ‘Secundo notandum quod deus verbum assumpsit naturam, non personam hominis’. 󰀂󰀁. See Meister Eckhart, In Ioh., n. 󰀅󰀁󰀇 (LW III 󰀄󰀄󰀇,󰀈-󰀁󰀁): ‘Adhuc autem omne creatum a patre uno unum est iuxta quod et nomen universi accepit, ut dicatur uni-versum; esse enim sive

󰀃󰀆

A NDRÉS Q UERO -S ÁNCHEZ

We also find before Eckhart this interpretation of the expression ‘universe’ by Albert the Great, an author to whom Thomas of Erfurt very often refers in his Commentary on Porphyry’s Isagoge. Universum means, Albert says in his Metaphysics, unum versum in omnia, that is, ‘the One turned to all the things’.󰀂󰀂 Of course, the metaphysical positions of Albert and Eckhart are quite different from each other. For Albert thinks that anything is ‘one’ in virtue of its given natural being: realising its own characteristic ‘property’ or ‘quality’, a particular thing is ‘one’, existing in accordance with the one order of things that God – Who is the ‘One’ itself – has created.󰀂󰀃 That is, however, not the case with Meister Eckhart who takes the contrary position: overcoming its own characteristic ‘property’ or ‘quality’, a particular thing becomes – surely not merely ‘one’ but nevertheless – ‘One’, so that it is not any more just a merely particular thing but also – at the same time – a universal thing.󰀂󰀄 In his Commentary on Porphyry’s Isagoge, Thomas of Erfurt does not offer an interpretation of the word ‘universe’ but of the word ‘universal’ in order to express a realistic metaphysical position which is clearly, as I will show below, in opposition to that of Meister Eckhart. Let us consider Thomas’ discussion in the work that I have just mentioned. A universal concept, Thomas says at the beginning of the passage, presented in the Appendix below, is not a real, existing thing, but something produced by the mind: ‘We must notice that this kind of universal [namely the universal of predication] is in the mind and by means of the activity of the mind’.󰀂󰀅 Nevertheless, the universal concept must in some way have been taken from the real existing things, otherwise it would be – not a concept but – just a pure fiction. At the very beginning of such essentia dei cum sua proprietate patris, unitate scilicet, descendit in omnia a se quocumque modo procedentia’. 󰀂󰀂. See Albert the Great, Metaphysica, ed. B. Geyer, Opera omnia XVI/󰀁 (Münster, 󰀁󰀉󰀆󰀀), 󰀂󰀈󰀄,󰀆󰀀-󰀂: ‘quia universum est unum versum in omnia’. See Wouter Goris, Einheit als Prinzip und Ziel: Versuch über die Metaphysik des Opus tripartitum (Leiden a.o., 󰀁󰀉󰀉󰀇), 󰀂󰀉󰀈, note 󰀃󰀄. 󰀂󰀃. See A. Quero-Sánchez, Über das Dasein (󰀂󰀀󰀁󰀃), 󰀆󰀆󰀈-󰀇󰀅 (Das Seinlassen vorgegebener Verschiedenheit) and 󰀆󰀇󰀅-󰀉 (Alberts aristotelische Umformung der Metaphysik: Die moderne Promotion des Konkreten). 󰀂󰀄. See Andrés Quero-Sánchez, Sein als Freiheit: Die idealistische Metaphysik Meister Eckharts und Johann Gottlieb Fichtes (Freiburg i. Breisgau and Munich, 󰀂󰀀󰀀󰀄), 󰀁󰀁󰀈-󰀉󰀉 (‘Die niht glîch sint, die sint aleine gote glîch: Eckharts Forderung nach Vernichtung des bestimmten Seins [esse hoc]’). 󰀂󰀅. Thomas of Erfurt, In Isagogas Porphirii, ed. A. Quero-Sánchez, Appendix I below, 󰀂󰀄󰀀,󰀁󰀇: ‘Notandum ergo quod illud universale habet esse per intellectum et in intellectu’.

T HOMAS

OF

E RFURT

AND

E CKHART

OF

H OCHHEIM

󰀃󰀇

an activity of the mind, therefore, Thomas says, must be sensitive experience, from which we can – by means of the imagination – form an image or representation: There is nothing in the mind which had not been before in the imagination. Now, whatever might be in the imagination was before in the senses, because ‘the imagination is the actuality of a movement from the senses’, as it is said in the 󰀂nd book On the Soul.󰀂󰀆 However, the representation of the imagination is not yet the universal concept itself. For such a representation or image is, as Thomas rightly notes, something determined in some way, something namely that the mind does not apprehend in a completely abstract way, but always in conjunction with some particularising conditions. When I imagine a man, I am not thinking of the abstract concept of man, but I am thinking of a certain man, who as such – as a certain one – presents some particularising conditions: When we perceive some singular thing – let us say a singular man called ‘Sortes’ –, then we are knowing something with this or that figure, with this or that colour, with these or those dimensions, pertaining to this or that family, proceeding from this or that place, and so forth in a similar way with regard to other individualising conditions. If Sortes now ceases to be accessible to our perception, then we can imagine him, but our imagination is a power bound to the body, so that we must imagine him with some of these materialising and particularising conditions. We have therefore in such a representation of the imagination – because it is bound to the body – two different aspects to distinguish from each other: the human nature and the individualising conditions.󰀂󰀇 󰀂󰀆. Thomas of Erfurt, In Isagogas Porphirii, ed. A. Quero-Sánchez, Appendix I below, 󰀂󰀄󰀀,󰀁󰀇-󰀉: ‘Nihil autem est in intellectu nisi praefuerit in fantasia. Sed quidquid est in fantasia praefuit in sensu, quia “fantasia est motus factus a sensu secundum actum”, ut dicitur 󰀂 De anima’. 󰀂󰀇. Thomas of Erfurt, In Isagogas Porphirii, ed. A. Quero-Sánchez, Appendix I below, 󰀂󰀄󰀀,󰀁󰀉-󰀂󰀄󰀁,󰀃: ‘Accipiatur modo aliquod sensibile singulare, scilicet Sortes. Sensus ergo cognoscit Sortem ut est sic vel sic figuratus, et sic vel sic coloratus, sub tantis vel tantis dimensionibus, vel de tali parentela vel de tali loco, et sic de aliis conditionibus quae consequuntur individuum. // Ponatur tunc quod Sortes recedat a sensu, tunc fantasia, cum sit virtus organica, apprehendit ipsum sub istis conditionibus materialibus et individuantibus. In tali ergo fantasmate organica duo sunt, scilicet natura humana et conditiones individuantes’.

󰀃󰀈

A NDRÉS Q UERO -S ÁNCHEZ

The universal concept, e.g. human nature, is something abstract, that as such does not present any particularising or individualising conditions. Such an unconditioned or abstract object is the result, Thomas says, of the abstracting activity of reason, the work of ‘active reason’ (intellectus agens): It is however clear that such an [abstract] human nature is essentially different from the individualising conditions [which pertain to any representation or image of a certain man]. The active reason supervenes then and abstracts human nature from these individualising conditions, and it [active reason] presents it [the abstracted (and therefore abstract) human nature] to the possible reason.󰀂󰀈 What does Thomas mean here when referring to ‘possible reason’ (intellectus possibilis)? What does this ‘possible reason’ mean? I do not really think that it is particularly important to answer this question. It is crucial, by contrast, to understand what Thomas of Erfurt is telling us with this reference to ‘possible reason’, namely that the abstract object of reason is not yet the real object of knowledge, that is, that we don’t know what – say – man is, when we are apprehending an abstract or absolutely considered human nature: Such an abstract(ed) nature is, however, not yet the real universal concept, because to a real universality pertain two aspects, namely the universal meaning and the [concrete] nature of which this universal meaning can be predicated. The universal meaning must take its origin from some property of the real things, otherwise it would be pure fiction. On the basis of this premise, I then argue as follows: If a cognitive faculty is not appropriate to know how the properties of the real things are, then it cannot be able to form the complete concept of the universal. Active reason is now not appropriate to know how the properties of the real things are, because it can only know abstract objects. That is why Averroes says that, ‘active reason does not know anything, but it enables possible reason to know something’. Active reason can therefore not form the complete concept of 󰀂󰀈. Thomas of Erfurt, In Isagogas Porphirii, ed. A. Quero-Sánchez, Appendix I below, 󰀂󰀄󰀁,󰀃-󰀆: ‘Constat autem quod talis natura humana essentialiter differt ab istis conditionibus individuantibus, ideo intellectus agens supervenit et abstrahit naturam humanam ab his conditionibus accidentibus reponendo eam in intellectu possibili’.

T HOMAS

OF

E RFURT

AND

E CKHART

OF

H OCHHEIM

󰀃󰀉

the universal, so that it is not the case that it [active reason] knows it [universal], but it enables possible reason to know the universal. This makes it clear, that the nature of a thing is not really universal considered merely as an abstract nature, although as such it is immaterial as well as an object that possible reason can know (for every immaterial thing is as such knowable). It is also clear that in virtue of the proper action of active reason, that is abstraction, something becomes knowable, but it does not become a real universal. It must therefore be the case that the complete concept of the universal pertains to possible reason [and not to active reason].󰀂󰀉 And how does ‘possible reason’ know the real universal? Thomas gives the following answer: It does so by referring the abstract concept to the concrete, existing things, of which it can be predicated, showing thereby that the concept is not just abstract, but also real, that is, a real concept: To the concept ‘universal’ belongs both oneness and generality [or community]. A real universal can only come about by means of the operation of possible reason [that is, by means of reason as converted to the real things outside of the mind]. If we consider the nature of a thing in an abstract manner, then we are thereby considering it as ‘one’. But we are only considering the nature of a thing as a ‘general one’ [or as a ‘common one’], when we consider it in relation to a plurality of individual things [of which it can be predicated]. Consequently, the nature of a thing is properly universal just because of the operation of possible reason, so that the universal is properly only 󰀂󰀉. Thomas of Erfurt, In Isagogas Porphirii, ed. A. Quero-Sánchez, Appendix I below, 󰀂󰀄󰀁,󰀆-󰀂󰀀: ‘Talis autem natura sic abstracta adhuc non est actu universalis, quia in universali secundum actum est duo considerare, scilicet intentionem universalitatis et naturam subiectam intentioni. Intentio autem universalitatis, cum non sit pure figmentum, habet ortum ab aliqua proprietate reali. Ex hoc arguo: Cuius non est considerare vel cognoscere proprietates rerum, eius non est agere completam rationem universalis. Sed intellectus agentis non est cognoscere proprietates rerum, quia ipse nihil cognoscit eorum quae non sunt hac abstractione, quia dicit Commentator quod “intellectus agens non est intellectus qui cognoscat, sed quia efficit intellectum possibilem ut cognoscere possit”; ergo intellectus agentis non est agere completam rationem universalis, ita quod cognoscat ipsum, sed facit bene quod intellectus possibilis possit ipsum cognoscere. Et ita patet quod natura rei, ex eo quod solum est abstracta, non est actu universalis, sed est actu immaterialis et actu obiectum intellectus possibilis, quia omne immateriale de se est actu intelligibile. // Patet etiam, cum abstrahere sit propria operatio intellectus agentis, quod per operationem eius aliquid fit actu intelligibile, sed non fit actu universale. Reliquitur ergo quod universale, quantum ad eius rationem completam, fiat ab intellectu possibili’.

󰀄󰀀

A NDRÉS Q UERO -S ÁNCHEZ

insofar as it is considered in relation to the plurality of individual things [of which it can be predicated], and this is the characteristic action of possible reason [that is: of reason as converted to the real things outside of the mind]. Aristotle maintains this same position by defining the universal in the 󰀁st book of the Posterior Analytics as that which ‘is one in many things and is predicated of many things’. These prepositions, [namely] ‘of ’ and ‘in’, imply respect and relation; the universal is therefore a [real] universal just because of the respect and the relation to the concrete things of which it can be predicated. Also, Porphyry defines the universal in respect to the concrete things of which it can be predicated. He says [namely] that ‘the genus is what can be predicated of many things, etc.’. And he says this [not only of the genus, but] also of the other universals.󰀃󰀀

In order to know something, we certainly need to understand it in an abstract way, that is, not just as a mere representation of the imagination, which is – as such – something determined by some individualising conditions. But an abstract concept is not as such a real universal, which – as a real one – should be apprehended in respect or relation to the concrete things to which it applies: Et ita patet quod universale est actu per respectum ad supposita plura.󰀃󰀁 A concept, Thomas says, is not properly a concept, that is, is not really a concept, not a real concept, unless we conceive it as referred to a real plurality of things, of which it can be predicated. The concept ‘man’ is a real concept insofar as there is a plurality of things which can properly be said to be a man: insofar as there are some men actually being there or actually existing. And precisely in this context, Thomas writes: ‘This becomes also clear from 󰀃󰀀. Thomas of Erfurt, In Isagogas Porphirii, ed. A. Quero-Sánchez, Appendix I below, 󰀂󰀄󰀂,󰀁-󰀁󰀂: ‘Et hoc sic patet: Quia de ratione universalis completam sunt et unitas et communitas. Nunc autem natura rei non est una nec communis nisi per solam operationem intellectus possibilis. Ipsa enim est una ut consideratur abstracta, communis autem ut ad plura supposita comparata; ergo natura rei est actu universalis per solam operationem intellectus possibilis. Et ita patet quod universale est actu per respectum ad supposita plura, quod contingit per intellectum possibilem. // Hoc idem patet auctoritate Philosophi, 󰀁° Posteriorum, qui definiens universale dicit quod ‘universale est unum in multis et de multis dicitur’. Sed illae praepositiones, “de” vel “in”, important respectum et habitudinem; ergo universale est formaliter universale per respectum et habitudinem ad supposita. // Hoc idem patet per Porphyrium, qui definit universalia per respectum ad supposita. Dicit quod ‘genus est quod praedicatur de pluribus, etc.’, et ita de aliis’. 󰀃󰀁. Thomas of Erfurt, In Isagogas Porphirii, ed. A. Quero-Sánchez, Appendix I below, 󰀂󰀄󰀂,󰀄-󰀅.

T HOMAS

OF

E RFURT

AND

E CKHART

OF

H OCHHEIM

󰀄󰀁

the interpretation of the expression itself. For “uni-versal” (uni-versale) means “one” (unum) “turned” (versum) “to a plurality of things” (ad multa)’.󰀃󰀂 Eckhart, on the contrary, looks for abstraction, absoluteness or abegescheidenheit.󰀃󰀃 For, as he says in his German Sermon 󰀁󰀀, an ‘abstract spirit’ – ein abgescheiden geist or (as we find this expression translated in the documents concerning Eckhart’s inquisition trial) spiritus abstractus – is the basis for true knowledge.󰀃󰀄 And at the beginning of his Sermons and Lectures on chapter 󰀂󰀄:󰀂󰀃–󰀃󰀁 of Ecclesiasticus – a work in which he, as we will see below, is facing up to an Aristotelian metaphysics that is very similar to the one we find in Thomas of Erfurt – he writes in a similar manner: Purity of life: ‘we are’. ‘Because for living beings “to live” means “to be”’ [Aristotle’s On the Soul, 󰀂nd Book]. It is said: ‘we are’; now, the more general (or common) and the more abstract (quanto communius, quanto abstractius) this ‘being’ is, the purer is the life which the expression ‘to live’ signifies.󰀃󰀅 Eckhart’s metaphysics is undoubtedly looking for abstract – absolute or abegescheiden – being, because the individualising conditions (supposita), he says, keep things from its true being, that is, from the (unconditioned) condition on which they are what they themselves – properly – are: ‘suppositum, this means: what “is placed” (positum) “under” (sub), that is, “under and below” its producing cause [as an inferior being]’ (suppositum, positum scilicet sub et infra producentem).󰀃󰀆 󰀃󰀂. Thomas of Erfurt, In Isagogas Porphirii, ed. A. Quero-Sánchez, Appendix I below, 󰀂󰀄󰀂,󰀁󰀃󰀆: ‘Item. Hoc idem patet ex interpretatione vocabuli. Dicitur enim “uni-versale”, id est, “unum ad multa versum”. Et quia illae respectus et habitudo ad supposita non competit naturae nisi per intellectum possibilem, patet quod universale actu et formaliter non est nisi per intellectum possibilem’. 󰀃󰀃. See Andrés Quero-Sánchez, ‘Sein als Absolutheit (esse als abegescheidenheit)’, in Andres Quero-Sánchez and Georg Steer (eds), Meister Eckharts Straßburger Jahrzehnt, MEJb 󰀂 (Stuttgart, 󰀂󰀀󰀀󰀈), 󰀁󰀈󰀉-󰀂󰀁󰀈. 󰀃󰀄. See Meister Eckhart, Pr. 󰀁󰀀 (DW I 󰀁󰀆󰀂,󰀃): ‘daz ist eines ieglîchen abegescheidenen geistes bekantnisse’. See Processus Coloniensis II, n. 󰀁󰀂󰀉 (LW V 󰀃󰀄󰀉,󰀄-󰀅): ‘hoc est uniuscuiusque abstracti spiritus cognitio’. 󰀃󰀅. Meister Eckhart, In Eccli., n. 󰀂 (LW II 󰀂󰀃󰀂,󰀃-󰀆): ‘Vitae puritas: “sumus”. “Vivere viventibus est esse”. Sed li esse – “sumus” – quanto communius, quanto abstractius, tanto purius vitam, quod li vivere, significat’. 󰀃󰀆. See Meister Eckhart, In Gen. II, n. 󰀆󰀂 (LW I,󰀁, 󰀅󰀂󰀉,󰀇-󰀅󰀃󰀀,󰀂 [Rec. CT]; LW I,󰀂, 󰀃󰀆󰀈,󰀂󰀀-󰀄 [Rec. alt.]: ‘Res autem iam producta extra producentem cadit et descendit foris, extra esse producentis

󰀄󰀂

A NDRÉS Q UERO -S ÁNCHEZ

III.B. The Question about the Attachment of Reason to the Given Reality We often find Eckhart using Priscian’s definition of the pronoun – which is also characteristic of the Speculative Grammar of Boethius of Dacia and Thomas of Erfurt – in his Sermons and Lectures on chapter 󰀂󰀄: 󰀂󰀃–󰀃󰀁 of Ecclesiasticus,󰀃󰀇 a work that is supposed to have been written in Erfurt.󰀃󰀈 This work starts, as I have just quoted, arguing for an idealistic understanding of being: Sed li esse [...] quanto communius, quanto abstractius, tanto purius vitam [...] significat.󰀃󰀉 With this a sentence, as we have just seen, Eckhart is precisely criticising an understanding of being that is characteristic of Thomas of Erfurt. In addition to this, at the end of the second lecture of this work – that is precisely the very end of it –, Eckhart offers an interpretation of verse 󰀂󰀄:󰀃󰀁 of Ecclesiasticus: ‘They who manifest (reveal or explain) me shall have life everlasting’ (Qui elucidant me, vitam aeternam habebunt), by which he is, as I will endeavour to show in what follows, reacting to some thesis that Thomas of Erfurt – at least he too – was at that time maintaining in Erfurt. To begin with, let me quote a crucial passage in Thomas of Erfurt’s Commentary on Porphyry’s Isagoge, in which he is explaining a certain signification of the term species used by Porphyry. He calls this signification the vulgaris acceptio of the term, but this does not mean that it was a false or even vulgar signification, but just that it is a signification that we usually find in ordinary language. Let me quote the beginning of the passage according to the β-version, which is more extensive than the author’s α-version: He [Porphyry] first explains an ordinary signification of ‘species’. He says that ‘species’, according to a first signification of the term, ‘means the form of any thing. And according to this signification of “species” it is said of Priam: “The species [that is, the lineage or the family] of Priam is worthy to reign”’.󰀄󰀀 et extra ipsius vivere et intelligere, obumbratum umbra temporis vel saltem factionis et causati, facti scilicet, et suppositi, positi sciclicet sub et infra producentem, extra et sub ratione principii, cadens in ordine et sub ordine principati’. 󰀃󰀇. See A. Quero-Sánchez, ‘Ein ,ewig Unwiderlegbares‘’ (in this volume), 󰀂󰀂󰀉-󰀃󰀅. 󰀃󰀈. See M. Vinzent, ‘Personal Pronouns’ (in this volume). See on this Alessandra Beccarisi, ‘Eckhart’s Latin Works’, in Jeremiah M. Hackett (ed.), A Companion to Meister Eckhart (Leiden and Boston, 󰀂󰀀󰀁󰀃), 󰀈󰀅-󰀁󰀂󰀃, 󰀉󰀈. 󰀃󰀉. See above, note 󰀃󰀅. 󰀄󰀀. Thomas of Erfurt, In Isagogas Porphirii, ed. A. Quero-Sánchez, Appendix II below, 󰀂󰀄󰀇,󰀁󰀀-󰀂: ‘Primo ergo praemittit unam acceptionem speciei vulgarem. Dicit quod “species” in prima

T HOMAS

OF

E RFURT

AND

E CKHART

OF

H OCHHEIM

󰀄󰀃

Before I further discuss this passage by Thomas of Erfurt, let me quote another one in Eckhart’s Latin Sermon 󰀂󰀅, from which it becomes quite clear that such a signification of ‘species’ is not crucial to him: Augustine says therefore, that the soul – because it is an image (imago) – is able to assume God’s nature. For an image is as such fully in respect to the thing of which it is an image [...]. It is therefore appropriate when it is said [in the Bible]: ‘So therefore, any one of you who does not renounce all that he has etc. [cannot be my disciple]’ [Lk. 󰀁󰀄:󰀃󰀃]; and in a similar manner: ‘Blessed are the poor [in spirit: for theirs is the kingdom of heaven]’ [Matt. 󰀅:󰀃]; and in a similar manner: ‘[The one who would be my disciple] must deny himself [to take up his cross, and to follow me]’ [Matt. 󰀁󰀆:󰀂󰀄]; and in a similar manner: ‘forget your own people, and your father’s house’ [Ps. 󰀄󰀅:󰀁󰀁]; and in a similar manner: ‘Go from your country, [your people and your father’s household to the land that I will show you]’ [Gen. 󰀁󰀂:󰀁]; and in a similar manner: ‘To them gave he the power to become sons of God [...] which were born not of blood [nor of the will of the flesh, nor of the will of man, but of God]’ [Joh. 󰀁:󰀁󰀂󰀃]. Now, ‘to deny anything you have’ means ‘to deny the creature or everything which is this or that [everything which is something determined]’. For ‘this and that’ means ‘property’, ‘creature’.󰀄󰀁 In its ordinary signification, Thomas says, ‘species’ means, as we have seen above, ‘the form of everything’. Now, it does not mean the ‘substantial form’ (forma substantialis) but only the ‘accidental form’ (forma accidentalis). The substantial form of a man is his soul, by virtue of which he is what he is: a living being with certain characteristics or properties.󰀄󰀂 By contrast, the accidental form means the ‘beauty’, that significatione “dicit formam uniuscuiusque rei, secundum quam speciem dictum est de Priamo: ‘Species Priami digna est imperio’”’. 󰀄󰀁. Meister Eckhart, Latin Sermon 󰀂󰀅, n. 󰀂󰀆󰀆 (LW IV 󰀂󰀄󰀂,󰀁-󰀉): ‘Unde Augustinus dicit quod anima eo quod imago dei est capax. Imago enim, in quantum imago, se tota ad illud est, cuius imago est, sive in ordine, quem ad illud habet, et ad nihil [aliud]. Ad hoc est etiam quod convenienter dicitur [...]. [Dicitur] enim: “nisi quis renuntiaverit omnibus, quae possidet” etc. Item: “beati pauperes”. Item: “abneget semet ipsum”. Item: “obliviscere populum tuum et domum patris tui”. Item: “egredere de terra tua” etc. Item: “dedit eis potestatem filios dei fieri”, “qui non ex sanguinibus” etc. Abnegatio proprii est abnegatio creaturae sive huius et huius. Hoc enim et hoc proprium est, creatura est’. 󰀄󰀂. See Thomas of Erfurt, In Isagogas Porphirii, ed. A. Quero-Sánchez, Appendix II below, 󰀂󰀄󰀇,󰀁󰀃-󰀆: ‘Unde notandum quod duplex est forma. Una est forma substantialis, et ista dicitur illud a quo aliquid informatum est simpliciter, ut est forma substantialis speciei, quae habet res per naturam

󰀄󰀄

A NDRÉS Q UERO -S ÁNCHEZ

is, the right or ‘natural’ order of the different parts composing a thing whichever: The accidental form does not form a thing as a certain being, but it is the reason why we call something ‘nice’ (formosus) and ‘beautiful’ (pulchrum). This accidental form does not therefore form a thing as a certain being, but it forms a thing as something being in a peculiar way. And this is the signification of ‘form’ that Porphyry is using in this passage that we are now analysing, defining it as follows: ‘Form is a graceful disposition of the parts of body’, that is, a ‘beautiful and good [disposition]’. According to this signification, the form is the beauty and the goodness emerging from the graceful disposition of the different parts of something. We are using this second signification of ‘form’ when we say: ‘The species [lineage or family] of Priam’, that is, ‘the goodness and the beauty of Priam’, ‘is worthy to reign’. Those therefore who have a good and graceful disposition of the different parts [of the body], have also a good disposition in mind. And the good and graceful disposition of the parts of the body shows the good disposition of the mind.󰀄󰀃 Thomas then supports his statements in this passage by referring not only to Aristotle but also to Plato: Even this position maintains Aristotle in his [Nicomachean] Ethics: ‘Nobody is happy being very ugly in his form’; and also in informantem quoad esse simpliciter, quia dat sibi esse simpliciter. Anima enim est forma substantialis hominis, quia ab anima homo informatur quoad esse homo simpliciter’. 󰀄󰀃. Thomas of Erfurt, In Isagogas Porphirii, ed. A. Quero-Sánchez, Appendix II below, 󰀂󰀄󰀇,󰀁󰀇-󰀂󰀅: ‘Forma accidentalis est illud a quo aliquid non est informatum simpliciter, sed dicitur ab illo “formosum” et “pulchrum”. Et ista forma accidentalis non dat esse simpliciter, sed dat esse secundum quid et tale. Et hoc modo accipitur in proposito et definitur: Forma est elegans membrorum corporis dispositio, id est, decora et bona. Et sic forma est formositas et pulchritudo causata ex elegante dispositione membrorum. // Et hoc modo dicitur “species Priami”, id est, pulchritudo et formositas Priami, “digna est imperio”, id est, regere. Unde illi qui habent bonam et elegantem dispositionem membrorum, illi etiam habent bonam dispositionem mentis; et bona dispositio elegans membrorum corporis arguit bonam dispositionem mentis et attestatur bonam dispositionem mentis’. See also the α-version, ibid., 󰀂󰀄󰀆,󰀉-󰀁󰀅: ‘Sciendum quod duplex est forma. Quaedam est forma quae dat esse, a qua aliquis dicitur formatus, et de illa non dicitur “species”. Alia est forma a qua aliquis dicitur “formosus” et de illa dicitur “species”. Talis autem forma non est aliud quam elegans, id est, decora et ornata membrorum dispositio, vel – quod idem est – decor et speciositas corporis. Unde olim dictum est de Priamo quod “species Priami digna est imperio”. Decentia enim et formositas corporis signum est bonae dispositionis mentis’.

T HOMAS

OF

E RFURT

AND

E CKHART

OF

H OCHHEIM

󰀄󰀅

the 󰀃rd book On the Soul [we find a corresponding affirmation]: ‘The actions of acting people require [as necessary condition for them] something of a certain disposition as the foundation [subject, ground] on which they can be achieved’. And also, Plato says in Timaeus that ‘the action of the form presupposes a certain disposition in matter’.󰀄󰀄 At the end of this discussion on the accidental form, Thomas tries to infer some political implications from his metaphysical position: ‘Therefore’, he writes, ‘people obey rightly to the graceful prince, assuming that his inner mind is good when they see that the exterior corporeal form is good’.󰀄󰀅 According to Thomas of Erfurt, you can therefore infer from the external appearance of a thing (particularly of a man) the internal or spiritual disposition of it (or of him, or of her). At the end of the second lectture of his Sermons and Lectures on chapter 󰀂󰀄:󰀂󰀃–󰀃󰀁 of Ecclesiasticus, that is, as I said, at the very end of the whole work, Eckhart maintains precisely the opposite position to Thomas of Erfurt, namely the priority of the inner man (of inwardness) over the outer man (over outwardness). Inwardness is the prior or most important thing, which, as Eckhart emphasised, should be realised or brought to the outside: ‘They who manifest (reveal, explain) me (Qui elucidant me) shall have life everlasting’ (Qui elucidant me, vitam aeternam habebunt) (Eccli. 󰀂󰀄:󰀃󰀁). Notice that ‘to explain something’ (e-luci-dare) means ‘to bring something outwards, to the light’ 󰀄󰀄. Cf. Thomas of Erfurt, In Isagogas Porphirii, ed. A. Quero-Sánchez, Appendix II below, 󰀂󰀄󰀉,󰀁-󰀈: ‘Et illud dicit Aristoteles in libro Ethicorum: “Omnis ille non est felix qui est turpissimus in forma”. Et etiam in 󰀃° De anima: “Actus activorum sunt in patiente disposito”. Et etiam Plato dicit in Thimaeo: “Forma agit secundum materiam dispositam”. Et ita, cum formositas et elegantia membrorum dispositio arguit et attestatur bonam dispositionem mentis et intellectus, et quia Aristoteles dicit: “Vigentes in intellectu et ratione aliorum duci sunt et rectores; et qui in his deficiunt aliorum sunt servi et ministri”, et cum formositas attestatur bonam dispositionem mentis, ideo dictum fuit de Priamo: “Species Priami digna est imperio”, id est, formositas et pulchritudo Priami digna est imperio, id est, regere’. See also the α-version, ibid., 󰀂󰀄󰀈,󰀁-󰀅: ‘Unde 󰀁° Ethicorum: “Non omnino felix est, qui specie turpissimus est”. Et in 󰀂° De anima dicitur quod “actus activorum sunt in patiente disposito”. Et in Thimaeo Plato dicit quod “secundum merita materiae dantur formae”. Et convenienter dicitur: “Qualis est in corpore, talis in anima est”. Unde bona dispositio corporis attestatur bonam dispositionem mentis. Et “bene dispositi mente naturaliter sunt aliorum rectores”, ut dicit Philosophus, 󰀁° Politicorum’. 󰀄󰀅. Thomas of Erfurt, In Isagogas Porphirii, ed. A. Quero-Sánchez, Appendix II below, 󰀂󰀄󰀈,󰀆󰀇: ‘Unde etiam homines convenienter obediunt formoso principi ex decentia corporis exterioris bonitatem mentis interius praesumentes’.

󰀄󰀆

A NDRÉS Q UERO -S ÁNCHEZ

(extra luci dare), that is, ‘to manifest something’ (manifestare). [...]. True being is as such an inner being. Now, ‘for living beings “to live” means “to be”’. Therefore whoever has to teach or to manifest (reveal, explain) something (elucidare) must himself be inner light, in his way of life: ‘The life is the light of man’ (Joh. 󰀁). [...]. And this means ‘to manifest (reveal, explain)’ (elucidare): ‘to bring the light which is life and shines inside outwards, into light”.󰀄󰀆 In contrast to Meister Eckhart, Thomas of Erfurt is assuming that there is a relationship between corporal and spiritual things, that is, between the given reality and thought or reason; he is postulating the inevitable attachment of reason or thought to a certain given reality. ‘The actions of acting people require [as a necessary condition for them] something of a certain disposition as the foundation [subject, ground] on which they can be achieved’, he says, as we have just seen, by quoting Aristotle. And he finds the same thesis in Plato: ‘The action of the form presupposes a certain disposition in matter’ (Forma agit secundum materiam dispositam), or, as we read in the α-version: ‘And in Timaeus Plato says that “the forms are given according to the merits of matter” (et in Thimaeo Plato dicit quod ‘secundum merita materiae dantur formae’).󰀄󰀇 This reference to Plato can also be found in Albert the Great, who undoubtedly thinks that this thesis is indeed a true one. I have already discussed the different contexts in which Albert refers to this doctrine in my Habilitation.󰀄󰀈 The term ‘merits’ in the expression ‘according to the merits of matter’ (secundum merita materiae) means here nothing but the respective special dispositions of the different types of matter. Albert discusses this thesis in connection with the thesis of the inchoativity of forms in matter 󰀄󰀆. See Meister Eckhart, In Eccli., n. 󰀆󰀈 (LW II 󰀂󰀉󰀇,󰀁󰀁-󰀂󰀉󰀈,󰀆): ‘“Qui elucidant me, vitam aeternam habebunt”. Notandum quod elucidare est extra luci dare, id est manifestare, Eph. 󰀅: “omne quod manifestatur lumen est”. Sed nota quod ait elucidare. Oportet ergo, ut “qui elucidant”, prius intus luceant. Propter quod primis doctoribus dictum est Matth. 󰀅: “vos estis lux mundi”. “Estis” inquit. Esse verum et intimum est, et “vivere viventibus est esse”. Debet ergo qui docet sive elucidat intus lucere vivendo, Ioh. 󰀁: “vita erat lux hominum”, et iterum: “quod factum est in ipso vita erat”. Et hoc est elucidare, scilicet lucem, quae intus vita lucet et est, extra luci dare’. 󰀄󰀇. See above, note 󰀄󰀄. 󰀄󰀈. See A. Quero-Sánchez, Über das Dasein (󰀂󰀀󰀁󰀃), 󰀅󰀅󰀉-󰀆󰀀󰀂 (Die von außen gegebenen Formen werden ‚nach den Verdiensten der Materiae‘ [secundum merita materiae]) gegeben: Alberts Korrektur am platonischen Idealismus im Sinne der aristotelischen Lehre der ‚Anfänglichkeit der Form in der Materie‘ [inchoatio formarum in materia]).

T HOMAS

OF

E RFURT

AND

E CKHART

OF

H OCHHEIM

󰀄󰀇

(inchoatio formarum in materia), which is also essential for Eckhart’s second lecture of his Sermons and Lectures on chapter 󰀂󰀄:󰀂󰀃–󰀃󰀁 of Ecclesiasticus.󰀄󰀉 We find, however, the central passages in which Eckhart criticises these Albertian positions also in his Latin Sermon 󰀂󰀅 as well as in his Commentary on John’s Gospel, by using a characteristic distinction between the actions of nature and the actions of grace. In the actions of nature there is a correspondence between corporality and spirituality, between reality and thought or reason. In natural actions there is therefore an inevitable attachment of thought to a certain given reality. On the contrary, in the works of grace there is no such correspondence, no such attachment to a certain given reality. ‘Grace’ is here not a theological concept but it means the works of reason, which as such – as rational works – are not merely works of nature, namely insofar as they are not even attached to a certain given reality: Grace means as such what is given to a thing without presupposing any merit at all, gratis [or gratuitously], for nothing, without the mediation of any [real] disposition at all. This pertains, however, only to the most original being of a thing, whatever it be in a thing that has received its being. In all things, the most original being is the one that the thing receives from God; otherwise, God were not the First Cause nor were God [really] God. What a thing firstly is, originates from nothing; for it was nothing before the thing received its first being. That is the reason why this first being was given to the thing without any merit at all, without any mediation, without any disposition, and therefore gratis [or gratuitously]. Every action of God in the creature is therefore grace.󰀅󰀀 The actions of grace do not presuppose therefore any given reality as a sufficient or necessary condition of its activity. Such actions have therefore nothing to do with any kind of natural being, but only with a supernatural one: ‘This is the reason why grace is said to be supernatural’ 󰀄󰀉. See Meister Eckhart, In Eccli., nn. 󰀄󰀅-󰀆 (LW II 󰀂󰀇󰀄,󰀄-󰀂󰀇󰀅,󰀁󰀆). See A. Quero-Sánchez, Über das Dasein (󰀂󰀀󰀁󰀃), 󰀅󰀉󰀅-󰀆󰀀󰀂. 󰀅󰀀. Meister Eckhart, Latin Sermon 󰀂󰀅, n. 󰀂󰀅󰀉 (LW IV 󰀂󰀃󰀇,󰀄-󰀁󰀀): ‘gratia est ex sui natura quod datur sine meritis, datur gratis, pro nihilo, sine medio disponente. Hoc autem competit tantum primo, quodcumque sit illud in suscipiente. Primum autem in singulis est id, quod a deo est. Aliter enim deus non esset prima causa nec deus esset. Primum autem est ex nihilo, et ante ipsum est nihil, et sic sine merito, sine medio, sine dispositione, et per consequens gratis. Sic ergo omnis operatio dei in creatura gratia est’.

󰀄󰀈

A NDRÉS Q UERO -S ÁNCHEZ

(Hinc est quod dicitur gratia esse supernaturalis).󰀅󰀁 But again: This thesis is not to be understood as a theological but as a philosophical one, stating that reason is not merely natural reason, but absolute reason, which, as such, has no attachment to any given reality at all. This is an epistemological or even a metaphysical thesis with some important ethical and political implications, as we have seen; perhaps also with some important theological implications: maybe a ‘democratisation of God’, as Dietmar Mieth writes.󰀅󰀂 Now, I think this theological ‘democratisation’ relies on an understanding of God as an absolute – I mean: as an abstract or even an abegescheiden – power. III.C. The Question about the Nature of Pure Reason Not only ‘abstractness’, as we have just seen, but also ‘purity’ – ‘pure reason’, if you like – is a key concept in Eckhart’s Sermons and Lectures on chapter 󰀂󰀄:󰀂󰀃-󰀃󰀁 of Jesus Sirach. In the passage that I have quoted above, he actually puts these concepts in relatio to each other: ‘Purity of life [...]; the more general (or common) and the more abstract (quanto communius, quanto abstractius) this “being” is, the purer is the life that the expression “to live” signifies’.󰀅󰀃 There are, however, some other important passages in this work in which ‘purity’ plays a crucial role, with Eckhart using in this context his particular understanding of the word class 󰀅󰀁. See Meister Eckhart, Latin Sermon 󰀂󰀅, n. 󰀂󰀆󰀄 (LW IV 󰀂󰀄󰀀,󰀇󰀇-󰀂󰀄󰀁,󰀃): ‘“Gratia dei”. Nota quod gratia est a solo deo pari ratione sicut et ipsum esse. Praeterea sicut aer totus se habet immediate ad solem in ratione illuminabilis, quamvis sit ordo partium aeris in situ, sic omnis creatura immediate se habet ad deum quantum ad esse, quantum ad gratiam et quantum ad omnes perfectiones, maxime communes, indeterminatas ad hoc et hoc. Hoc enim et hoc creatura est, proprium est, mendacium est. Hinc est quod huiusmodi, scilicet perfectiones communes et gratia, dicuntur gratis dari, a deo dari, sine meritis dari scilicet, quia nihil creatum se habet ad huiusmodi active aut fortassis dispositive proprie. Hinc est quod dicitur gratia esse supernaturalis’. 󰀅󰀂. See Dietmar Mieth, ‘Meister Eckhart: Leidenschaft des Denkens, Spiritualität und Lebenskunst’, in Volker Leppin and Hans-Jürgen Schiewer (eds), Meister Eckhart aus theologischer Sicht, MEJb 󰀁 (Stuttgart, 󰀂󰀀󰀀󰀇), 󰀇󰀁-󰀉󰀅, 󰀈󰀂: ‘Ich versuche, für diese Bewegung den provokatorischen Titel “Demokratisierung Gottes” zu verwenden. Das wäre freilich missverstanden, wenn man Demokratie als das Umlegen der Vertikale in die Horizontale sehen würde. Aber da der Adel aus äußeren Privilegien in eine innere, jedem menschlichen zugängliche Freiheit verlegt wurde, hörte die religiöse Verankerung der Privilegien auf, auch wenn sie sich weiter aus anderen Gründen behaupten’. 󰀅󰀃. Meister Eckhart, In Eccli., n. 󰀂 (LW II 󰀂󰀃󰀂,󰀃-󰀆): ‘Vitae puritas: “sumus”. “Vivere viventibus est esse”. Sed li esse – “sumus” – quanto communius, quanto abstractius, tanto purius vitam, quod li vivere, significat’. See above, note 󰀃󰀅.

T HOMAS

OF

E RFURT

AND

E CKHART

OF

H OCHHEIM

󰀄󰀉

‘pronoun’, which is depending, as we will see below, upon its definition by Priscian as it is incorporated by speculative grammarians such as Boethius of Dacia and Thomas of Erfurt.󰀅󰀄 This is the case with the following passage, in which Eckhart is explaining the meaning of Exod. 󰀃:󰀁󰀄 (‘I am the one [i.e. the only one] who is’) [Ego sum Qui sum]):󰀅󰀅 ‘“I” (Ego), that is to say: purity of life. For this [pronoun] “I” signifies the mere, that is pure substance, so that one could say (as is said in the Epistle to the Philippians [󰀁:󰀂󰀁]): “For me to live is Christ”’.󰀅󰀆 Eckhart also uses the adjectives solus (‘mere’) and nudus (‘nude’) in similar contexts, even in his Sermons and Lectures on chapter 󰀂󰀄:󰀂󰀃-󰀃󰀁 of Ecclesiasticus by quoting Porphyry’s Isagoge: Reason (intellectus) [...] apprehends the principles of the thing (principia rei) [...], namely the concepts of the things (rationes rerum) in the highest state: in the original and primordial causes, before they became real existent things; it apprehends thus the things as they are still latent (occult) ‘in the mere, pure, nude reason’ (in solis puris nudis intellectibus [Porphyry]). And such a purity of substance is meant by the [pronoun] ‘I’.󰀅󰀇 ‘The more nude reason (or a concept) is’, Eckhart says in a Latin Sermon in a similar manner, ‘the more powerful it is’ (intellectus [...] quanto nudius, tanto capacius).󰀅󰀈 And it is not difficult to find much more similar passages in his works.󰀅󰀉 󰀅󰀄. See A. Quero-Sánchez, Heideggers Missverständnis (󰀂󰀀󰀁󰀉), 󰀂󰀂󰀉-󰀃󰀅. 󰀅󰀅. For an understanding of my translation of Exod. 󰀃:󰀁󰀄 (Ego sum Qui sum) with ‘I am the one (i.e. the only one) who is’ see Andrés Quero-Sánchez, ‘“The First Cause gives everything to all things, even to that which is nothing”. Origen of Alexandria and Meister Eckhart on Romans 󰀄:󰀁󰀇’, SP 󰀁󰀀󰀀 (󰀂󰀀󰀂󰀀), 󰀃󰀃󰀆-󰀄󰀀. 󰀅󰀆. Meister Eckhart, In Eccli., n. 󰀃 (LW II 󰀂󰀃󰀂,󰀈-󰀉): ‘“Ego”: vitae puritas – li ego enim meram quod est puram substantiam significat – ut possit dicere: “mihi vivere Christus est”, Phil. 󰀁’. See also ibid. n. 󰀆 (󰀂󰀃󰀅,󰀆-󰀇); ibid. n. 󰀈 (󰀂󰀃󰀅,󰀁󰀄-󰀂󰀃󰀇,󰀈); ibid. n. 󰀁󰀀 (󰀂󰀃󰀉,󰀉-󰀁󰀂). 󰀅󰀇. Meister Eckhart, In Eccli., n. 󰀉 (LW II 󰀂󰀃󰀈,󰀂-󰀇): ‘Intellectus [...] principia rei [...] rationes rerum scilicet in summitate causarum originalium sive primordialium, priusquam in res ipsas prodeant, “in solis puris nudis intellectibus” latentes, apprehendit. Sub hac autem puritate substantiae significat li “ego”’. See Porphyry, Isagoge, Latin translation by Boethius, ed. L. Minio-Palluelo, Aristoteles Latinus I 󰀆-󰀇 (Bruges and Paris, 󰀁󰀉󰀆󰀆), 󰀅,󰀁󰀁-󰀂. 󰀅󰀈. Meister Eckhart, Latin Sermon 󰀁󰀁, n. 󰀁󰀁󰀂 (LW IV 󰀁󰀀󰀅,󰀈-󰀁󰀁). 󰀅󰀉. See Meister Eckhart, Latin Sermon 󰀂󰀄, n. 󰀂󰀄󰀆 (LW IV 󰀂󰀂󰀅,󰀁󰀁-󰀂); Latin Sermon 󰀅󰀅, n. 󰀅󰀃󰀉 (󰀄󰀅󰀂,󰀉-󰀁󰀂); ibid. n. 󰀅󰀄󰀇 (󰀅󰀈,󰀄-󰀁󰀁); In Exod., n. 󰀂󰀇󰀆 (LW II 󰀂󰀂󰀂,󰀁󰀁-󰀂 [Rec. CT] [Rec. E – vacant]); In Ioh., n. 󰀃󰀄 (LW III 󰀂󰀇,󰀁󰀂-󰀂󰀈,󰀂); ibid. n. 󰀃󰀉󰀇 (󰀃󰀃󰀈,󰀁-󰀉); In Gen. I, n. 󰀁󰀆󰀈 (LW I,󰀁, 󰀃󰀁󰀃,󰀁󰀂-󰀃󰀁󰀄,󰀅 [Rec. CT]; I,󰀂, 󰀁󰀉󰀉,󰀂󰀃-󰀈 [Rec. L] [Rec. E – vacant]); In Gen. II, n. 󰀃󰀁 (LW I,󰀁, 󰀄󰀉󰀉,󰀅-󰀅󰀀󰀀,󰀁󰀃 [Rec. CT]; I,󰀂, 󰀃󰀅󰀆,󰀁󰀆-󰀃󰀅󰀇,󰀇 [Rec. alt.]); ibid. n. 󰀃󰀂 (LW I,󰀁, 󰀅󰀀󰀁,󰀁-󰀆 [Rec. CT]; I,󰀂, 󰀃󰀅󰀇,󰀈-󰀁󰀂 [Rec. alt.]).

󰀅󰀀

A NDRÉS Q UERO -S ÁNCHEZ

In his Commentary on Porphyry’s Isagoge, Thomas of Erfurt also discusses – of course – the passage of Porphyry that Eckhart quotes for arguing that we only find true knowledge in pure reason (‘in the mere, pure, nude reason’ [in solis puris nudis intellectibus]). Thomas explicitely raises the question about the nature of pure reason in even this context: ‘What does Porphyry mean by speaking of mere, pure and nude reason?’󰀆󰀀 His answer to this question clearly shows that his position is precisely opposite to that of Eckhart: [...] mere reason concerns thoughts to which nothing corresponds in reality, e.g. a figment of the imagination [...]. By contrast, non-mere reason concerns thoughts to which something corresponds in reality, e.g. the thought of stone or of wood, etc. Nude reason is as such not dressed with any intelligible species or form, e.g. the reason of a child at the beginning of his existence, which is like a tabula rasa, without any image on it. By contrast, non-nude reason is dressed with some intelligible species and forms. Pure reason is as such free of any images (representations) as well as not bound to any bodily organ; this is the case with God’s reason. By contrast, non-pure (impure) reason knows the world through some images (representations) and is bound to some bodily organ; this is the case with human reason, of which Aristotle, in his third book On the Soul, says that ‘it is necessary that the one who knows something knows it through some images (representations)’.󰀆󰀁 ‘Unmediated knowledge’ – i.e. some sort of ‘intellectual intuition’ – according to Thomas of Erfurt, therefore, is not characteristic of human 󰀆󰀀. See Thomas of Erfurt, In Isagogas Porphirii, ed. A. Quero-Sánchez, Appendix III below, 󰀂󰀅󰀈,󰀁-󰀂: ‘Ad evidentiam istarum quaestionum notandum est quid significetur per hos tres intellectus, scilicet per intellectum solum, nudum et purum’. 󰀆󰀁. Thomas of Erfurt, In Isagogas Porphirii, ed. A. Quero-Sánchez, Appendix III below, 󰀂󰀅󰀈,󰀃-󰀁󰀂: ‘Sciendum quod intellectus solus est cui nihil ex parte rei correspondet, ut intellectus alicuius figmenti, ut chimerae vel hircocervi, et sic de aliis. Per oppositum autem intellectus non solus est cui aliquid ex parte rei correspondet, ut intellectus lapidis vel ligni, etc. // Intellectus nudus est qui speciebus et formis intelligibilibus non est vestitus, ut intellectus pueri in prima sui creatione, qui est sicut tabula rasa in qua nihil est depictum. Per oppositum intellectus non nudus est qui aliquibus formis et speciebus intelligibilibus est vestitus. // Intellectus purus est qui ab omni fantasmate est denudatus et nulli organo corporeo est alligatus, ut intellectus divinus. Per oppositum intellectus impurus est qui ex fantasmatibus intelligit et organo corporeo est alligatus, ut intellectus humanus, de quo dicitur 󰀃° De anima quod “intelligentem quemcumque necesse est fantasmata speculari”’.

T HOMAS

OF

E RFURT

AND

E CKHART

OF

H OCHHEIM

󰀅󰀁

reason, which is, as such, always in need of some ‘representations’ or ‘images’ (fantasmata) ‘through’ which it knows whatever it might know.󰀆󰀂 This is, of course, not how Meister Eckhart conceives human knowledge which is as such – as knowledge –, Eckhart says, not merely a human but a divine activity, namely in as much as it is liberated’ or ‘absolved’ (‘ab-soluted’ or ‘detached’ [ab-geschieden]) from any ‘image’ (bilde) at all. He speaks in this context of a process of entbildung – i.e. a liberation from any kind of images – as the fundamental requirement for knowing in an unmediated manner what things are in themselves.󰀆󰀃 Now, considered from the ‘Averroistic’ perspective of Thomas of Erfurt, this is a totally impossible task for any human being. IV. Conclusion Was there actually a dialogue between Thomas of Erfurt and Eckhart of Hochheim in Erfurt at the turn of the 󰀁󰀄th century, as the title of my contribution states? It is surely not easy to answer this question with certainty. Some historical research is still to be done for clarifying this question. Now, if there was actually some kind of dialogue between them, it was undoubtedly a ‘controversial’ one, since their metaphysical positions are clearly in contradiction to each other. Particularly with regard to Eckhart’s Sermons and Lectures on chapter 󰀂󰀄:󰀂󰀃-󰀃󰀁 of Ecclesiasticus, 󰀆󰀂. See also Thomas of Erfurt, In Isagogas Porphirii, ed. A. Quero-Sánchez, Appendix III below, 󰀂󰀆󰀅,󰀈-󰀁󰀅 (version β): ‘Nec etiam sunt universalia in intellectu puro, sed in suo opposito, scilicet in intellectu non puro. Quia intellectus purus est qui est depuratus ab omni fantasmata et organo corporali non est alligatus. Talis intellectus est primae causae, quia omnia cognoscit absque fantasmata et non est alligatus organo corporali. Sed ita non sunt in intellectu non puro, quia ille intellectus est humanus, quia ille intellectus intelligit vel cognoscit universalia praeexsistente fantasmata et hac virtute intus agentis, qui abstrahit ab hoc vel ab alio rem conceptam per fantasmatam, quia intellectus humanus nihil intelligit nisi per fantasmata intelligat, quia nihil est in intellectu nisi prius fuerit in fantasmata, quia necesse est omnem intelligentem fantasmata speculari. Unde nihil aliud est quam quidam intellectus procedens a sensibus. Et ita universalia sunt in intellectu non puro, quia alligatur organo corporali’. 󰀆󰀃. See Andrés Quero-Sánchez, ‘“Go from your country and your kindred and your father’s house!” (Gen. 󰀁󰀂:󰀁): Schelling’s Boehmian Redefinition of Idealism’, in Martin Fuchs, Antje Linkenbach, Martin Mulsow, Bernd-Christian Otto, Rahul B. Parson and Jörg Rüpke (eds), Religious Individualisation (Berlin and New York, 󰀂󰀀󰀂󰀀), 󰀂󰀂󰀆-󰀈, § 󰀂 (Schelling’s Analyticity-Principle as Mystical entbildung); id., ‘“The Head and Father of True Philosophy”: Schelling’s Philosophy of Identity, Meister Eckhart’s Mysticism, and Plato’s Understanding of Being’, in Dietmar Mieth and Regina D. Schiewer (eds), Religiöse Selbstbestimmung: Anfänge im Spätmittelalter, MEJb.B 󰀅 (Stuttgart, 󰀂󰀀󰀂󰀀), 󰀂󰀀󰀅-󰀁󰀃, § I.A. (Immediateness).

󰀅󰀂

A NDRÉS Q UERO -S ÁNCHEZ

it seems to me that some passages can be best understood as a reaction against positions that we find in Thomas of Erfurt’s Commentary on Porphyry’s Isagoge, as I will show below. However, we find these same positions that Eckhart is criticising not only in this work of Thomas of Erfurt, but also in some other major authors who were active at the University of Paris some years before, particularly in Siger of Brabant and Boethius of Dacia, as well as in some other more ‘orthodox’ thinkers, such as Godfrey of Fontaines and Albert the Great.󰀆󰀄 Either way, it is a fact that Thomas of Erfurt repeatedly quotes from Albert’s writings in his Commentary on Porphyry’s Isagoge, particularly – not exclusively, though – from Albert’s logical works. Should there still be anyone looking for some kind of philosophico-theological School of Albert the Great in Germany in the Late Middle Ages (the so-called Albert-Schule), I would think then one might take a look not at the works of Meister Eckhart or Dietrich of Freiberg󰀆󰀅 but rather at those of Thomas of Erfurt.

󰀆󰀄. See A. Quero-Sánchez, Über das Dasein (󰀂󰀀󰀁󰀃), 󰀁󰀅󰀄-󰀂󰀀󰀇 and 󰀅󰀁󰀉-󰀇󰀀󰀄. See also id., Individuum, Modernität und Aufklärung (󰀂󰀀󰀁󰀄), 󰀁󰀅-󰀄󰀇; id., ‘Der mittelalterliche Disput zwischen Realismus und Idealismus: Meister Eckhart, Gottfried von Fontaines und Marguerite Porete’, in Markus Vinzent, Dietmar Mieth, Christopher M. Wojtulewicz and Marie-Anne Vannier (eds), Meister Eckhart in Paris and Strasbourg, Eckhart: Texts and Studies 󰀄 (Leuven, 󰀂󰀀󰀁󰀇), 󰀁󰀀󰀉-󰀅󰀅, 󰀁󰀁󰀂-󰀄󰀃. 󰀆󰀅. See Andrés Quero-Sánchez, ‘San Alberto Magno y el Idealismo Alemán de la Edad Media Tardía (Maestro Eckhart y Teodorico de Freiberg)’, Revista española de Filosofía Medieval 󰀁󰀈 (󰀂󰀀󰀁󰀁), 󰀉󰀅-󰀁󰀂󰀂.

Modistik und Metaphysik. Berührungspunkte zwischen der spekulativen Grammatik und Meister Eckharts Metaphysik STEPHAN GROTZ, CATHOLIC UNIVERSITY OF LINZ, AUSTRIA For Ljida and Mike in friendship and gratitude Abstract This paper’s aim is to show how Meister Eckhart utilizes grammatical features for one of his crucial problems – the so-called ‘theory of analogy’. In this view Eckhart presents himself as an idiosyncratic interpreter of a speculative grammar reflected by the modistae of his own time. 󰀁. Vorüberlegung

W

enn sich irgendwo Formen in den Vordergrund schieben, dann kann dies allzu leicht den Eindruck des Hohlen und Inhaltsleeren erwecken. Das gilt für viele Lebensbereiche; auch der Bereich der Sprache macht da keine Ausnahme. Unmittelbar ersichtlich wird dies an tautologischen Sätzen wie etwa ‚Ein Stein ist ein Stein‘, ‚Eine Rübe ist eine Rübe‘; allgemein formuliert: ‚A ist A‘. Die offensichtliche Inhaltsleere solcher Sätze haben schon die antiken Grammatiker und Rhetoriker durchweg als vitiös, als unbrauchbar für die sprachliche Gestaltung gebrandmarkt. Tautologien und ihnen verwandte Sprachphänomene gehören für sie zur Gattung der Sprechblasen, die den Leser oder Hörer rasch ermüden und die daher tunlichst zu vermeiden sind.󰀁 󰀁. Nachweise bei Stephan Grotz, Vom Umgang mit Tautologien. Martin Heidegger und Roman Jakobson, Topos Poietikos 󰀂 (Hamburg, 󰀂󰀀󰀀󰀀), Kap. ‚Tautologien der Ars grammatica und der Ars rhetorica‘, 󰀇-󰀁󰀆.

󰀅󰀄

S TEPHAN G ROTZ

Zugleich aber ist es eben diese offensichtliche Inhaltsleere von tautologischen Sätzen, die die Satzform als solche besser zu Tage treten lässt. Und an dieser Satzform zeigt sich dann insbesondere der Begriff und das weit verzweigte Problemfeld der Identität. Die philosophische Reflexion auf die tautologische Satzform ist denn auch ganz verschiedene Wege gegangen, etwa bei Cusanus, bei Schelling und Hegel oder auch bei Martin Heidegger.󰀂 Wenn demnach der Inhalt bzw. die gängige lexikalische Bedeutung in sprachlichen Gebilden zurückgedrängt wird, dann kann mit der formalen Ebene dieser Sprachgebilde ein bestimmtes Problem sichtbar und namhaft gemacht werden, das sich auf anderem Weg nur schwer fassen ließe. Dies mag nun alles bei sprachlichen Phänomenen gelten, die zwar einen etwas reduzierten Inhalt besitzen, aber immerhin noch einen Inhalt vorweisen können. Der tautologische Satz ‚Eine Rübe ist eine Rübe‘ mag zwar wenig ‚die gegebene Erkenntnis vergrößern‘;󰀃 doch ist hier immerhin noch von einer Rübe die Rede. Was hingegen sollte man sich an diejenigen Wörtern und Wortverbindungen klar machen können, deren Inhalt wirklich gleich Null ist und die daher auch nicht der ordinary language angehören? Ich denke da an das Kunstwort ‚Kuboa‘, das Knut Hamsun in seinem Roman ‚Hunger‘ extensiv traktiert hat; mehr aber noch an den berühmten Satz, der sich gleich zu Anfang in Rudolf Carnaps ‚Logik der Syntax‘ findet: ‚Piroten karulieren elatisch‘.󰀄 Jenseits von den spezifischen Intentionen, die Carnap mit seinem Satz verfolgt, führt dieser Satz anschaulich Folgendes vor Augen: Auch die reinen, von allem Inhalt gereinigten grammatischen Formen haben eine eigene Bedeutsamkeit. Zwar kann niemand erklären, wer oder was ‚Piroten‘ sind, bzw. was unter ‚karulieren‘ zu verstehen ist. Gleichwohl wird hier einiges mitgeteilt: etwa, daß es sich nicht um einen einzelnen ‚Piroten‘, sondern um mehrere handelt; daß sich deren Tätigkeit im präsentischen und aktivischen Modus vollzieht: Unsere ‚Piroten‘ werden also weder ‚karuliert‘, noch ‚haben sie karuliert‘; sie vollziehen ihre Tätigkeit im Hier und Jetzt. Hinzu kommt noch eine modale Abschattung: Piroten 󰀂. Dazu ibid., 󰀁󰀇-󰀇󰀃 (zu Platon, Aristoteles, Wilhelm von Ockham und Meister Eckhart); 󰀈󰀅-󰀁󰀇󰀂 (zu Martin Heidegger). 󰀃. Kant, Prolegomena § 󰀂 (ed. Cassirer IV 󰀁󰀄). 󰀄. Rudolf Carnap, Logik der Syntax (Wien und New York, 󰀂󰀁󰀉󰀆󰀈), 󰀂.

M ODISTIK

UND

M ETAPHYSIK

󰀅󰀅

‚karulieren‘ nicht einfach vor sich hin, sondern tun dies im Modus des ‚Elatischen‘. In Carnaps Satz wird also bereits über die grammatischen Formen, noch vor und unabhängig von der Lexik, ein Inhalt transportiert. Der Satz illustriert damit das Problemfeld der sogenannten ‚grammatischen Bedeutung‘ (grammatical meaning), die in der Linguistik und Poetik des 󰀂󰀀. Jhds. intensiv bearbeitet worden ist. Die erste bedeutende begriffliche Fassung dieses Problemfeldes hat im Konzept des modus significandi ihren Niederschlag gefunden.󰀅 󰀂. Die Form als Bedeutungsträger (Modistik) In diesem modus significandi sah bekanntlich eine Gruppe von Gelehrten, welche vorwiegend an den Artisten-Fakultäten des 󰀁󰀃. und 󰀁󰀄. Jhds. beheimatet waren, etwas so Entscheidendes und Irreduzibles, daß sie darauf eine eigenständige Wissenschaft von der Sprache ‒ eben die sog. modistische bzw. spekulative Grammatik ‒ gründeten.󰀆 Die grammatischen Formen und ihr konstitutiver Beitrag zur sprachlichen Bedeutung besitzen nach Überzeugung dieser modistischen Grammatiker einen so elementaren und damit einen so selbstverständlich-unbefragten Charakter, daß sie bis dato mit den gängigen wissenschaftlichen Mitteln und innerhalb des gängigen Wissenschaftssystems gar nicht zureichend erfaßt werden konnten. Die Aufwertung der Grammatik zu einer eigenen philosophisch-theoretischen Disziplin sollte daher dem modus significandi zum Durchbruch verhelfen.󰀇 󰀅. Zur Theorie der grammatical meanings, die vor allem mit dem Namen von Roman Jakobson verknüpft ist, vgl. S. Grotz, Vom Umgang (󰀂󰀀󰀀󰀀), 󰀂󰀁󰀅-󰀂󰀇. Im übrigen waren es zuerst Linguisten und Semiotiker, die an das sprachtheoretische Erbe der spekulativen Grammatik erinnerten. Vgl. dazu etwa Roland Barthes, ,Die alte Rhetorik‘, in id., Das semiologische Abenteuer, a. d. Franz. übs. von Dieter Hornig, Edition Suhrkamp 󰀁󰀄󰀄󰀁 (Frankfurt a.M., 󰀁󰀉󰀈󰀈), 󰀁󰀅-󰀁󰀀󰀁, 󰀄󰀀-󰀁 (zu den modistae); sowie Roman Jakobson, ‚Glosses on the Medieval Insight into the Science of Language‘, in id., Contributions to Comparative Mythology. Studies in Linguistics and Philology 󰀁󰀉󰀇󰀂‒󰀁󰀉󰀈󰀂, Selected Writings 󰀇, ed. by Stephen Rudy, preface by Linda R. Waugh (Berlin u.a., 󰀁󰀉󰀈󰀅), 󰀁󰀈󰀅-󰀉󰀈. 󰀆. Auch wenn mittlerweile zahlreiche, überwiegend linguistische Einzelstudien zu den Modisten vorliegen, bleibt aus philosophiehistorischer Perspektive immer noch unüberholt: Jan Pinborg, Die Entwicklung der Sprachtheorie im Mittelalter, BGPhThMA XLII, 󰀂 (Münster und Kopenhagen, 󰀁󰀉󰀆󰀇). 󰀇. Näheres dazu in meinem Vorwort zu: Thomas von Erfurt, Abhandlung über die bedeutsamen Verhaltensweisen der Sprache (Tractatus de Modis significandi), übersetzt und eingeleitet von Stephan

󰀅󰀆

S TEPHAN G ROTZ

Um in einem Eckhartischen Bild zu reden: Nur die modistische Grammatik stößt durch die Oberfläche zum Kern der Sprache, und das meint: zu ihrem formalen Gerüst durch. Vor allem Inhalt kommt es auf dieses formale Gerüst an, welches nur auf den ersten Blick so bedeutungsarm ist und daher nicht der Rede wert erscheint. Auf den zweiten Blick jedoch zeigt sich: Sprachliche Bedeutsamkeit ist nicht einfachhin gegeben, sondern immer schon so und so gegeben, also in einer bestimmten Art geformt, in bestimmte grammatische Formen gegossen. Vor Augen führen kann man sich dies an jedem beliebigen Bedeutungsfeld. Handelt es sich also um einen bestimmten Tatbestand oder Gegenstand, so wird dies über die substantivische Form zum Ausdruck gebracht, also etwa durch das Substantiv ‚Schmutz‘. Liegt der Fokus auf einer Eigenschaft, die einem Gegenstand anhaftet, so kommt dies mit der adjektivischen Form zum Ausdruck, etwa mit ‚schmutzig‘. Der Aspekt, daß ein Ding Veränderungen an seiner Umwelt herbeiführen kann, wird über die verbale Form sprachlich vermittelt, also z. B. mit ‚schmutzen‘ oder ‚beschmutzen‘. Ein und dasselbe Bedeutungsfeld manifestiert sich also immer in verschiedenen grammatischen Formen; wobei es keine Grundform gibt, auf die sich ausnahmslos alle grammatischen Formen zurückführen ließen. Zwar gibt es wichtige oder essentielle Formen wie das Substantiv oder das Verb, die sich allerdings nicht wiederum aufeinander reduzieren lassen. Ein Bedeutungsfeld muß sich daher auch nicht notwendig in einer bestimmten oder gar in allen Wortklassen ausprägen. So gibt es etwa im Deutschen zu dem Substantiv „Honig“ kein entsprechendes Adjektiv, und umgekehrt besitzt das Adverb ‚gerne‘ kein substantivisches Pendant. Damit ist auch gesagt, daß sich die Wirklichkeit nicht einfach eins zu eins über das grammatische Raster einer bestimmten Sprache abbildet oder abbilden läßt. Für die Modisten konnte dies bereits an einem einfachen Umstand abgelesen werden: Den zehn aristotelischen Kategorien, welche ihrem Anspruch nach die fundamentalste begriffliche Einteilung der Wirklichkeit liefern, stehen in der (lateinischen) Sprache nur sieben bzw. acht Wortklassen (partes orationis) gegenüber, je nachdem, ob man nun Priscian oder Donatus als den beiden unbestrittenen grammatischen Autoritäten folgte. Und so stellt das grammatische Raster einer Sprache Grotz, Bochumer Studien zur Philosophie 󰀂󰀇 (Amsterdam und Philadelphia PA, 󰀁󰀉󰀈󰀈), vii-xv. Dort auch weitere Hinweise auf Forschungsliteratur.

M ODISTIK

UND

M ETAPHYSIK

󰀅󰀇

zunächst auch nur Möglichkeiten bereit, damit die Wirklichkeit auf bestimmte Weise in der Sprache zum Ausdruck kommen kann. Freilich erfolgt solch eine Umsetzung von Wirklichkeit in Sprache nicht von alleine. Im und mit dem grammatischen Raster setzt vielmehr der menschliche Intellekt seine Auseinandersetzung mit der Wirklichkeit eigenständig, geradezu kreativ um. Diesen kreativen Aspekt, daß wir uns mittels der Sprache aktiv mit der Wirklichkeit auseinandersetzen, statt sie passiv einfach abzubilden, hat Thomas von Erfurt, dessen ‚Grammatica speculativa‘ den Höhepunkt der modistischen Bewegung bildet, noch schärfer als seine Vorgänger terminologisch hervorgehoben: Für Thomas hat sich die modistische Grammatik ausschließlich mit den modi significandi activi zu beschäftigen, also mit den grundsätzlichen Formen, wie der menschliche Intellekt mittels der Sprache die Wirklichkeit einzufangen weiß.󰀈 Die menschliche Sprache ist für Thomas somit nichts Naturwüchsiges, sondern das Produkt des menschlichen Geistes, ihr wohnt daher schon von ihrem grammatischen Aufbau her eine Logizität inne. Dies hat zur Folge: Der menschliche Intellekt kann in vollem Bewußtsein demjenigen sprachliche Wirklichkeit verleihen, was überhaupt nicht oder nicht in dieser Form extramental existiert. Hierfür ein Beispiel aus Thomas von Erfurts Traktat: Das Wort ‚deitas‘ (Gottheit) weist ein feminines Genus auf. Grammatisch ist damit auf der Ebene des modus significandi signalisiert, daß es sich um etwas handeln muß, was prinzipiell einer Einwirkung unterliegen kann. Dabei ist klar, daß auf sachlicher Seite dies nicht gelten kann: Gott kann nie und nimmer einer Einwirkung von außen unterliegen. Dem Einwand, daß also diesem modus significandi sachlich nichts entspricht, er somit falsch und unlogisch sei, begegnet 󰀈. Soweit ich sehe, kennt nur Thomas die Differenzierung der modi significandi activi, welche allein in den Gegenstandsbereich der Grammatica speculativa fallen, von den modi significandi passivi. Diese Differenzierung ist für Thomas so fundamental, daß er damit seinen Traktat beginnt: modus significandi duo importat aequivoce. dicitur enim de modo significandi activo et passivo. modus significandi activus est modus sive proprietas vocis, ab intellectu sibi concessa, mediante qua vox propreitatem rei significat. Modus significandi passivus est modus sive proprietas rei, prout est per vocem significata. (,Mit „Bedeutungsmodus“ ist äquivok Zweierlei gemeint. Man spricht nämlich von einem aktivischen sowie von einem passivischen Bedeutungsmodus. Der aktivische Bedeutungsmodus ist ein Modus, d. h. ein typisches Verhalten des lautlichen Ausdrucks, das diesem vom Intellekt eingeräumt wird; in diesem seinem Verhalten zeigt der lautliche Ausdruck eine dingliche Verhaltensweise an. Der passivische Bedeutungsmodus kommt dem Modus, d. h. dem typischen Verhalten eines Dinges gleich, insofern dieses Verhalten vermittels des lautlichen Ausdrucks repräsentiert wird‘).

󰀅󰀈

S TEPHAN G ROTZ

Thomas mit dem Hinweis, daß unser Intellekt hier eine Übertragungsleistung (attributio) vornimmt. Er überträgt nämlich auf Gott eben die spezifische Verhaltensweise eines Dinges, das sich zu etwas anderem verhalten kann, und verleiht dieser Übertragungsleistung sprachlichen Ausdruck. Das hat nach Thomas auch seinen guten Grund: Jegliches Beten zu Gott wäre sonst vergebens, wenn wir uns Gott nicht auch als der Einwirkung fähig vorstellen würden.󰀉 Die der Sprache immanente Logizität, die durchaus nicht immer mit der Wirklichkeit konform sein muß, zeigt sich aber nicht nur auf der Ebene einzelner Wortformen, sondern insbesondere an dem Umstand, daß die Sprache ein syntaktisches System darstellt. Jedes einzelne Wort kann sich von daher in die höhere Einheit des Satzes einfügen.󰀁󰀀 Mit der einzigen Ausnahme des Martinus de Dacia trägt nur Thomas diesem Umstand in seiner ‚Grammatica speculativa‘ Rechnung: Nach einer allgemeinen Einleitung gliedert er seine Schrift in zwei Großabschnitte, die mit ‚Etymologia‘ bzw. mit ‚Diasynthetica‘ überschrieben sind. Während sich die ‚Etymologia‘ entgegen dem heute üblichen Wortsinn mit der Morphologie der acht Wortklassen (partes orationis) im einzelnen beschäftigt, betrachtet die ‚pars diasynthetica‘ eben diese Wortklassen als constructibiles, als Satzglieder bei ihrem Verhalten im kongruenten Verbund mit anderen Satzgliedern. Die grammatische Kongruenz ist in dieser Perspektive ein eigenständiges Prinzip und von so fundamentaler Wichtigkeit für die menschliche Sprache, daß eigentlich sie die Möglichkeitsbedingung für die Sinnhaftigkeit jeder sprachlichen Äußerung ist, und sei es noch so rudimentär. Ich möchte nur an den eingangs erwähnten Carnap‘schen Beispielsatz erinnern: Wäre Carnaps Satz nicht grammatisch kongruent konstruiert, wäre er vollkommen sinnlos. 󰀃. Formale Metaphysik (Meister Eckhart) Ob Meister Eckhart Thomas von Erfurt oder gar dessen Hauptschrift gekannt hat, können wir nicht mit dokumentarischer Sicherheit sagen. Einige Indizien sprechen aber dafür: Thomas und Eckhart befinden sich höchstwahrscheinlich in einem bestimmten Zeitraum am selben Ort, in 󰀉. Vgl. Thomas von Erfurt, Abhandlung (󰀁󰀉󰀉󰀈), 󰀃–󰀄 (Kap. II, 󰀇‒󰀉). 󰀁󰀀. So schon R. Barthes, ‚Die alte Rhetorik‘ (󰀁󰀉󰀈󰀈), 󰀄󰀁.

M ODISTIK

UND

M ETAPHYSIK

󰀅󰀉

Erfurt.󰀁󰀁 Sie gehören beide dem akademischen Milieu an, vielleicht ist auch Thomas Kleriker. Des weiteren kennt Eckharts etwas älterer Mitbruder Dietrich von Freiberg die damals neuartigen Theorien der Modisten; er verwendet sie affirmativ in seinen Schriften, welche Eckhart mit Sicherheit gekannt hat.󰀁󰀂 Man könnte einen Indizienprozeß in diesem Stil noch weiter fortführen. An eine Schranke jedoch wird man dabei über kurz oder lang gelangen: an Eckharts Schriften. Ist nämlich Eckhart schon im allgemeinen wenig auskunftsfreudig, was etwa die eigenen Intentionen und die grundsätzlichen Methoden seines Denkens angeht, so ist er dies noch weit weniger bei dem, was die besondere sprachliche Fassung seiner Schriften und seine explizite Reflexion auf die Sprache im allgemeinen betrifft. Kein Wunder also, daß wir in Eckharts Schriften keine direkte Bezugnahme auf irgendwelche Theoreme der Modisten finden. Selbst der Terminus modus significandi taucht kaum auf, und wenn, dann schon gar nicht in der spezifischen Verwendung wie bei den Modisten. Wie man es dreht und wendet: aus Eckhart läßt sich kein Modist, nicht einmal ein verkappter Modist machen. Und doch schien und scheint mir der Versuch nicht frucht- und aussichtslos zu sein, Eckharts Metaphysik mit der spekulativen Grammatik des Thomas von Erfurt engzuführen.󰀁󰀃 Die beide Autoren verbindende Brücke ist offensichtlich ihre Aufmerksamkeit auf eine Bedeutsamkeit von sprachlichen Formen. Dabei will ich durchaus mehr behaupten, als daß Thomas und Eckhart demselben ‒ ob nun einem spätmittelalterlichen oder einem Erfurter ‒ Zeitgeist huldigen. Ich möchte nämlich zu zeigen versuchen, daß einige zentrale Lehrstücke von Eckharts Metaphysik 󰀁󰀁. Zu Thomas’ Vita siehe etwa Sönke Lorenz, Studium generale Erfordense. Zum Erfurter Schulleben im 󰀁󰀃. und 󰀁󰀄. Jahrhundert, Monographien zur Gesch. d. MA 󰀃󰀄 (Stuttgart, 󰀁󰀉󰀈󰀉), 󰀃󰀁󰀂-󰀃. Für Eckhart ist immer noch sehr lesenswert: Kurt Ruh, Meister Eckhart. Theologe, Prediger, Mystiker (München, 󰀂󰀁󰀉󰀈󰀉). 󰀁󰀂. Ruedi Imbach hat als erster Verbindungslinien zwischen der Lehre von den modi significandi und Eckharts Mitbruder Dietrich von Freiberg gezogen. Demnach „verwendet“ Dietrich in seiner Schrift De ente et essentia wie selbstverständlich „diese Lehre als Instrument, sie ist keineswegs Selbstzweck“, was wiederum den Schluß nahelegt, daß diese späterhin heftig bekämpfte modistische Lehre zumindest in Eckharts Umfeld Akzeptanz erfahren hat. Siehe dazu Ruedi Imbach, ‚Gravis iactura verae doctrinae. Prolegomena zu einer Interpretation der Schrift De ente et essentia Dietrichs von Freiberg O. P.‘, FZPhTh 󰀂󰀆 (󰀁󰀉󰀇󰀉), 󰀃󰀆󰀉-󰀄󰀂󰀅, 󰀄󰀁󰀃-󰀉. 󰀁󰀃. Einen ersten Versuch habe ich unternommen in: ‚Zwei Sprachen und das Eine Wort. Zur Identität von Meister Eckharts Werk‘, Vivarium 󰀄󰀁 (󰀂󰀀󰀀󰀃), 󰀄󰀇-󰀈󰀃.

󰀆󰀀

S TEPHAN G ROTZ

besser verstehbar sind, wenn wir wie Eckhart die Aufmerksamkeit auf die grammatische Struktur der dabei verwendeten Termini richten. Ich wende mich daher einem der eigenwilligsten und markantesten Theoriestücke Eckharts zu: seiner sog. Analogielehre.󰀁󰀄 Dabei geht es mir nicht um eine erschöpfende, möglichst viele Aspekte integrierende Diskussion dieser viel besprochenen Lehre, sondern um einen grundsätzlichen und daher auch universalisierbaren Aspekt an dieser so typisch Eckhartischen Lehre. Es ist zudem dieser Aspekt, unter dem sich wohl am deutlichsten Eckharts Metaphysik mit der zeitgenössischen spekulativen Grammatik engführen läßt. Das Spezifische an Eckharts Verständnis der Analogie wird vielleicht am schnellsten faßbar, wenn man zunächst festhält, was eine Analogie nach Eckhart nicht leisten kann und soll. Eine Analogie erbringt nämlich für Eckhart keine Übertragungsleistung. Das meint: Es gibt hier keine Fokalbedeutung, die dann auf weitere Instanzen per analogiam übertragen wird. Eckharts bekanntestes Beispiel für solch eine Übertragung ist ein Aristotelisches: Als „gesund“ bezeichnen wir primär einen lebendigen Organismus, dann aber per analogiam alles, was mit der Gesundheit dieses Organismus in einem sachlichen Zusammenhang stehen kann; also z. B. eine Speise, die gesund im Sinne von gesundheitsfördernd sein kann, oder den Urin, insofern er als Indikator für die Gesundheit eines Körpers fungiert. Eckhart hat also nicht eine primäre konkrete Verwendungsweise von sanus im Blick, die per analogiam andere konkrete Verwendungsweisen von sanus verständlich werden läßt. Vielmehr gestaltet sich bei Eckhart die Attributionsanalogie als eine Bezugsform, bei der es einzig und allein einen Pol gibt, der den Gehalt der jeweiligen Analogie verwirklicht, und das meint: vollkommen verwirklicht. Sprachlich kommt dieser Umstand dadurch zum Ausdruck, daß Eckhart an vielen Stellen einen Terminus in konkreter Verwendung ‒ also etwa sanus, albus, iustus ‒ mit dem entsprechenden Nomen abstractum ‒ also etwa mit der sanitas, albedo und 󰀁󰀄. Ältere Literatur zu Eckharts Analogielehre etwa bei Burkhard Mojsisch, Meister Eckhart. Analogie, Univozität und Einheit (Hamburg, 󰀁󰀉󰀈󰀃), 󰀅󰀁-󰀂 mit Anm. 󰀄󰀃. Näheres auch bei Stephan Grotz, ‚Nur mit Vorsicht zu genießen. Die Lehre von der Ewigkeit der Welt bei Meister Eckhart und Nicolaus Cusanus‘, in Meister-Eckhart-Jahrbuch 󰀄 (Stuttgart, 󰀂󰀀󰀁󰀀), 󰀈󰀃-󰀁󰀀󰀆, 󰀉󰀃-󰀅. Sehr wertvolle Hinweise neuerdings in Markus Vinzent, The Art of Detachment, Eckhart: Texts and Studies 󰀁 (Leuven, 󰀂󰀀󰀁󰀁), 󰀄󰀀-󰀁.

M ODISTIK

UND

M ETAPHYSIK

󰀆󰀁

iustitia ‒ in einen direkten Bezug setzt. Eckharts Grundgedanke ist dabei, daß alle konkreten Verwendungsweisen von ,gesund‘, ‚gerecht‘ oder auch ‚weiß‘ sich gar nicht gegenseitig legitimieren können, sondern ihren Anfangsgrund in einer Instanz haben müssen, welche jeweils alle konkreten Verwendungsweisen gleichermaßen legitimiert. Jede andere Begründungsform erweist sich für Eckhart buchstäblich als haltlos. Nicht nur wäre das zu Begründende nicht begründet, sondern jeder Grund würde seinen begründenden Charakter verlieren: ‚Wenn es neben und außerhalb von der Weiße (albedo) noch etwas Weißes (album) gäbe, dann wäre die Weiße nicht die Weiße, da doch alles durch die Weiße weiß ist.‘󰀁󰀅 Demnach bezieht sich ausnahmslos jede konkrete Verwendungsweise von albus auf einen einzigen, abstrakt gefaßten Gehalt, in diesem Fall auf denjenigen der ‚Weiße‘. Nach Eckhart werden also nicht von einer Fokalbedeutung aus (in unserem Beispiel: vom Farbton Weiß aus) bestimmte Ähnlichkeitsmerkmale analogisch auf weitere Instanzen übertragen, so etwa, wenn wir von jemandem sagen, er habe eine ‚weiße Haut‘ oder er habe eine ‚weiße Weste‘. Vielmehr erhält nach Eckhart jede konkrete Instantiierung von Weiß ihre Wirklichkeit aufgrund ihres Bezugs auf den formalen Gehalt ‚weiß an sich‘ (albedo). Anders gesagt: Entscheidend ist für Eckhart nicht, ob der Farbton ‚weiß‘ oder etwa die Eigenschaft ‚gesund‘ an einem bestimmten Träger bzw. an einem bestimmten Substrat auftritt und damit Wirklichkeit erlangt. Im Gegenteil: Die Wirklichkeit dieses Farbtons bzw. der Eigenschaft ‚gesund‘ verdankt sich ihrem jeweiligen Bezug auf den formalen Gehalt ‚weiß an sich‘ (albedo) bzw. ‚gesund an sich‘ (sanitas). Dieser und nur dieser Bezug ist für Eckhart der wirklichkeitsstiftende. Bekanntlich hat Eckharts Konzept der Analogie massive Auswirkungen auf seinen Seinsbegriff. Was unter ‚Sein‘ eigentlich zu verstehen ist, kann nicht im Ausgang von einer konkreten Verwendungsweise von ‚seiend‘ geklärt werden, da hier für Eckhart eine Übertragung von Ähnlichkeitsmerkmalen unmöglich ist. Wir können also nicht im Ausgang vom geschöpflichen Sein per analogiam vom göttlichen Sein reden. Vielmehr erhält jede Rede vom geschöpflichen Sein ihre Berechtigung nur aufgrund 󰀁󰀅. Sermo IV/󰀁, n. 󰀂󰀃 (LW IV 󰀂󰀄,󰀁󰀁): si aliquid esset album praeter aut extra albedinem, albedo non esset albedo, siquidem albedine omnia sunt alba.

󰀆󰀂

S TEPHAN G ROTZ

des Bezugs jeden Seins auf das absolute Sein Gottes; nicht nur dies: auch die Wirklichkeit eines jeden geschöpflichen Seins besteht ausschließlich in seinem Bezug auf das göttliche Sein. Daraus ergeben sich wiederum weitreichende Konsequenzen, so Eckharts These von der ungeschmälerten Nichtigkeit aller Geschöpfe; einer Nichtigkeit also, die nicht per analogiam von irgendwo anders her, etwa im Hinblick auf das göttliche Sein, zu gewinnen und zu verstehen ist.󰀁󰀆 Auch wenn dies alles nicht von ungefähr sehr abstrakt anmutet, so wird doch zumindest so viel ersichtlich, daß es Eckhart bei seinem Analogiekonzept in erster Linie immer auf eine bestimmte Bezugsform ankommt. Hat man sich denn auch einmal diese Bezugsform anhand eines konkreten Falles aus Eckharts Schriften vor Augen geführt, also etwa anhand von albus und albedo, so lassen sich unschwer auch die anderen analogen Verhältnisse verstehen, sei es nun dasjenige von iustus und iustitia oder dasjenige von ens und esse.󰀁󰀇 Eckharts Betonung der strukturgleich gebauten Bezugsformen von albus ‒ albedo, sanus ‒ sanitas, iustus ‒ iustitia, ens ‒ esse dürfte auch den Grund dafür liefern, daß die inhaltliche Bestimmung des jeweiligen vollen Relates, insbesondere von esse und iustitia sehr formal ausfallen. Insofern scheint mir, daß für Eckhart die Frage, worin denn nun konkret Gerechtigkeit bestehe bzw. was für konkrete Merkmale das Sein aufzuweisen habe, im Ansatz verfehlt ist. Das Sein ‒ und das meint: das göttliche Sein ‒ faßt Eckhart viel lieber in relationalen Bestimmungen wie dem gleichzeitigen In-Sein und Übersein (inesse et superesse) oder auch als ein 󰀁󰀆. Eckharts inkriminierte These von der völligen Nichtigkeit alles Erschaffenen, welche er bekanntlich in Predigt 󰀄 vorgetragen hat, besitzt eine ganz zentrale Funktion in seinem Denken. Dies läßt sich nicht zuletzt daraus ersehen, daß Eckhart an seiner These omnes creaturae sunt unum purum nihil während des gesamten Prozesses nicht nur unbeirrt festhält, sondern daß er die unbedachte Leugnung dieses Satzes für blanke Blasphemie erachtet: Dicendum quod hoc [sc. quod omnes creaturae sunt unum purum nihil] pura, devota et utilis veritas est, valens ad informationem morum, ad contemptum mundi, ad amorem dei et ipsum solum amandum. Huius autem oppositum sentire error est imperitiae et sine dubio periculosa haeresis, si temere defendatur (Proc. Col. I, n. 󰀁󰀅󰀀 [LW V 󰀃󰀀󰀄,󰀅-󰀈]). Vgl. auch Proc. Col. II, n. 󰀂󰀈 (LW V 󰀃󰀂󰀄,󰀁󰀆): Hoc negare est ignorare et deum blasphemare; sowie ibid. n. 󰀁󰀀󰀇 (LW V 󰀃󰀄󰀄,󰀅-󰀆): Dicendum quod hoc negare est deum blasphemare et ipsum abnegare; ibid. n. 󰀁󰀅󰀃 (LW V 󰀃󰀅󰀄,󰀉): Dicere mundum [...] esse quid modicum, manifesta blasphemia est. 󰀁󰀇. Vgl. dazu neuerdings Rolf Schönberger, ‚Si Deus non est, nihil est. Die neuralgische Proportion von Inhalt und Form eines Gottesbeweises im Ausgang von Meister Eckhart‘, in Thomas Buchheim et al. (Hgg.), Gottesbeweise als Herausforderung für die moderne Vernunft, Collegium Metaphysicum 󰀄 (Tübingen, 󰀂󰀀󰀁󰀂), 󰀄󰀇-󰀈󰀃.

M ODISTIK

UND

M ETAPHYSIK

󰀆󰀃

Überwallen und Insichbleiben (bullitio et mansio in se ipso).󰀁󰀈 Ebenso manifestiert sich die Gerechtigkeit des homo divinus weniger in konkreten Taten als primär in einer bestimmten Haltung und damit in einer bestimmten Bezugsform den Geschöpfen und Gott gegenüber. Wie kommt nun aber die modistische Grammatik hier ins Spiel? Mit Eckharts Analogiekonzept scheinen wir denkbar weit von irgendwelchen sprachtheoretischen Reflexionen entfernt zu sein. Sieht man allerdings etwas genauer zu, dann fallen ausgerechnet an den Stellen, an denen Eckhart sein Analogiekonzept zu verdeutlichen sucht, Termini ins Auge, welche zum Grundinventar der Modisten gehören. Dies sind vor allem die Termini consignificare bzw. significare per modum. Gemeint ist damit eine Form von Bedeutsamkeit, die sich in erster Linie nicht aus dem lexikalischen Gehalt eines Wortes ergibt, sondern aus seiner grammatischen Form ‒ und das heißt zugleich: aus seiner grammatischen Beziehbarkeit auf andere Wortformen, kurzum: aus seiner syntaktischen Funktion. Im Beispiel gesprochen: Es kommt Eckhart nicht darauf an, daß das Wort albus einen bestimmten Farbton zur Sprache bringt, sanus eine bestimmte Verfassung eines Organismus meint, oder ens einen bestimmten ontologischen Sachverhalt ausdrückt. Vielmehr kommt es Eckhart darauf an, daß alle diese Wörter ‒ albus, sanus, ens oder auch iustus ‒ ihren Gehalt ausnahmslos in der (verbal)adjektivischen Form verbalisieren. Der jeweilige semantische Gehalt erlangt hier also in einer bestimmten grammatischen Form sprachliche Wirklichkeit: „Auch wenn die Weiße (albedo) an einem Träger auftritt und damit diesem Träger akzidentell ist bzw. ihm anhaftet, so kommt mit ‚Weiße‘ dennoch nicht zum Ausdruck, dass sie inhärieren würde. Wie die Weiße bedeutet ja auch das Wort ‚weiß‘ ‚ausschließlich eine Qualität‘ und bezeichnet seinen Träger nur mit bzw. bezeichnet ihn nur indirekt (consignificat sive connotat). Deswegen kommt mit ‚weiß‘ eine Qualität zum Ausdruck, und zwar in der Form, dass sie an etwas auftritt bzw. etwas inhäriert (per modum accidentis et inhaerentis).“󰀁󰀉 󰀁󰀈. Werner Beierwaltes’ magistrale Studien sind diesem Verhältnis von inesse und superesse bei Eckhart, insbesondere im Zusammenhang mit dessen Exodus-Kommentar, wiederholt nachgegangen: Platonismus und Idealismus (Frankfurt a.M., 󰀁󰀉󰀇󰀂; 󰀂. erw. Aufl. 󰀂󰀀󰀀󰀄), 󰀃󰀇-󰀆󰀇; id., Identität und Differenz (Frankfurt a.M., 󰀁󰀉󰀈󰀀), 󰀉󰀇-󰀁󰀀󰀅; id., Procliana (Frankfurt a.M., 󰀂󰀀󰀀󰀇), 󰀁󰀂󰀉-󰀆󰀄. 󰀁󰀉. In Ex. n. 󰀆󰀃 (LW II 󰀆󰀇,󰀁󰀁-󰀆󰀈,󰀁): Albedo enim quamvis sit in subiecto et accidens sive inhaerens subiecto, non tamen significat albedinem per modum inhaerentis; sicut hoc nomen ‚albus solum quidem

󰀆󰀄

S TEPHAN G ROTZ

An dieser Stelle sieht man ganz deutlich, daß sich Eckhart auf die grammatische Bedeutsamkeit ‒ eben auf den modus significandi ‒ von albedo und albus konzentriert, also darauf, wie sich der semantische Gehalt dabei jeweils realisiert. Und so zeigt sich für Eckhart, daß das Adjektiv albus seine Bedeutsamkeit zwar per modum inhaerentis zum Ausdruck bringt, also in der Verbindung mit einem Substantiv (z. B. equus albus), daß es aber seine Bedeutsamkeit gerade nicht dieser Inhärenz verdankt. In erster Linie verweist das Adjektiv albus auf die entsprechende substantivische Form albedo (albedinem significat); erst in zweiter Linie verweist es auf seinen Träger (consiginificat). Im Adjektiv albus tritt also der semantische Gehalt nicht in voller Form auf, sondern, wenn überhaupt, in gebrochener Form, an etwas Anderem, an irgendeinem Substrat. Daß aber der semantische Gehalt albus überhaupt an etwas auftreten kann und damit wie die Eigenschaft eines beliebigen Trägers aussehen kann, liegt für Eckhart an einem ganz anderen Bezug: an dem Bezug von albus auf albedo. Anders als bei den Modisten steht bei Eckhart daher nicht das syntaktische Zusammenspiel und damit auch nicht die Kongruenz eines Adjektivs mit einem beliebigen Substantiv im Zentrum, sondern die vollkommene Ableitbarkeit einer adjektivischen aus ihrer entsprechenden substantivischen Form. Hier konstruiert sich Eckhart gewissermaßen seine eigene Syntax. Über diese Syntax kann Eckhart zeigen, daß ‚Gerechtsein‘ oder auch überhaupt ‚zu sein’ ihr Fundament nicht da haben, woran sie auftreten bzw. wo sie vorkommen, und daß sie daher von vornherein keine Eigenschaften sein können. Auch wenn es zunächst so aussieht, als ob sie eine Einheit bilden mit ihrem jeweiligen Träger: als homo iustus, als ens hoc et hoc. Dabei ist es für Eckhart ja gerade nicht entscheidend, ob die Gerechtigkeit in diesem oder jenem Menschen auftritt, ob das Sein sich als dieses oder jenes Seiende verwirklicht. Mit Bedacht spricht denn auch für Eckhart das biblische Buch der Weisheit nur von den ‚Gerechten‘ (iusti) ‒ „ohne irgendeine Hinzufügung oder ein Substrat, also etwa ‚Mensch‘ oder dergleichen, vielmehr heißt es ganz formal: die Gerechten. Denn dies geht über den Menschen, ja qualitatem significat‘ sicut albedo, et subiectum consignificat sive connotat, et propter hoc significat ipsam per modum accidentis et inhaerentis.

M ODISTIK

UND

M ETAPHYSIK

󰀆󰀅

sogar über alle Schöpfung hinaus, es ist etwas Göttliches: ‚Gott allein‘ der Form nach angeglichen zu werden und in ihn, ihm entsprechend und von ihm verwandelt zu werden.“󰀂󰀀 Eckharts Analogiekonzept geht somit aufs Ganze. Entweder realisiert sich der Gehalt z. B. von „gerecht“ in voller Form ‒ oder erst gar nicht richtig: „Ein bißchen Gerechtigkeit ist nämlich keine Gerechtigkeit“.󰀂󰀁 Etwaige Abstufungen im Gerechtsein oder auch im Sein, aufgrund eines engeren bzw. weiteren Bezugs auf die volle Form der Gerechtigkeit oder des Seins, sind denn auch zu vernachlässigende Größen, da sie endlichen Vergleichsmaßstäben niemals entkommen. Nicht, ob dieser oder jener Mensch gerechter ist als ein anderer, ob denn nun Martha oder Maria den besseren Teil erwählt hat, ist daher von vordringlicher Bedeutung; vielmehr muß erst die Frage beantwortet sein, worin überhaupt Gerechtigkeit, überhaupt der rechte Bezug auf Gott und die Welt besteht. Ebensowenig wie Gerechtigkeit ist auch Wahrheit für Eckhart eine Eigenschaft, die sich einfach mit dem Vorkommen bestimmter Substrate, z. B. bestimmter Propositionen oder Sachverhalte, einstellt. Ein Wahrheitsanspruch kann bei all diesen Substraten daher auch nicht wirklich mittels von Folgerungen fundiert werden, da dieser Anspruch immer von den Substraten selbst, von bestimmten Sätzen und Sachverhalten, abhängig bliebe. Wahrheit ist aber für Eckhart nicht abhängig von irgendwelchen Bedingungen. Vielmehr ist Wahrheit die Bedingung von allem, was wahr sein will. Entscheidend ist daher für Eckhart, daß die Wahrheit nur ungeteilt in jedem Wahren anwesend sein kann. Wahrheit als Eigenschaft speist sich nur aus dem Bezug auf die absolute Wahrheit: „,Nichts ist wahr, was nicht die Wahrheit ganz einschließt.‘ Dazu ist zu bemerken: Dies in Abrede zu stellen heißt, es nicht zu kapieren. Denn ein bißchen Wahrheit ist keine Wahrheit. Zudem ist Gott die Wahrheit (Joh. 󰀁󰀄), der in jedem Ding als Ganzer ist oder nicht ist bzw. in keinem Ding ist.“󰀂󰀂 󰀂󰀀. In Sap. n. 󰀆󰀄 (LW II 󰀃󰀉󰀂,󰀅-󰀈): Notandum autem quod [sc. sapiens] ait iusti sine addidamento quolibet aut subiecto, homine scilicet aut huiusmodi, sed formaliter iusti. Est enim super hominem, sed etiam super omnem creaturam, divinum ‘soli deo’ conformari et transformari in ipsum, secundum ipsum et ab ipso. ‒ Dieser Gedanke auch in Pr. 󰀃󰀉 (DW II 󰀂󰀅󰀈,󰀁-󰀃); sowie im BgT (DW V 󰀁󰀂,󰀈-󰀁󰀅). 󰀂󰀁. In Ioh. n. 󰀂󰀂 (LW III 󰀁󰀈,󰀁󰀆): media enim iusitia non est iustitia. 󰀂󰀂. Resp. II, nn. 󰀁󰀉-󰀂󰀀 (LW V 󰀃󰀂󰀂,󰀁󰀂-󰀆):  »Nihil est verum quod non includat omnem veritatem.« Dicendum quod hoc negare est ignorare. Media enim veritas est non veritas. Praeterea, deus est veritas, Joh. 󰀁󰀄, qui in quolibet totus est aut non est aut non est in quolibet. ‒ Für Eckharts Reflexionen auf die Wahrheitsbedingungen vgl. Stephan Grotz, ‚Auslegung oder Zerlegung? Interpretatorische Gewalt bei Meister Eckhart‘, in Meister-Eckhart-Jahrbuch 󰀅 (Stuttgart, 󰀂󰀀󰀁󰀁), 󰀉󰀉-󰀁󰀁󰀄, 󰀁󰀀󰀃-󰀁󰀀.

󰀆󰀆

S TEPHAN G ROTZ

Eben dies kann Eckhart anhand der Wortformen von albus und albedo und deren Bezug zueinander veranschaulichen. Denn erst dann realisiert sich der volle Gehalt eines Adjektivs, wenn seine Ableitbarkeit aus einer entsprechenden substantivischen Form in den Blick kommt und seine Beziehbarkeit auf bestimmte Träger in den Hintergrund tritt. Innerhalb des Kreatürlichen hat daher nur diejenige Instanz eine Chance auf die Verwirklichung des vollen Gehaltes der Gerechtigkeit und des Seins, welche die Bedingungen der Endlichkeit ‒ das Gebundensein an ein Substrat ‒ hinter sich zu lassen vermag. Insofern ist einzig der Intellekt capax dei, dessen Sein an keinem Substrat zu finden ist, sondern einzig allein im Bezug auf ein Anderes (totum esse ad aliud) besteht: „Denn Gott als Gott ist und schmeckt und findet sich nur in der geistigen Natur, wo das Bild Gottes empfänglich ist für Gott, welches zur Gänze darin besteht, auf Anderes ausgerichtet zu sein.“󰀂󰀃 Die jeweils substantivische Form in einem analogen Verhältnis, also etwa diejenige von iustitia, li esse oder veritas, signalisiert demnach, daß der mit diesen Wörtern zur Sprache kommende Gehalt nirgendwo inhäriert, noch von irgend etwas in dieser Welt prädiziert werden kann. Wahre Substantialität, welche die beiden Aristotelischen Merkmale der Nicht-Inhärenz und der Nicht-Prädizierbarkeit erfüllt, kann sich nicht in einer adjektivischen Form, und d. h. in der Bindung an ein bestimmtes Substrat, erfüllen. Eckhart wird daher auch Gott nicht los ‒ nicht, weil er noch an die Grammatik glauben würde, sondern weil er allererst ihre Möglichkeiten reflektiert ausnützt. * * * Wollte man meine voranstehenden Überlegungen bündeln, dann könnte man dies in drei Sätzen tun:

󰀂󰀃. Sermo XIV/󰀂 n. 󰀁󰀅󰀂 (LW IV 󰀁󰀄󰀄,󰀆-󰀇): Deus enim ut deus non est nec sapit nec invenitur nisi in intellectuali natura, ubi imago dei est capax dei, cuius totum est esse ad aliud. ‒ Eckharts hier nur en passant berührte ‚Intellekttheorie‘ hängt aufs engste mit seinem Verständnis der Relation zusammen, insofern der Intellekt für Eckhart ja nicht etwas an sich und für sich Bestehendes ist, sondern wesentlich Relation, Bezug auf Anderes ist. Welche Konsequenzen sich daraus ergeben, habe ich ein Stück weit zu erhellen versucht in: Stephan Grotz, Negationen des Absoluten. Meister Eckhart ‒ Cusanus ‒ Hegel, Paradeigmata 󰀃󰀀 (Hamburg, 󰀂󰀀󰀀󰀉), 󰀉󰀄-󰀁󰀀󰀅.

M ODISTIK

󰀁.

󰀂.

󰀃.

UND

M ETAPHYSIK

󰀆󰀇

Mit der modistischen Universalgrammatik verbindet Eckhart die Aufmerksamkeit auf sprachliche Formen und die damit einhergehenden spezifischen semantischen Potentiale. Bei den Modisten läuft diese Aufmerksamkeit auf die Herausarbeitung einer Logizität hinaus, welche der menschlichen Sprache und nur ihr immanent ist. Bei Eckhart sieht man deutlich, wie er mit Hilfe von grammatischen Formen ein eigenständiges formales Raster für seine Metaphysik entwickelt.

Meister Eckhart and Thomas of Erfurt: the Gospel of John and the Ontology of Nouns and Adjectives CLAIRE TAYLOR JONES, UNIVERSITY OF NOTRE DAME, INDIANA Abstract In both Latin and German, Eckhart uses the relationship between nouns and their derivative adjectives (most commonly ‘justice’ and ‘the just’) as a metaphor for the relationship between God and the soul. The ontological stakes of this analogy are best understood if we read Eckhart’s grammatical meditations as grounded in Thomas of Erfurt’s discussion of adjectives in his Grammatica speculativa. On the one hand, Thomas’ differentiation between adjectives that describe inherent qualities and those that describe apposite substances provides a model for understanding Eckhart’s created and uncreated parts of the soul. On the other, Thomas’ claim that adjectives signify according to ‘being’ (esse) and thus have something of verbs about them aligns with Eckhart’s emphasis on the activity and effectivity of justice in and through the just.

I

would like to begin my contribution to this volume with the caveat that I believe any attempt to demonstrate a direct influence of Thomas of Erfurt on the thought of Meister Eckhart to be somewhat overly ambitious. If for no other reason than the limited manuscript record and the meager information we have about Thomas’ biography, anything I argue here must, like Thomas’ grammar, remain speculative. Nevertheless, I find it quite plausible that Eckhart and Thomas could have known each other in Erfurt since they were both Paris-educated scholars in charge of the religious communities of this city during the same decades. This being the case, their relationship would have been one of peers or

󰀇󰀀

C LAIRE T AYLOR J ONES

colleagues, rather than mentor and mentee. Furthermore, I find it very likely that Eckhart would have come into contact with speculative or even Modistic grammar during his early education. Thomas’ role would therefore have been to refresh this form of thought for Eckhart and perhaps to add nuance rather than to introduce him to it. That is, Thomas, in his dual role as a highly educated philosopher of language as well as an administrator of education, could have revived in his peer an interest in or appreciation for areas of study traditionally relegated to children. Just such a renewed interest in the subjects or the setting of youth education may underlie Eckhart’s reference to the ‘kleine meister’ who teach the ten Aristotelian categories ‘in der schule’ in German sermon 󰀉, Quasi stella matutina – the sermon that famously also includes the bîwort neologism.󰀁 Whether or not it is possible to demonstrate a direct influence, some of Eckhart’s stranger interpretive moves can certainly be clarified through reference to Modism, and reading Eckhart against Thomas is extremely productive. Indeed, I argue that a Modistic model of the relationships between word classes is absolutely fundamental to Eckhart’s conception of logos theology. In the following pages, I will show how Eckhart’s exegesis of John 󰀁:󰀁 (‘In the beginning was the Word’) relies on a particular grammatical relationship between abstract nouns and substantive adjectives (the most important example for Eckhart’s German works being die Gerechtigkeit and der Gerechte) that Thomas of Erfurt expounds in his discussion of adjectival nouns in the Grammatica speculativa. First, Thomas distinguishes between adjectives that signify inherence and adjectives that signify apposition. Second, Thomas claims that adjectives signify according to being (secundum esse) and thus indicate activity. Both of these understandings of adjectives help to elucidate Eckhart’s repeated invocations of ‘justice’ and ‘the just [man]’. Eckhart’s Latin Commentary on John highlights the signal importance of ‘justice’ and ‘the just [man]’ to Eckhart’s thought. As is to be expected, Eckhart treats the definition of the Word at length. Like Augustine, on whom he draws heavily in this work, Eckhart connects the opening of the Gospel of John with the beginning of Genesis and thereby the Word with the act of creation. He then proceeds to explain 󰀁. Meister Eckhart, Werke, vol. I, ed. Niklaus Largier, Deutscher Klassiker Verlag im Taschenbuch 󰀂󰀄 (Frankfurt a.M., 󰀂󰀀󰀀󰀈), 󰀁󰀀󰀆-󰀇.

THE

G OSPEL

OF

J OHN

AND THE

O NTOLOGY

OF

N OUNS

AND

A DJECTIVES

󰀇󰀁

the relationship of God both to the created world and to the Word through the metaphor of the artifex: the artist and his work. The artist’s intention and design do not leave his mind as he works on his project, but continue to exist within it even once the work has been realised. In the same way, the Word continues to exist within God even after its expression or birth. This metaphor foregrounds both the continued connection of the artist and the art through the double existence of the design, as well as the role of activity through the emphasis on production. Continuing the commentary, Eckhart enumerates a series of fifteen points about the relationship of the Word to God, most of which are fairly standard and drawn primarily from Augustine. Eckhart then, however, declares that this description of the relationship between God and the Word is equally applicable to the relationship between ‘justice’ (iustitia) and ‘the just [man]’ (iustus). Beyond simply noting this, Eckhart actually repeats each of the fifteen points almost verbatim with ‘the just’ and ‘justice’ replacing the Word and God.󰀂 The implications of this analogy are clear. Just as Christ serves as the expression of God’s work in the world but exists united with him in eternity, so does the just perform the work of justice in the world but remains united with it – and with God, insofar as justice is an aspect of the Godhead. This relationship of the just to justice also appears in German Sermon 󰀉 alongside the injunction that one should be a with-word (bîwort) with the Word. Eckhart introduces the term bîwort in the context of elementary education in grammar but lends it a tropological significance that his reference to John 󰀁:󰀁 does little to clarify. As a morning star in the fog. I am thinking of the little word ‘quasi’, which means ‘as’, and which schoolchildren call a ‘bîwort’. This is what I intend in all of my sermons. The most proper thing that one can say about God is Word and Truth. God called himself a Word. Saint John said: ‘In the beginning was the word’ and intended us to be a ‘bîwort’ by the Word.󰀃 󰀂. The passage in question may be found in Meister Eckhart, Werke, vol. II, ed. Niklaus Largier, Deutscher Klassiker Verlag im Taschenbuch 󰀂󰀅 (Frankfurt a.M., 󰀂󰀀󰀀󰀈), 󰀅󰀀󰀀-󰀈. 󰀃. Meister Eckhart, Werke, I, ed. N. Largier (󰀂󰀀󰀀󰀈), 󰀁󰀁󰀂: ‘Als ein morgensterne miten in dem nebel. Ich meine daz wörtelîn “quasi”, daz heizet “als”, daz heizent diu kint in der schuole ein bîwort. Diz ist, daz ich in allen mînen predigen meine. Daz aller eigenlîcheste, daz man von gote gesprechen mac, daz ist wort und wârheit. Got nante sich selber ein wort. Sant Johannes sprach: “in dem anvange was daz wort”, und meinet, daz man bî dem worte sî ein bîwort.’

󰀇󰀂

C LAIRE T AYLOR J ONES

In order to understand this passage, we must determine what sort of Modistic grammatical category might contain the word quasi and how such a word could represent what Eckhart is talking about in all of his sermons. As Christian Lehmann pointed out, there is no place for a word like ‘quasi’ in a notional grammatical system that borrows its structure from ontological categories instead of developing it through analysis of syntactic function.󰀄 That is to say, a word like ‘quasi’ occupies a place in a structural grammar system by virtue of its function, but its lack of ontological content orphans it within the Modistic conceptual field. For this reason, in order to discover what the relationship of bîwort to wort is, instead of speculating about grammar, we must turn to other places where Eckhart interprets the Gospel of John in search of other analogies for the relationship we should have to Christ. If we consider this sermon in the context of the Commentary on John, it becomes clear that Eckhart understands a bîwort to be a substantive adjective insofar as it bears a relation to the abstract noun from which it derives – der Gerechte, the just, is the bîwort of die Gerechtigkeit, justice. The term describes the relationship of a substance that possesses a quality to the quality in the abstract. This conclusion could explain the odd status of quasi, since for a speculative, ontological grammar a phrase such as ‘like a morning star’ would be interpreted to signify a property that inhered in some other substance, i.e. an adjective – even if it takes more than one word to express it. This definition of adjective as a word that signifies something inhering in another substance needs to be further unpacked. Comparing the relationship between nouns and adjectives as described by Thomas of Erfurt to Eckhart’s descriptions of the relationship between ‘justice’ and ‘the just’ yields provocative results. According to Thomas, the class of common nouns contains two subsets: nouns that stand alone and adjacent nouns (i.e. nouns and adjectives).󰀅 Words like ‘justice’, ‘goodness’, and ‘wisdom’ belong to the class of stand-alone or substantive nouns, along 󰀄. So his oral contribution at the workshop. See also Christian Lehmann, ‘Thomas von Erfurt (󰀁󰀃./󰀁󰀄. Jahrhundert)’, in Dietmar von der Pfordten (ed.), Große Denker Erfurts und der Erfurter Universität (Göttingen, 󰀂󰀀󰀀󰀂), 󰀄󰀅-󰀇󰀃. 󰀅. Thomas of Erfurt, Grammatica Speculativa, trans. G.L. Bursill-Hall, The Classics of Linguistics (London, 󰀁󰀉󰀇󰀂), 󰀁󰀅󰀈: ‘Modus per se stantis. Circa primum notandum, quod modus significandi per modum communis habet duos modos sub se, qui sunt minus generales eo, scilicet modum per se stantis, et modum adiacentis.’

THE

G OSPEL

OF

J OHN

AND THE

O NTOLOGY

OF

N OUNS

AND

A DJECTIVES

󰀇󰀃

with words like ‘whiteness’ or ‘stone’.󰀆 These nouns signify according to the mode of independence or determinateness with regard to essence (essentia). This mode of independence corresponds to the substances signified by these words, which have an existence without relying on another substance for support. The second category of adjacent nouns is easier to understand in relation to this first category. Whereas substantive nouns exist in a mode of independence, adjacent or adjectival nouns exhibit the mode of inherence in something else with regard to being (esse).󰀇 Words belonging to this category include ‘white’ (albus) and ‘stony’ (lapideus), as opposed to ‘whiteness’ (albedo) and ‘stone’ (lapis) – or, to use Eckhart’s example, ‘just’ (gerecht) as opposed to ‘justice’ (die Gerechtigkeit). Adjectives are thus in fact a form of noun signifying in a different mode. Determinate nouns signify something that has substance and signify according to essence. Adjectival nouns signify something that relies on something else for substance and manifests in a mode of dependent inherence according to being (esse). The things described by nouns and adjectives are not permanently fixed in that ontological mode, but may manifest as either a noun or an adjective depending on their status as a substance. That is to say, many things may exist in both the mode of dependence and the mode of independence and will be signified by a noun or by an adjective according to the context. All of the examples in the foregoing paragraph belong to this paradigm. Albedo and albus both express a relationship to the universal ‘white’, but albedo signifies it in the mode of independent essence, while albus signifies it in the mode of active inherence. Thomas emphasises the adjective’s lack of substance by relating it to the general mode of the verb (esse).󰀈 The determinate noun signifies according to essence (essentia), while the adjectival noun signifies according to being (esse). Not having substance of its own, it must take on a verbal character in order to inhere in something else. It might seem that 󰀆. Ibid.: ‘Nomen ergo substantivum significat per modum determinati secundum essentiam, ut: albedo, lapis, etc.’ 󰀇. Ibid.: ‘Modus adiacentis. Modus significandi per modum adiacentis sumitur a proprietate rei, quae est proprietas alteri adhaerentis secundum esse. [...] Nomen ergo adiectivum significat per modum inhaerentis alteri secundum esse, ut: albus, lapideus, etc.’ 󰀈. Ibid.: ‘Sicut enim modus generalissimus verbi sumitur a proprietate ipsius esse absolute, ut postea patebit, sic modus adiacentis in nomine sumitur a proprietate ipsius esse inhaerentis alteri secundum esse; et hic modus constituit nomen adiectivum.’

󰀇󰀄

C LAIRE T AYLOR J ONES

certain kinds of things could not possibly have substance, for example whiteness, and would therefore belong perpetually to this adjectival category. For Thomas, whiteness (albedo) does in fact have essence, that is to say, independent ontological status, although white (albus) does not. Since word classes correspond to classes of being in speculative grammar, the difference in ontological status between albedo and albus implies that the thing whiteness can manifest either as a substance (albedo) or in the verbal mode of inherence (albus). Nothing about the thing whiteness requires it to be one or the other. For this reason, adjectives that directly describe substance prove to be a problem for Thomas and require him to invent a second class of adjectives that signify in a different mode. He defines adjectives as a class of words that only signify inherence and not substance. There are, however, undeniably words that operate syntactically just like the words in this category, but clearly refer to something that possesses substance. Animatus, Thomas concedes, quite clearly signifies animal, which undeniably has substance. The problem with describing something substantive as animatus is that the fact of being a certain kind of substance cannot inhere in another different substance. Rationale similarly signifies human, which also entails substance and therefore cannot share the verbal character of inherence with the adjectives that lack substance.󰀉 Thomas concludes that the syntactic connection of words like rationale and animatum with other determinate nouns is inappropriate, because these things cannot inhere. And since it is said that they join mutually with substantives by saying, e.g. rational animal (animal rationale), animate body (corpus animatum), it must be pointed out that this is an appositive construction but is incongruent in and of itself, and yet is admissible by apposition, that is, on account of a specifiable specification.󰀁󰀀 󰀉. Ibid.: ‘Et si instetur: nomina differentiarum in genere substantiae, sicut corporeum, et animatum, sensibile, rationale, adiectiva quidem sunt, congrue enim substantivis adiunguntur, dicendo corpus animatum, animal rationale; et tamen non significant per modum inhaerentis alteri secundum esse, quia significant substantiam, quae secundum esse alteri non inhaeret. Dicendum, quod huiusmodi nomina sunt substantiva, quia significant substantiam. Et probatur: nam idem significat rationale quod homo, et animatum quod animal.’ 󰀁󰀀. Ibid.: ‘Et cum dicitur, quod congrue cum substantivis coniunguntur, dicendo animal rationale, corpus animatum; dicendum, quod ibi est constructio appositoria, et est incongrua de se; tamen per appositionem admissiva, hoc est, propter specificationem specificandam.’ (English translation, ibid. 󰀁󰀅󰀉).

THE

G OSPEL

OF

J OHN

AND THE

O NTOLOGY

OF

N OUNS

AND

A DJECTIVES

󰀇󰀅

In order to resolve this conundrum, Thomas allows that such words may be apposite – simply placed next to each other in the sentence and co-present in the object described. Instead of words being joined to another word (adiunguntur), such pairs of words are joined with each other (coniunguntur) in apposition. To summarise, the difference between a determinate noun and its corresponding adjective noun is that the determinate noun signifies according to substance – that is, it refers to something as a substance in the mode of its primary essence. The adjectival noun, on the other hand, signifies secondarily according to inherence and relies on something else’s substance.󰀁󰀁 Finally, certain words that look and behave like adjectives do not actually signify in the mode of inherence, but rather signify substance. For this reason, they cannot be adjectival in the same way, and syntactic locutions that pair these words with other substance words are appositions or juxtapositions, instead of true adjectives. Turning to Eckhart now, the question of the relationship between the determinate noun and the adjectival noun is important because Eckhart consistently compares the relationship between ‘justice’ (Gerechtigkeit) and ‘the just’ (der Gerechte), for example, to that between God and the Word and between God and the soul. The question is patently an issue of ontological grammar and not integral to justice itself, because discussions of ‘justice’ and ‘the just’ belong to a constellation of repeated metaphors, clearly meant to be mutually explanatory. Eckhart almost never discusses the relationship between ‘justice’ and ‘the just’ independently but always includes a reference to at least one other explanatory metaphor, such as the artist (artifex) discussed above. In the Commentary on John, Eckhart begins with an analysis of the biblical passage (In principio erat verbum et verbum erat apud deum) and adduces a lengthy discussion of the relationship between iustitia and iustus. However, Eckhart reverses this move elsewhere, explaining iustus and iustitia by means of John. For example, in German Sermon 󰀆 on Wisdom 󰀅:󰀁󰀆 (Iusti vivent in aeternum), he sets out to interpret a Biblical verse that includes the term iustus. After explaining justice in terms of reminiscent 󰀁󰀁. See also ibid., 󰀁󰀇󰀆: ‘Unde mons primitivae speciei est, quia significat rem sub essentia primaria, quae est essentia absoluta; sed montanus derivativae speciei est, quia significat rem sub esse secondario sive sub essentia secundaria, quae est essentia comparata. Nam montanus non significat montem absolute, sed in comparatione ad habitatorem montis.’

󰀇󰀆

C LAIRE T AYLOR J ONES

of Gelassenheit,󰀁󰀂 he adduces the phrase ‘daz wort was bî gote’ in order to elucidate what it means for just men to live in aeternum.󰀁󰀃 German Sermon 󰀃󰀉 on the same verse similarly uses John to explain the nature of the just man’s heavenly reward: Now, he says: his reward is with (bî) the Lord. A little about this. When he says ‘with’ (bî), it means that the reward of the just is there where God Himself is; for the blessedness of the just and the blessedness of God are one blessedness, for the just man is blessed there, where God is blessed. Saint John says: the Word was with (bî) God. He says with (bî), and therefore the just man is like God.󰀁󰀄 Both sermons use the language of birth and the father/son relationship, but only Sermon 󰀃󰀉 uses that metaphor in direct relation to iustus, while in Sermon 󰀆 the connection remains implicit.󰀁󰀅 Furthermore, the first section of Eckhart’s Liber Benedictus does not refer to the Gospel of John, but does employ the metaphorical language of birth and the father/son relationship to describe the relationship between Güte and der Gute.󰀁󰀆 Already in this very limited selection of examples, we can clearly identify a constellation of metaphors, which Eckhart uses in various combinations in both his Latin and his German oeuvre. Each is drawn from a different realm of thought or a different approach to God. The language of birthing, the metaphor of the artist and his work, and the relationship between justice and the just derive from a variety of source texts or influences, from Patristic writings, to the Victorines, to Frauenmystik. Nevertheless, each represents the same argument, which Eckhart is trying to explain in as many different ways as possible. Eckhart does not need 󰀁󰀂. Meister Eckhart, Werke, I, ed. N. Largier (󰀂󰀀󰀀󰀈), 󰀇󰀈: ‘Die gerehten enhânt zemâle keinen willen; waz got wil, daz ist in allez glîch.’ 󰀁󰀃. Ibid. 󰀈󰀀-󰀂: ‘Sie lebent êwicliche bî gote, rehte glîch bî gote, noch unden noch oben. Sie würkent alliu iriu werk bî gote und got bî in. Sant Johannes sprichet: “daz wort was bî gote.”’ 󰀁󰀄. Ibid. 󰀄󰀂󰀂: ‘Nû sprichet er: “sîn lôn ist bî dem herren”. Von disem ein wênic. Daz er sprichet “bî”, daz ist, daz des gerehten lôn ist, dâ got selber ist; wan des gerehten saelicheit und gotes saelicheit ist ein saelicheit, wan dâ ist der gerehte saelic, dâ got saelic ist. Ez sprichet sant Johannes: “daz wort was bî gote”. Er sprichet “bî”, und dar umbe ist der gerehte glîch gote, wan got ist diu gerehticheit.’ 󰀁󰀅. Sermon 󰀃󰀉 (ibid.) states: ‘Der vater gebirt sînen sun den gerehten und den gerehten sînen sun.’ Sermon 󰀆 accomplishes this connection only by designating both the son and the just man as glîch gote in eternity (ibid., 󰀈󰀂): ‘Der vater gebirt sînen sun in der êwicheit im selber glîch. Daz wort was bî gote, und got was daz wort.’ 󰀁󰀆. Meister Eckhart, Werke, II, ed. N. Largier (󰀂󰀀󰀀󰀈), 󰀂󰀃󰀄: ‘diu güete enist noch geschaffen noch gemachet noch geborn; mêr si ist gebernde und gebirt den guoten, und der guote, als verre sô er guot ist, ist ungemachet und ungeschaffen und doch geborn kint und sun der güete.’

THE

G OSPEL

OF

J OHN

AND THE

O NTOLOGY

OF

N OUNS

AND

A DJECTIVES

󰀇󰀇

to have cited Thomas of Erfurt or drawn an argument from him directly in order for an influence to be present. My contention is that Eckhart’s discussion of justice and the just fits best into this nexus of metaphors if the grammatical and ontological relationship between justice and the just is understood according to Thomas of Erfurt’s terms. There are certain characteristics that Eckhart’s thought must display for this to be so. Eckhart ought to share Thomas’ Modist conception of some kind of universal that could manifest either as substance (a noun) or by inherence (an adjective). And if he does share this notion, when he uses nouns such as ‘justice’ (Gerechtigkeit) there should be an attempt to distinguish between reference to the universal (which cannot be grasped in language) and to its manifestation as substance in and by means of the noun. This distinction itself, however, raises the following problem in the context of theology that pertains to Thomas of Erfurt’s distinction between the two types of adjective. Because of the status of qualities such as ‘justice’, ‘goodness’, and ‘truth’ as names for the Godhead, these words might be considered to signify substance insofar as they refer to God. Stated in Thomas’ terms, the issue is whether the adjective ‘just’ belongs to the class of adjectives like ‘white’ which may inhere in a substance, or to the class of adjectives like ‘animate’ which are only apposite. That is to say, would the locution ‘just man’ signify a human in whom inhered the quality of justice – or would it signify a human substance co-present with the substance of justice in a single manifestation? Eckhart does discuss the relationship of ‘justice’ to the human, by way of the connection to the beginning of John and the focus on the preposition ‘apud’. In the Commentary on John, Eckhart describes justice as a quality in a way that seems to reflect Thomas’ definition of adjectives that function by apposition rather than inherence. Eckhart writes: Justice or the just soul is not seen in the soul as an image or something external to the soul. Nor does it appear as something absent, as Carthage and Alexandria are seen. It is seen in the soul as something present to the soul, but which nevertheless stands as it were apart from that justice, next to it, just as if it were like it without quite reaching it.󰀁󰀇 󰀁󰀇. Ibid. 󰀅󰀃󰀀: ‘Iustitia sive iustus animus videtur in animo non tamquam fictum aliquid extra ipsum animum, aut quasi aliquod absens, quomodo videtur Carthago ve Alexandria. Videtur quidem in animo ut praesens quoddam animo, sed tamen quasi foris stans ab ipsa iustitia, apud ipsam, similis quidem utcumque, nondum ipsam attingens.’

󰀇󰀈

C LAIRE T AYLOR J ONES

Justice does not appear in the soul as something naturally present to it, but as something that exercises an influence on it from the outside. This manner of relationship calls to mind the medieval understanding of perception as impressions on the soul by the objects that enter it through the senses. Eckhart immediately rejects the notion that justice exists in the soul in the same mode as images and impressions, whether present and immediate or imagined and remembered like the distant and historical cities of Carthage and Alexandria. Justice is neither within nor impressed upon the soul, but next to it. This spiritual justice is present to the soul, but stands apart from justice itself, although with it, apud ipsam. Eckhart uses the word apud here to describe this relationship of copresence between justice and the soul in terms in terms that hearken back to the first verse of John – Verbum erat apud Deum, the Word was with God. The beginning of John, of course, says that the Word was both with, apud, God and was God. The double relationship of coincidence and identity – the juxtaposition of two substances within one entity – obtains for God and the Word as well as justice and the soul. It also seems to correspond to the relationship that Thomas describes between, for example, the words animal and rationale. Since both words refer to substance, one cannot inhere in the other. Eckhart’s explanation that justice does not inhere in the just soul but lies apud, next to it reflects Thomas’ description of two substances that coincide rather than a quality inhering in some other substance. In the German sermons, as well, Eckhart lays a great deal of weight on the preposition bî (apud), which in Eckhart’s terminology also often indicates that one thing is derivative from something else but somehow simultaneously also the same (glîch). Almost every time he refers to the Gospel of John, Eckhart insists that the choice of the preposition bî or apud indicates the equality of the Word with God, despite the fact that the Word is born from the Father. In German Sermon 󰀆, he claims of the Word that, ‘It was identical and was beside (bî neben), neither under nor over, but the same (glîch).’󰀁󰀈 In German Sermon 󰀃󰀉, Eckhart uses the preposition as a hinge between the two biblical passages Wisdom 󰀅:󰀁󰀆 󰀁󰀈. Meister Eckhart, Werke, I, ed. N. Largier (󰀂󰀀󰀀󰀈), 󰀈󰀂: ‘Ez was alzemale glîch und was bî neben, noch undenân noch obenân sunder glîch.’

THE

G OSPEL

OF

J OHN

AND THE

O NTOLOGY

OF

N OUNS

AND

A DJECTIVES

󰀇󰀉

and John 󰀁:󰀁 by connecting the locution ‘with God’ (apud deum) from John with the Wisdom author’s statement that the reward of the just man is ‘with the Lord’ (apud dominum). Bî or apud again indicates a relationship between things that are somehow both the same and distinct, like God and the Word. Understanding apud and bî in this way supports an interpretation of the relationship between iustus and animus as analogous to the relationship Thomas describes between animal and rationale. Iustus designates something that cannot inhere in another substance and has to be connected by apposition rather than inherence, although iustus and animus together still constitute a single entity. The reason for this special status of ‘the just’ is the designation of ‘justice’ as one of the names for the Godhead, as Eckhart claims for diu gerehticheit in German Sermon 󰀃󰀉. Eckhart expounds John’s use of the word bî by explaining ‘Saint John says: the Word was with (bî) God. He says bî, and therefore the just man is like God, for God is justice.’󰀁󰀉 If when we say justice we are indicating an aspect of God, it would therefore be incongruous to say that justice inhered in a person, because an aspect of the Godhead could not inhere in some other substance, even the soul. The relationship between iustus and animus therefore must be one of apposition, which would allow iustus to retain ontological priority even in a derivative grammatical form. This position entails making an exception to a grammatical rule for words that designate the Godhead in a derivative or subordinate manner, since God cannot be derivative or subordinate. This move is in fact consistent with Thomas of Erfurt.󰀂󰀀 In addition to claiming that adjectives that designate substance function as appositions, Thomas argues that grammatical exceptions apply to words that signify the divine in inappropriate modes. He first registers discomfort with the noun deitas, since he understands the feminine gender to signify something in a passive mode and God may not be understood as passive. He continues, explaining that we invent locutions of this kind, because we cannot perceive God. It must be said that it does not follow that the active mode of signifying of a word is always drawn from the property of the thing of that word of which it is a mode of signifying, but it can 󰀁󰀉. Ibid. 󰀄󰀂󰀂: ‘Ez sprichet sant Johannes: “daz wort was bî gote”. Er sprichet “bî”, und dar umbe ist der gerehte glîch gote, wan got ist diu gerehticheit.’ 󰀂󰀀. Stefan Grotz discusses this at much more length in his contribution to this volume.

󰀈󰀀

C LAIRE T AYLOR J ONES

be derived from a property of the thing of another word and attributed to the thing of that word, and it suffices that these should not be incompatible. And because we do not understand separate substances unless perceived by the senses, therefore we give names to them by means of the properties of the senses and assign active modes of signifying to their names. Hence, although in Deo, in reality, is not a passive property, yet we imagine Him, as it were, being acted upon by our prayers.󰀂󰀁 Thomas holds that the human reliance on sense perception limits our ability to express imperceptible substances appropriately in language. Although his examples are the feminine noun deitas and the masculine noun deus in the dative case, his explanation for such linguistic infelicities applies equally to the adjectives that describe substance, like ‘animate’ (animatum) and ‘rational’ (rationale). We assign these substances the expressive function of adjectives because ‘we do not understand separate substances unless perceived by the senses.’ Humanity and animality are not things that may be seen, so we treat these substances as if they were things that inhered in another substance. Thomas’ philosophical exceptions apply equally to adjectives that designate substance and adjectives that refer to the divine. Returning to Eckhart’s Commentary on John with the premise that the relationship between ‘the soul’ (animus) and ‘just’ (iustus) is apposition rather than inherence, we are now in a better position to understand Eckhart’s version of the argument that the soul tries to become more like that which it loves, in this case justice. Even though the soul is not the same as justice, ‘it follows it as if it could attain it, grasp it, enter it, and become one in her [justice] and she [justice] in it [the soul].’󰀂󰀂 This is accomplished, Eckhart argues, when the soul takes on the form of justice by inhering in it – inhaerendo – in order that the soul be just.󰀂󰀃 󰀂󰀁. Thomas of Erfurt, Grammatica Speculativa, 󰀁󰀃󰀈: ‘Dicendum, quod non oportet, quod semper modus significandi activus dictionis trahatur a proprietate rei illius dictionis, cuius est modus significandi; sed potest accipi a proprietate rei alterius dictionis, et rei illius dictionis tribui, et sufficit quod ipsi non repugnet; et quia substantias separatas non intelligimus, nisi ex istis sensibilibus, ideo sub proprietatibus sensibilium eis nomina imponimus, et nominibus eorum modos significandi activos attribuimus. Unde licet in Deo, secundum veritatem, non sit proprietas passiva, tamen imaginamur ipsum tanquam patientem a nostris precibus.’ (English translation ibid. 󰀁󰀃󰀉). 󰀂󰀂. Meister Eckhart, Werke, II, ed. N. Largier (󰀂󰀀󰀀󰀈), 󰀅󰀃󰀀-󰀂: ‘sequitur autem si quomodo attingat, comprehendat, intret et unum fiat in ipsa et ipsa in isto.’ 󰀂󰀃. This language in fact derives from Augustine’s De Trinitate. See ibid. 󰀈󰀆󰀆.

THE

G OSPEL

OF

J OHN

AND THE

O NTOLOGY

OF

N OUNS

AND

A DJECTIVES

󰀈󰀁

The syntactical relationship of iustus to animus in the Latin of this pasasge is actually ambiguous: ‘Ut inde formetur et sit iustus animus ipse.’󰀂󰀄 Because of the word order and the possibility of an implied subject, we could understand iustus either as an adjective attached to animus, or as a stand-alone substantive adjective. That is, this clause could be translated either as ‘in order that it itself be a just soul’ or as ‘in order that the soul itself be a just thing, iustus.’ The distinction is important and I would argue that, in order for the interpretation to be truly Eckhartian, we must understand it according to the second translation (that the soul be a just thing) because in order to become just the soul must give up being a soul. This interpretation is supported by passages from both the Liber Benedictus and German Sermon 󰀃󰀉, where Eckhart emphasises the use of iustus or der Gerechte as a stand-alone substantive adjective. Eckhart stresses this independence of the word gereht in Sermon 󰀃󰀉, saying: ‘Now let us talk more about the word “just”. He does not say “the just man” nor “the just angel”, he just says “the just.”’󰀂󰀅 Liberating the adjective from connection with some noun that would provide a determinate substance is equivalent to the project of Gelassenheit. That is, the noun ‘man’ (mensche), in which ‘just’ (gereht) would inhere or be apposite, is a worldly attribute that must be overcome in order to unite fully with the Godhead represented by the quality of ‘justice’ (Gerechtigkeit). In the Liber Benedictus, Eckhart similarly writes: ‘One should also know, that when we say “good,” the name or the word designates and encompasses nothing else, no more nor less, than bare and pure goodness.’󰀂󰀆 The adjective ‘good’ represents goodness alone and does not necessarily imply inherence in another substance. As Eckhart explains, again with a reference to wisdom literature: ‘Salomon says: “The just is not saddened by anything that may happen to him.” He does not say: “the just man” nor “the just angel” nor this nor that. He says “the just.”’󰀂󰀇 It is actually not 󰀂󰀄. Ibid. 󰀅󰀃󰀂. 󰀂󰀅. Meister Eckhart, Werke, I, ed. N. Largier (󰀂󰀀󰀀󰀈), 󰀄󰀂󰀂: ‘Nû sprechen vürbaz von dem worte “gereht”. Er ensprichet niht “der gerehte mensche” noch “der gerehte engel”, er sprichet aleine: “der gerehte”.’ 󰀂󰀆. Meister Eckhart, Werke, II, ed. N. Largier (󰀂󰀀󰀀󰀈), 󰀂󰀃󰀄: ‘Noch sol man wizzen, da der name oder daz wort, sô wir sprechen “guot”, nennet und besliuzet in im niht anders, noch minner noch mê, wan blôze und lûter güete.’ 󰀂󰀇. Ibid. 󰀂󰀃󰀈: ‘Salomon sprichet: “den gerehten enbetrüebet niht allez, daz im geschehen mac.” Er ensprichet niht “den gerehten menschen” noch “den gerehten engel” noch diz noch daz. Er sprichet “den gerehten”.’

󰀈󰀂

C LAIRE T AYLOR J ONES

possible to render this passage well in English, because it relies on the use of a substantive adjective (der Gerechte), a grammatical form common in both Latin and German, but unidiomatic in English. The substantive adjective allows the word to indicate ‘justice’ in a derivative form, but without connection to some other substance on which it would depend – a human or an angel. In order to be truly just, then, one must be only just. That is, one must surrender whatever substance it is, whether man or angel, that was supposed to be anchoring ‘justice’ (Gerechtigkeit) and become pure and simply ‘the just’ (der Gerechte). Returning to the gospel commentary, the soul (animus) would therefore have to become ‘just’ (iustus) and, being formed by justice, would no longer be animus iustus, but merely iustus. Eckhart’s treatment of adjectives and their syntactic connection to substantive nouns is consistent with Thomas’ arguments on the one hand about derivative word-forms that signify the Godhead and on the other about adjectives that signify substance and therefore cannot inhere but are apposite. Indeed, it could perhaps be argued that the relationship of apposition is fundamental to the possibility of Gelassenheit – one can ‘unbecome’ the soul but continue to exist as ‘the just’ alone. It remains for me to address the verbal character of adjectives, which signify according to being (esse). This aspect of Thomas of Erfurt’s discussion also perfectly suits a central feature of Eckhart’s theology, namely, the importance of activity. In the Liber Benedictus, Eckhart elaborates on the relationship between wisdom and the wise man, good and the good man, and so forth, in the same terms with which he describes the Father and the Word in other places, namely, with the language of birth. First one should know, that the wise [man] and wisdom, the true [man] and truth, the just [man] and justice, the good [man] and goodness regard each other and hold to each other: goodness is not created, nor made, nor born; rather, she is fruitful and begets the good [man], and the good [man], insofar as he is good, is unmade and uncreated and nevertheless a begotten child and son of goodness.󰀂󰀈 󰀂󰀈. Meister Eckhart, Werke, II, ed. N. Largier (󰀂󰀀󰀀󰀈), 󰀂󰀃󰀂-󰀄: ‘Von dem êrsten sol man wizzen, daz der wîse und wîsheit, wâre und wârheit, gerehte und gerehticheit, guote und güete sich einander anesehent und alsô ze einander haltent: diu güete enist noch geschaffen noch gemachet noch

THE

G OSPEL

OF

J OHN

AND THE

O NTOLOGY

OF

N OUNS

AND

A DJECTIVES

󰀈󰀃

The specification of “the good [man], insofar as he is good” implies the exclusion of the determinate noun (mensche or engel) as I have just shown. It implies furthermore, as Eckhart goes on to explain, that the works of “the good [man]” are derived from and performed in goodness, which he proves by adducing no less than three verses from various chapters of the gospel of John in which Christ states that the Father ‘works’ (würket) in him. The association of the Father/Word relationship with work or effectivity also provides the key point of German Sermon 󰀉’s third interpretation of bîwort, which refers to the distinction between reason and sense perception. Reason deals with spiritual things and works inwardly, whereas sense perception deals with bodily things and must therefore work outwardly. Blessedness lies in the work of reason within the soul, where the Word resides. ‘That is where the soul should be a bîwort and accomplish a work with God.’󰀂󰀉 Similarly, when we turn to German Sermon 󰀆, we find that the just are bî gote because they accomplish all their works with God and God with them.󰀃󰀀 Finally, German Sermon 󰀃󰀉 deals from the very beginning almost exclusively with works and the work of justice and the just man, reversing the metaphor to state that ‘God is born from every virtue of the just.’󰀃󰀁 Work and effectivity are clearly central to the concept of ‘the just’. Moreover, work is precisely what distinguishes ‘the just’ from ‘justice’, since it is only through, by means of, and in the just that justice can perform its work. We may understand how central effectivity is in the relationship between ‘justice’ and ‘the just’ theologically by analogy to God and the Word. ‘The just’ would serve as the earthly representative of ‘justice’ in the way that Christ as the Word performed God’s will within time. There is, however, also a grammatical explanation for this distinction based on work. I argued earlier for understanding the adjective ‘just’ (iustus) as operating like the adjectives which signify substance and therefore connect with other nouns only by apposition. If Eckhart understands justice geborn; mêr si ist gebernde und gebirt den guoten, und der guote, als verre sô er guot ist, ist ungemachet und ungeschaffen und doch geborn kint und sun der güete.’ 󰀂󰀉. Meister Eckhart, Werke, I, ed. N. Largier (󰀂󰀀󰀀󰀈), 󰀁󰀁󰀆: ‘Dâ sol diu sêle sîn ein bîwort und mit gote würken ein werk.’ 󰀃󰀀. Ibid. 󰀈󰀀: ‘sie würkent alliu iriu werk bî gote und got bî in.’ 󰀃󰀁. Ibid. 󰀄󰀂󰀀: ‘von einer ieglîchen tugent des gerehten wirt got geborn.’

󰀈󰀄

C LAIRE T AYLOR J ONES

to be a name for the Godhead, such a use would put Eckhart in line with Thomas, who makes grammatical exceptions for words that signify substance and the divine. Such adjectives are an exception, however, to the more usual form of adjective, which operates by the mode of inherence in something else with regard to being, esse. This is to say that adjectives, although they belong to the class of nouns, share the characteristic of esse with verbs and therefore signify activity on the part of the substance in which they inhere. ‘Whiteness’ (albedo) as a noun signifies ‘white’ as it is in itself independently. ‘White’ (albus) as an adjective signifies that the substance in which it inheres is ‘being white’ or ‘doing whiteness’. This inherent performative character of the adjective conforms with Eckhart’s insistence that ‘the just’ does the work of ‘justice’. Just as albus Socrates is Socrates being white, der Gerechte is doing justice. There is no reason why Eckhart should have chosen and maintained one of these two interpretations of the function of gereht as an adjective, signifying either as inhering according to being or as apposite substance. It is merely plausible that Thomas of Erfurt’s approach to nouns and adjectives provided a fruitful impulse for Eckhart’s thought on man’s relationship to God. Although I have argued that iustus could be grouped with the adjectives that signify substance or the exceptions for words signifying the divine, Thomas does not mention iustus to assign it to either of these categories. We have already seen with regard to Quasi stella matutina that Eckhart offers as many different interpretations of a passage as will render productive meanings. Nevertheless, whether we or Eckhart understand iustus and gereht to signify substance or to signify activity, Thomas of Erfurt’s philosophical grammar provides a conceptual model that brings Eckhart’s discussion of ‘the just’ and ‘justice’ fully into line with other aspects of his thought.

Meister Eckhart, die schuole, die Grammatik und die Bibel FREIMUT LÖSER, AUGSBURG

Abstract In a famous statement in his Sermon 󰀉 Master Eckhart talks about ‘the little word quasi’ which ‘young people at school call a bîwort’ (= ‘by-word’, ‘ad-verbium’). The following article deals with Eckhart’s view of ‘school’, grammar and, since with his use of bîwort he reflects on Sir. 󰀅󰀀:󰀆-󰀇 (Quasi stella matutina…), on his use of grammar and grammatical terms when he is explaining the Bible. The University of Paris, mentioned in his German, not in his Latin sermons, is an important place of scholarship, which does not necessarily mean that God is to be found there (and in scholarship); the Dominican Order’s school at Cologne is sometimes also mentioned in Eckhart’s German sermons and it is to be seen that there is neither hierarchy nor even a sharp borderline between a ‘scholarly High School’ and a ‘school of life’. The theories taught at school were also discussed in German sermons in front of a lay-audience and the boundary between the two different languages Latin (school) and German (life) is dissolved, if it ever existed. The German language (bîwort) is used at school, whereas Latin structures are reflected in German sermons. And what is more: Bilingual structures help to get to the bottom of the Holy Scripture (schrift ergründen, as Eckhart puts it): Maybe influenced by the ‘modists’, and especially by Thomas of Erfurt, for Eckhart Grammar becomes an important means of biblical exegesis; but grammar is more for him than a method: The meaning of a text is not to be found by analysing semantics only, but it is constituted by the deeper meaning of syntactical positions in sentences as well as by classes of words. Especially when he translates Biblical sentences from Latin into German and, while doing so, necessarily reflects on grammar, Eckhart proves to be a very sound and profound grammarian. The true meaning of the Holy Text

󰀈󰀆

F REIMUT L ÖSER

is to be found when the two languages Latin and German meet to constitute a meaning of language in language-structures and in a language beyond language.

D

ie sicherlich bekannteste Stelle, in der Meister Eckhart die mögliche Bedeutung grammatischer Strukturen erwähnt und grammatikalisch argumentiert, findet sich in Predigt 󰀉 (Quasi stella matutina): Ich meine daz wortelîn ›quasi‹, daz heizet ›als‹, daz heizent diu kint in der schuole ein bîwort (Pr. 󰀉, DW I 󰀁󰀅󰀄,󰀇-󰀈).󰀁 Dabei fällt zunächst die Verbindung von schuole und Grammatikunterricht auf. Im Folgenden soll also zunächst gefragt werden, was Eckhart eigentlich genauer unter schuole versteht (Teil I), bevor auf seine Wahrnehmung und Verwendung von Grammatik-Lehre und Grammatik allgemein im deutschen Werk eingegangen wird (Teil II). Dabei wird sowohl die Übersetzungsproblematik (›quasi‹, daz heizet ›als‹) als auch die Frage von Bibelzitaten (Quasi stella matutina) und Grammatik im Mittelpunkt stehen. Eckharts Stellung zur schuole, d. h. zur Hohen Schule (= Universität oder Studium Generale der Dominikaner), betrifft zuvörderst die Universität Paris. Ich habe Eckharts Sicht auf Paris in einem eigenen Aufsatz dargestellt󰀂 und fasse hier nur die Ergebnisse kurz zusammen. Man kann insgesamt feststellen: Mit der Nennung der Universität Paris in seinen Werken signalisiert Eckhart: – –

höchste theologische und philosophische Autorität; theologisch diffizile Diskurse;

󰀁. Eckharts Werke werden zitiert nach: Meister Eckhart. Die deutschen und lateinischen Werke, Herausgegeben im Auftrage der Deutschen Forschungsgemeinschaft. Die deutschen Werke. Herausgegeben und übersetzt von Josef Quint. Meister Eckharts Predigten. Erster bis dritter Band (Stuttgart, 󰀁󰀉󰀆󰀈, 󰀁󰀉󰀇󰀁, 󰀁󰀉󰀇󰀆); Meister Eckhart. Die deutschen und lateinischen Werke. Die Deutschen Werke. Herausgegeben und übersetzt von Georg Steer unter Mitarbeit von Wolfgang Klimanek und Freimut Löser. Predigten Vierter Band Teilband IV,󰀁 (Stuttgart, 󰀂󰀀󰀀󰀃); Meister Eckhart. Die deutschen und lateinischen Werke. Herausgegeben im Auftrag der Deutschen Forschungsgemeinschaft. Die lateinischen Werke. Herausgegeben von Loris Sturlese, Albert Zimmermann u. a. (Stuttgart, 󰀁󰀉󰀅󰀆, 󰀁󰀉󰀆󰀄, 󰀁󰀉󰀈󰀇, 󰀁󰀉󰀉󰀂, 󰀁󰀉󰀉󰀄, 󰀂󰀀󰀀󰀆). 󰀂. Vgl. Freimut Löser, ‚Meister Eckhart von Paris. Zur Bedeutung von ,Paris‘ in Eckharts deutschen Predigten und deren Überlieferung‘, in Dietmar Mieth, Marie-Anne Vannier, Markus Vinzent, Christopher M. Wojtulewicz (Hgg.), Meister Eckhart in Paris and Strasbourg, Eckhart: Texts and Studies 󰀄 (Leuven, 󰀂󰀀󰀁󰀇), 󰀆󰀈-󰀁󰀀󰀈.

M EISTER E CKHART ,

–

DIE SCHUOLE , DIE

G RAMMATIK

UND DIE

B IBEL

󰀈󰀇

gleichzeitig aber eine gewisse Distanz: Gelehrsamkeit ist nicht per se ein Weg zur Gotteserkenntnis.

Er signalisiert die Relevanz bestimmter Fragen (wie der Debatte um den Primat der bekantnisse oder der vernunft). Er charakterisiert später – sogar noch im späten Umfeld des Kölner Prozesses ganze dreimal! – als ein Zentrum seiner universitären Lehre in Paris die These, am gerechten Menschen sei alles erfüllt, was die Heilige Schrift von Christus selbst sage. Auffällig ist, dass Eckhart Paris insgesamt eigentlich nicht sehr oft erwähnt und dass die ermittelbaren Fälle eindeutige Tendenzen erkennen lassen. Eckhart ist bei der Erwähnung konkreter Orte generell zurückhaltend. Das liegt daran, dass er Allgemeingültigkeit und hohe Abstraktion anstrebt. Man kann deshalb eine gewisse ‚Ortlosigkeit‘ der Eckhartschen Texte feststellen. Konkret heißt das: Wenn Eckhart nur wenige Orte (und diese nur selten) erwähnt, hat ihre Erwähnung umso stärkeren Signalcharakter. Erwähnt werden die Namen bestimmter Kölner Klöster (keine anderen, auch nicht das Erfurter, das für ihn so bedeutend war) und eben Paris mit seiner Universität, nicht jedoch Erfurt und nicht dessen ‚Hohe Schule‘. Eine Grenzziehung zwischen Pariser Universität und Laien im Publikum der deutschen Predigt findet nicht statt: Dem volkssprachigen Publikum werden gerade die schwierigen Fragen auch vorgelegt. Die Problematik des Schriftverständnisses und der Exegese betrifft Laien wie gelehrte Meister. Bevor aber die Frage nach Eckharts Bibelexegese im Blick auf die Grammatik erörtert wird, sollen anhand von Eckharts Umgang mit der Institution und dem Begriff schuole die Ergebnisse zum Stichwort Paris überprüft werden und auf einer allgemeineren Ebene hinterfragt werden. Wie steht Eckhart nicht nur der Pariser Universität gegenüber, sondern was denkt er generell über die schuole? I. (Hohe) Schule(n) Nimmt man die Stellen in Eckharts deutschem Werk in den Blick, in denen er die schuole erwähnt, fällt zunächst auf, dass, ähnlich wie sich dies schon andeutete, eine Grenzziehung zwischen Schule und Laien so nicht existiert. So ist die Schule für Eckhart zuerst einmal die ‚Schule des Lebens‘.

󰀈󰀈

F REIMUT L ÖSER

Und in der Schule Christi lernt man leben. So beschreibt es Eckhart in der berühmten Maria-Martha-Predigt 󰀈󰀆, wenn es etwa von Maria heißt: Marîâ was ê Marthâ, ê si Marîâ würde; wan, dô si saz bî den vüezen unsers herren, dô enwas si niht Marîâ: si was ez wol an dem namen, si enwas ez aber niht an dem wesene; wan si saz bî luste und bî süeze und was allerêrst ze schuole gesetzet und lernete leben. Aber Marthâ stuont sô weselîche, dâ von sprach si: ‚herre, heiz sie ûfstân!‘, als ob si spræche: ‚herre, ich wölte gerne, daz si dâ niht ensæze durch lust; ich wölte, daz si lernete leben, daz siez weselîche besæze. […]‘󰀃 ‚Marîâ saz bî den vüezen unsers herren und hôrte sîniu wort‘ und lernete, wan si allerêrst ze schuole was gesetzet und lernete leben. Aber dar nâch, dô si gelernete und Kristus ze himel gevuor und si den heiligen geist enpfienc, dô vienc si allerêrst ane ze dienenne und vuor über mer und predigete und lêrte und wart ein dienærinne und ein wescherinne der jünger.󰀄 Im Zentrum eines solchen christlichen Lebensmodells zwischen vita activa und vita contemplativa steht somit nicht die Hohe Schule mit der Vermittlung von Wissen, sondern die Schule des Lebens zu Füßen Christi, die in einem aktiven, den Mitmenschen zugewandten Lebensstil gipfelt. Die Grenze zwischen Schule und Leben, Theorie und Praxis, Universität und Frauenkloster, Latein und Deutsch wird aber auch in anderer Hinsicht aufgelöst, etwa in Predigt 󰀂󰀂: ‚In principio‘ daz sprichet als vil ze tiutsche als ein anegenge alles wesens, als ich sprach in der schuole; ich sprach noch mê: ez ist ein ende alles wesens, wan der êrste begin ist durch des lesten endes willen.󰀅 󰀃. Pr. 󰀈󰀆 (DW III 󰀄󰀉󰀁,󰀉-󰀁󰀄); Übersetzung Quints: „‹Auch› Maria ist erst ‹eine solche› Martha gewesen, ehe sie ‹die reife› Maria werden sollte; denn, als sie ‹noch› zu den Füßen unseres Herrn saß, da war sie ‹noch› nicht ‹die wahre› Maria; wohl war sieʼs dem Namen nach, sie warʼs aber ‹noch› nicht in ihrem Sein, denn sie saß ‹noch› im Wohlgefühl und in süßer Empfindung und war erst in die Schule genommen und lernte leben. Martha aber stand ganz wesenhaft da, daher sprach sie: ʻHerr, heiß sie aufstehenʼ, als hätte sie sagen wollen: ʻHerr, ich möchte gern, dass sie nicht da säße um des Wohlgefühls willen; ich wünschte ‹vielmehr›, dass sie leben lernte, auf dass sie es ‹= das Leben› wesenhaft zu eigen hätte.ʼ“ (DW III 󰀅󰀉󰀈). 󰀄. Pr. 󰀈󰀆 (DW III 󰀄󰀉󰀂,󰀇-󰀁󰀁); Übersetzung Quints: „ʻMaria saß zu den Füßen unseres Herrn und hörte seine Worteʼ und lernte, denn sie war erst in die Schule genommen und lernte leben. Aber späterhin, als sie gelernt hatte und Christus gen Himmel gefahren war und sie den Heiligen Geist empfangen hatte, da erst fing sie an zu dienen und fuhr überʼs Meer und predigte und lehrte und ward eine Dienerin und Wäscherin der Jünger.“ (DW III 󰀅󰀉󰀈-󰀉). 󰀅. Pr. 󰀂󰀂 (DW I 󰀃󰀈󰀉,󰀁-󰀃); Übersetzung Quints: „ʻIn principioʼ, das heißt zu deutsch soviel wie ein Anfang alles Seins, wie ich in der Schule sagte. Ich sagte überdies: Es ist ein Ende alles Seins, denn der erste Beginn ist um des letzten Endziels willen da.“ (DW I 󰀅󰀂󰀀).

M EISTER E CKHART ,

DIE SCHUOLE , DIE

G RAMMATIK

UND DIE

B IBEL

󰀈󰀉

Eckhart könnte damit meinen, dass er,principium‘ in der schuole in lateinischer Sprache als Anfang alles Seins erklärt habe; er würde diese Erklärung dann hier ins Deutsche übertragen. Eckhart könnte hier aber auch nichts anderes sagen, als dass er in der schuole für in principio eine d e u t s c h e Erklärung, nämlich anegenge alles wesens gegeben hat. Mit Eckhart wäre dann die deutsche Sprache an einer solchen Stelle offenbar nicht nur in die Verkündigungssituation der deutschsprachigen Predigt, sondern auch in den Unterricht der schuole eingedrungen. Eckhart geht mit seiner Übertragung dabei über die mittelalterlichen Vokabularien hinaus, die principium als anegenge, anbegynne, anhebung oder anevang übersetzen.󰀆 Der ‚Mehrwert der Volkssprache‘ (Ruh) erschließt lateinische Zentralbegriffe: In principio wird zum anegenge alles wesens, und mehr noch: gleichzeitig zum ende alles wesens. Wir wissen, dass Eckhart auch Predigt 󰀂󰀂, in der er die schuole erwähnt, wie die für die Erwähnung von Paris wichtigen Predigten 󰀁󰀄 und 󰀁󰀅 in einem Kölner Kloster hielt, im Zisterzienserinnenkloster St. Mariengarten;󰀇 dies aber nicht nur vor den dortigen Nonnen, sondern wohl auch vor einem breiteren städtischen Publikum.󰀈 In dieser Predigt 󰀂󰀂, von der noch einmal die Rede sein wird, erinnert Eckhart an eine schuole, in der er die lateinische Begrifflichkeit in deutscher Sprache erklärt hat, und er tut dies abermals vor s e i n e m Predigtpublikum in der Volkssprache. Mit der erwähnten schuole kann somit nicht die Pariser Universität gemeint sein, sondern wohl nur die theologische Schule der Dominikaner in Köln (s. u.). Zweierlei aber scheint mindestens ebenso beachtlich dabei. Zum einen: Wenn tatsächlich (sicher im Ausnahmefall) die deutsche Sprache in die schuole eindringt, wird das Mit- und Gegeneinander der verschiedenen Sprachen Latein und Deutsch grundsätzlich ein Klima erzeugen, das im Sprachvergleich auch die Sprachreflexion fördert. Zum anderen: Die Lehren, die Eckhart 󰀆. Vgl. Klaus Kirchert zusammen mit Dorothea Klein (Hgg.), Die Vokabulare von Fritsche Closener und Jakob Twinger von Königshofen. Überlieferungsgeschichtliche Ausgabe, Texte und Textgeschichte 󰀄󰀀/󰀂 (Tübingen, 󰀁󰀉󰀉󰀅), hier Band II 󰀁󰀁󰀇󰀁, 󰀁󰀀󰀉; Klaus Grubmüller, Bernhard Schnell et al. (Hgg.), Vocabularius Ex quo. Überlieferungsgeschichtliche Ausgabe, Text und Textgeschichte 󰀂󰀂/󰀇 (Tübingen, 󰀁󰀉󰀈󰀈-󰀂󰀀󰀀󰀁), hier Bd. IV 󰀂󰀁󰀁󰀆 P 󰀁󰀁󰀀󰀂; Peter Schmitt (Hg.), Liber ordinis rerum (EsseEssencia-Glossar), Text und Textgeschichte 󰀅/󰀁 und 󰀅/󰀂 (Tübingen, 󰀁󰀉󰀈󰀃), hier Bd. 󰀅/󰀂, 󰀄󰀂󰀄, 󰀁󰀇. 󰀇. Vgl. DW I 󰀃󰀇󰀂-󰀄. 󰀈. Freimut Löser, ,Was sind Meister Eckharts Straßburger Predigten?‘ in Andrés QueroSánchez und Georg Steer (Hgg.), Meister Eckharts Straßburger Jahrzehnt, Meister-Eckhart-Jahrbuch 󰀂 (Stuttgart, 󰀂󰀀󰀀󰀈), 󰀃󰀇-󰀆󰀃, 󰀃󰀇-󰀄󰀁.

󰀉󰀀

F REIMUT L ÖSER

in dieser Schule behandelt, werden von ihm in seiner volkssprachigen Predigt auch nach außen weitergegeben, in seinen ‚außerschulischen‘ Wirkbereich. Der Bereich der ‚Schule‘ bleibt nicht verschlossen und hermetisch: Dort dringt die Volkssprache ein; die Lehren der ‚Schule‘ dringen hinaus.󰀉 Diese Durchlässigkeit nach außen lässt sich an einem weiteren Beispiel demonstrieren: Die Lehre von der Seele des Menschen als Bild Gottes wird von Eckhart in Predigt 󰀅󰀀 als komplex und schwierig gekennzeichnet, sie gilt ihm explizit als Gegenstand der schuole: Es wart gesprochen in der schv̊le, vnd sprachen etliche meister, Got hette das bilde gedrvket in die sele, als der ein bilde malet an der want vnd das vergat. das wart wider sprochen. Ander Meister sprachen bas vnd sprachen, got hette das bilde gedrv̍ket in die sele in eime blibende, als ein in ire blibender gedanch – Also: ich habe hv̍te einen willen vnd habe morne den selben gedanch vnd enthalte das bilde vf mit mime gegenwertigen inflvsse –, vnd sprachent also, das gottes werch vollenkomen sint. want wer der zimberman vollenkomen an sime werche, er bedorfte der materien nicht; want, als schier, als er sin gedechte, so were das hus vollebracht. Also sint dv̍ werch in gotte: als schier, als er sin gedenket, so sint dv̍ werch vollenbracht in eime gegenwertigen nv. Do kam der fvnfte meister und sprach aller best vnd sprach: Da enist enkein ‹gewerden›, mer: es ist ein nv̍, ein gewerden svnder gewerden, ein nv̍we svnder vernv̍wen, und das gewerden ist sin wesen.󰀁󰀀 󰀉. Von Bedeutung sind hier auch Eckharts unbedingter Wille, ‚Ungelehrte‘ zu lehren und seine Lehrkonzepte. Dazu detailliert: Freimut Löser, ,Meister Eckhart und seine Schüler. Lebemeister oder Lesemeister?‘, in Andreas Speer und Thomas Jeschke (Hgg.), Schüler und Meister, Miscellanea Mediaevalia 󰀃󰀉 (Berlin, 󰀂󰀀󰀁󰀆), 󰀂󰀅󰀅-󰀇󰀆. 󰀁󰀀. Pr. 󰀅󰀀 (DW II 󰀄󰀅󰀈,󰀆-󰀄󰀅󰀉,󰀈); Übersetzung Quints: „Man diskutierte in der Schule, und einige Meister sagten, Gott habe das Bild in die Seele so eingeprägt wie einer, der ein Bild an die Wand malt, und das vergeht. Dem ward widersprochen. Andere Meister äußerten sich besser und sagten, Gott habe das Bild als bleibend in die Seele geprägt, so wie einen in ihr bleibenden Gedanken, wie etwa: ich habe heute einen ‹bestimmten› Willen und habe morgen denselben Gedanken und erhalte die Willensvorstellung durch meinen vergegenwärtigenden Einfluss ‹d. h. durch vergegenwärtigende Bewusstmachung zu einer bleibenden Willensvorstellung›, und sie sagten demgemäß, dass Gottes Werke vollkommen sind. Denn, wäre der Zimmermann vollkommen in seinem Werke, so bedürfte er der Materie nicht; so schnell nämlich, wie er darauf sänne, wäre das Haus ‹auch schon› vollendet. So ‹auch› steht es mit den Werken in Gott: sobald er sie denkt, sind die Werke in einem gegenwärtigen Nun vollbacht. Da kam der fünfte Meister und äußerde sich am besten und sagte: Es gibt da ‹= in Gott› kein Werden, sondern nur ein Nun, ein Werden ohne Werden, ein Neusein ohne Erneuerung, und dieses Werden ist sein ‹= Gottes› Sein.“ (DW II 󰀇󰀂󰀂).

M EISTER E CKHART ,

DIE SCHUOLE , DIE

G RAMMATIK

UND DIE

B IBEL

󰀉󰀁

Eckhart erfasst das Wesen der Debatte in der schuole darin, dass man sich widerspricht, dass die Aussagen überboten werden, dass einige bas (= ‚besser‘) definieren als andere und dass gar einer aller best lehrt. Erkenntnis wird als schulischer Prozess und diskurshaftes Vorgehen greifbar. Eckhart lässt die Debatte der Meister in der Schule für seine Zuhörerschaft lebendig werden. Und so bleibt der Diskurs – trotz aller Schwierigkeiten, die man selbst Quints Übersetzung noch anmerkt – nicht bloß ein gelehrter Diskurs. Eckhart trägt ihn (man sieht dies schon in Predigt 󰀅󰀀 und ihrer Lehre) hinaus und berichtet dem volkssprachlichen Publikum von den Meistern der Schule; aber mehr noch: In Predigt 󰀁󰀆b formuliert Eckhart den Anspruch, solche Debatten nicht auf die Schule zu beschränken, sondern sie vom Predigtstuhl herab überall in der deutschen Predigt zu diskutieren, auch im Frauenkloster: Nû merket mich vil rehte! Waz eigenlîche ein bilde sî, daz sult ir merken an vier stücken, oder vil lîhte wirt ir mêr. Bilde enist sîn selbes niht, noch enist im selber niht; ez ist aleine des, des bilde ez ist, und ist im alzemâle allez, daz ez ist. Daz dem vremde ist, des bilde ez ist, dem enist ez niht, noch enist sîn niht. Bilde nimet aleine sîn wesen âne mittel an dem, des bilde ez ist, und hât éin wesen mit im und ist daz selbe wesen. Diz enist niht gesprochen von den dingen, diu man sol reden in der schuole; sunder man mac sie wol gesprechen ûf dem stuole ze einer lêre.󰀁󰀁 󰀁󰀁. Pr. 󰀁󰀆b (DW I 󰀂󰀇󰀀,󰀁-󰀈); Übersetzung Quints: „Nun hört mir recht genau zu! Was ein Bild im eigentlichen Verstande sei, das sollt ihr an vier Stücken erkennen, vielleicht aber werdenʼs ihrer mehr. Ein Bild ist nicht aus sich selbst noch ist es für sich selbst; es stammt vielmehr von dem, dessen Bild es ist und gehört ihm mit allem, was es ist, zu. Was dem, dessen Bild es ist, fremd ist, dem gehört es nicht zu noch stammt es von ihm. Ein Bild nimmt sein Sein unmittelbar allein von dem, dessen Bild es ist, und hat ein Sein mit ihm und ist dasselbe Sein. Ich habe hiermit nicht von Dingen gesprochen, die man ‹ausschließlich› in der Schule vortragen soll; man kann sie vielmehr recht wohl auch auf dem Predigtstuhl zur Belehrung vortragen.“ (DW I 󰀄󰀉󰀃). Der Hinweis darauf, dass Eckhart Predigt 󰀁󰀆b abermals in einem Kloster gehalten hat, ergibt sich aus folgender Textstelle: „Ir vrâget dicke, wie ir leben sült. Daz sult ir hie merken mit vlîze. Ze glîcher wîs, als hie gesprochen ist von dem bilde, sich, alsus soltû leben. Dû solt sîn sîn und solt im sîn und ensolt dîn niht sîn und ensolt dir niht sîn und ensolt niemannes sîn. Dô ich gester her in diz klôster kam, dô sach ich salbei und ander wurzen ûf einem grabe stân; und dô gedâhte ich: hie liget eines menschen lieber vriunt, und dar umbe hât ez diz ertrîche deste lieber. Swer dâ hât einen rehte lieben vriunt, der hât allez daz liep, daz im zuo gehœret, und swaz sînem vriunde wider ist, des enmac er niht.“ (Pr. 󰀁󰀆b [DW I 󰀂󰀇󰀁,󰀁-󰀈]); Übersetzung Quints: „Ihr fragt oft, wie ihr leben sollt. Das sollt ihr hier mit Fleiß erkennen. Ganz ebenso, wie es hier von dem Bild gesagt wurde, sieh, so sollst du leben. Du sollst aus ihm sein und sollst für ihn ‹= Gott› sein und sollst nicht aus dir sein und sollst nicht für dich sein und sollst niemand zuhören. Als ich gestern hierher in dieses Kloster kam, sah ich Salbei und andere Kräuter auf einem Grabe stehen; und da dachte ich: Hier liegt eines Menschen lieber

󰀉󰀂

F REIMUT L ÖSER

Die weiteren Erwähnungen der schuole zeigen, dass Eckhart auch das ‚Lehrpersonal‘ differenziert, so etwa in der schon erwähnten Predigt 󰀉 mit ihrer Reminiszenz des Pariser Lehrbetriebs, wo auch die schuole zur Rede kommt: Kleine meister lesent in der schuole, daz alliu wesen sîn geteilet in zehen wîse, und die selben sprechent sie gote zemâle abe. Dirre wîsen enberüeret got keiniu, und er enbirt ir ouch keiner. Diu êrste, diu des wesens allermeist hât, dâ alliu dinc wesen inne nement, daz ist substancie, und daz leste, daz des wesens aller minnest treit, daz heizet relatio, daz ist glîch in gote dem aller grœsten, daz des wesens allermeist hât; sie hânt ein glîch bilde in gote. In gote sint aller dinge bilde glîch; aber sie sint unglîcher dinge bilde.󰀁󰀂 Man hat festgestellt, dass mit den kleine[n] meister[n] und den zehen wîse[n] wohl die baccalaurii theologiae und die zehn Seinskategorien des Aristoteles gemeint sind.󰀁󰀃 Während sich die kleine[n] meister in Lehre und Unterricht damit zu befassen haben, gehen die ‚großen‘ Gelehrten in Eckarts Predigt 󰀆󰀈 anderen Fragen nach: Die meister hânt grôze vrâgen in der schuole, wie daz mügelich werde der sêle, daz si got bekennen müge? Ez enist niht von gotes gerehticheit noch strengicheit, daz er vil heischet von dem menschen; ez ist von sîner grôzen milticheit, daz er wil, daz sich diu sêle wîte, daz si vil enpfâhen müge, daz er ir vil geben müge.󰀁󰀄 In Predigt 󰀂󰀂, die Eckhart im Zisterzienserinnenkloster St. Mariengarten in Köln gehalten und in der er, wie gesehen, auch an den Unterricht der Freund, und deshalb hat er diesen Erdenfleck umso lieber. Wer einen recht lieben Freund hat, der hat alles das lieb, was jenem zugehört, und was seinem Freunde zuwider ist, das mag er nicht.“ (DW I 󰀄󰀉󰀄). 󰀁󰀂. Pr. 󰀉 (DW I 󰀁󰀄󰀇,󰀃-󰀁󰀄󰀈,󰀂); Übersetzung Quints: „Kleine Meister lehren in der Schule, alle Wesen seien geteilt in zehn Seinsweisen, und diese sprechen sie sämtlich Gott ab. Keine dieser Seinsweisen berührt Gott, aber er ermangelt auch keiner von ihnen. Die erste, die am meisten Sein besitzt, in der alle Dinge ihr Sein empfangen, das ist die Substanz; und die letzte, die am allerwenigsten Sein enthält, die heißt Relation, und die ist in Gott dem Allergrößten, das am meisten Sein besitzt, gleich: sie haben ein gleiches Urbild in Gott. In Gott sind aller Dinge Urbilder gleich; aber sie sind ungleicher Dinge Urbilder.“ (DW I 󰀄󰀆󰀃). 󰀁󰀃. Quint (DW I 󰀁󰀄󰀇, Anm. 󰀃 und 󰀄). 󰀁󰀄. Pr. 󰀆󰀈 (DW III 󰀁󰀅󰀁,󰀄-󰀇); Übersetzung Quints: „Die Meister werfen bedeutsame Fragen in der Schule darüber auf, wie es für die Seele möglich werde, dass sie Gott erkennen könne. Es kommt nicht von Gottes Gerechtigkeit noch von ‹seiner› Strenge, dass er viel heischt vom Menschen; es kommt von seiner großen Gebefreudigkeit, wenn er will, dass die Seele sich weite; auf dass sie viel empfangen, damit er ihr viel geben könne.“ (DW III 󰀅󰀃󰀃).

M EISTER E CKHART ,

DIE SCHUOLE , DIE

G RAMMATIK

UND DIE

B IBEL

󰀉󰀃

schuole erinnert hat, macht er sogar darauf aufmerksam, dass sich eine der Debatten über die ‚großen‘ Fragen unter den ‚großen‘ Gelehrten am Vortag abgespielt hat: Ein vrâge was gester in der schuole under grôzen pfaffen. ‚Mich wundert‘, sprach ich, ‚daz diu geschrift alsô vol ist, daz nieman daz allerminste wort ergründen enkan‘, und vrâget ir mich, wan ich ein einiger sun bin, den der himelische vater êwiclîche geborn hât, ob ich dan êwiclîche in gote sun sî gewesen, sô spriche ich: jâ und nein; jâ, ein sun nâch dem, daz der vater mich êwiclîche geborn hât, und niht sun nâch der ungebornheit.󰀁󰀅 Auch hier findet sich also die Problematik wieder, die Eckhart gerade im Rückbezug auf seine Zeit in Paris mehrfach angedeutet hat, dass nämlich die Meister der Schule die Tiefe der Schrift nicht ergründen können. Der Bezug des Wortgebrauchs (ergründen) und die Bedeutung der Exegese allgemein ergeben sich dabei aus einer Allegorie, die Eckhart in Predigt 󰀅󰀁 prägt: Es spricht mein herre sant Gregorius: „Was das lamb ergründet, da schwimmet der ochß oder die ků, vnd da die ků schwimmet, da fürlaufft sy der helffant vnnd gat im für sein haupt“. Diß ist gar ein schoͤner synn; man mag wol gar vil daruß ziehen. Es spricht mein herr sant Augustin, Das die geschrifft sey ein tieffes moͤr; vnd ein kleines lemblein bedeüttet einen demuetigen, einfaltigen menschen, der die geschrifft mag ergründen. Aber bey dem ochsen, der da schwimpt, da bey so versteen ‹wir› grobe leüt: Ein yegklicher nympt daruß, das jn benueget. Aber bey dem helffant, der da fürlaufft, da bey ist vns gegeben zů versteen die vernünfftigen leüt, die durch grabent die geschrifft vnnd fürlauffent darinn. Mich wundert, daz die heilig geschrifft so voll ist, vnnd die meyster sprechent, das man sey nit bedeütten moͤg also bloß, als sy ist, Vnnd sprechent, ob icht grobes darinne sey, das soll man auff thůn; aber man bedarff dar zů gleichnuß.󰀁󰀆 󰀁󰀅. Pr. 󰀂󰀂 (DW I 󰀃󰀈󰀁,󰀃-󰀃󰀈󰀂,󰀂); Übersetzung Quints: „Gestern gings in der Schule unter großen Theologen um eine Frage: „Mich wundert“, sagte ich, „dass die Schrift so gehaltvoll ist und doch niemand das allermindeste Wort ‹darin› ergründen kann.“ Und fragt ihr mich, da ich ein einiger Sohn bin, den der himmlische Vater ewig geboren hat, ob ich denn ‹auch› ewiglich in Gott Sohn gewesen sei, so antworte ich: ja und nein; ja – als Sohn demgemäß, dass der Vater mich ewiglich geboren hat, nicht aber Sohn gemäß der Ungeborenheit.“ (DW I 󰀅󰀁󰀈). 󰀁󰀆. Pr. 󰀅󰀁 (DW II 󰀄󰀆󰀅,󰀁-󰀄󰀆󰀆,󰀅); Übersetzung Quints: „Der Herr Sankt Gregorius sagt: „Wo das Lamm auf den Grund gelangt, da schwimmt der Ochs oder die Kuh, und wo die Kuh schwimmt, da überläuft sie der Elefant, und es ‹= das Wasser› geht ihm bis über den Kopf.“ Das enthält einen

󰀉󰀄

F REIMUT L ÖSER

Die Stelle wäre eine ausführliche eigene Interpretation wert. Im Zusammenhang dieses Beitrags soll zunächst die Feststellung genügen, dass die Ergründung der Schrift nicht per se an Meisterschaft gebunden ist, sondern (mit Augustins Beispiel) dem demuetigen, einfaltigen menschen (= lemblein) und den vernunfftigen (= Elefanten!) gegeben ist, die die Schrift durch grabent. Die groben leüte, die mit ochsen verglichen werden, sind in einem vergleichbaren Beispiel aus der Predigt Pfeiffer 󰀁󰀀󰀇󰀁󰀇 gerade die meister, die als Kühe und Pferde gekennzeichnet werden, die bei der Schriftauslegung ‚ins Schwimmen geraten‘. Aber bevor auf die Frage der Schriftexegese und die Bedeutung der Grammatik dabei einzugehen ist, sollen die Beobachtung zu Eckharts ‚Schul-Konzept‘ kurz zusammengefasst werden: Die schuole (unter der die Universität, die theologische Hohe Schule, und die gelehrte Ausbildung allgemein zu verstehen ist) ist für Eckhart kein hermetisch abgeschlossener – oder gar bevorzugter – Bereich. Dies ist gar schönen Sinn; man kann gar viel daraus entnehmen. Der Herr Sankt Augustinus sagt, die Schrift sei ein tiefes Meer. Das kleine Lämmlein aber bedeutet einen demütigen, einfältigen Menschen, der in der Schrift Grund zu fassen vermag. Unter dem Ochsen aber, der darin schwimmt, verstehen wir grobsinnige Menschen: ein jeglicher ‹von ihnen› entnimmt daraus, was ihm genügt. Aber unter dem Elefanten, der darin weiterläuft, sollen wir die vernünftigen Leute verstehen, die die Schrift durchwühlen und darin weiter vordringen. Mich wundertʼs, dass die Heilige Schrift so gehaltvoll ist und die Meister sagen, dass man sie ihrem unverhüllten Sinn nach nicht auszudeuten vermöge, und sie sagen: Wenn etwas Grob-Sinniges darin sei, so müsse man es aufschließen; aber dazu bedarf man des Gleichnisses.“ (DW II 󰀇󰀂󰀃). 󰀁󰀇. zw ainn tzeiten ward ich in der schuel zw paris gefragt, wie man dy geschrifft alle erfüllen müg. Da antwurt ich vnd sprach: „wer dy geschrifft erfüllen will, der sol sich also halten, das er gots in seiner sel nymer vermizz; so ist dann in im aws plüeund das vaͤterleich wart.“ Vnd han das dar vmb gesagt, das vil menschen dy geschrifft gar hart versten, so man sy predigt vnd sagt. […] wann ir ist vil vnter vns maistern, dy die geschrifft dreissig Jar oder mer nw gevͤbt haben vnd versten sy dannoch in ainung als wenig als ein chue oder ein ros. (= Pfeiffer, S. 󰀃󰀅󰀂,󰀂󰀇-󰀃󰀃 und 󰀃󰀅󰀃,󰀂󰀆-󰀂󰀉). […] Ich ward ainsten in der schuel zw paris gefragt, ob dy sel ein natürleiche chrafft hiet, mit der sy sich möcht vnterschaiden von aller creatur. Da sprach ich ia vnd nayn. (= Pfeiffer, S. 󰀃󰀅󰀄,󰀁󰀇-󰀁󰀉). Zitiert nicht nach Pfeiffers Edition, sondern nach der Handschrift, Melk, Stiftsbibliothek, cod. 󰀁󰀈󰀆󰀅, f. 󰀁󰀂󰀁ra-󰀁󰀂󰀄va. Eine detailliertere Echtheits-Untersuchung aller Teile des Textes und dessen kritische Edition stehen noch aus. Dazu Freimut Löser, Meister Eckhart in Melk. Studien zum Redaktor Lienhart Peuger. Mit einer Edition des Traktates Von der sel wirdichait vnd aigenschaft, Texte und Textgeschichte 󰀄󰀈 (Tübingen, 󰀁󰀉󰀉󰀉), 󰀁󰀉󰀂. Meine Übersetzung: „Zu einer bestimmten Zeit wurde ich in der Schule zu Paris gefragt, wie man die Schrift ganz erfüllen könne. Da antwortete ich, indem ich sagte: ›Wer die Schrift erfüllen will, der soll sich so halten, dass er in seiner Seele Gott niemals vermisst, so treibt in ihm das väterliche Wort Blüten aus.‹ Und das habe ich deshalb gesagt, weil viele Menschen die Schrift sehr schwer verstehen, wenn man sie predigt und vorträgt. […] denn es gibt viele unter uns Meistern, die sich 󰀃󰀀 Jahre oder länger in der Schrift geübt haben und verstehen sie in Bezug auf die Einheit so wenig wie eine Kuh oder ein Pferd. […] Ich wurde einst in der Schule zu Paris gefragt, ob die Seele eine natürliche Kraft hätte, mit der sie sich von allen Geschöpfen unterscheiden könnte. Da antwortete ich ›Ja und Nein‹.“

M EISTER E CKHART ,

DIE SCHUOLE , DIE

G RAMMATIK

UND DIE

B IBEL

󰀉󰀅

in zweierlei Hinsicht von Bedeutung. Denn zum ersten ließ sich zeigen, dass Eckhart, wenn er die Universität Paris nennt, schlicht das Wort Paris, seltener schuole, verwendet. Wenn er von schuole spricht, tut er dies häufig gerade in Kölner Predigten aus seinen späten Jahren. Ein möglicher Bezug auf Erfurt lässt sich vorderhand aber nicht ausschließen. Dies ist in einer zweiten Hinsicht durchaus bedeutungsvoll, denn für die Erfurter schuolen und deren Stand vor der 󰀁󰀃󰀉󰀂 eröffneten Universität Erfurt hat Sönke Lorenz das Studium generale Erfordense ausführlich beschrieben und dies von den Studien der vier großen Bettelorden in Erfurt klar abgegrenzt: „Das Studium generale, um das es hier geht, stand einem Kreis von Personen offen, den Scholaren bzw. Studenten, die aus allen Himmelsrichtungen nach Erfurt kamen, ‹ad studium›. Spätestens von dem Augenblick an, da sie an den Lehrveranstaltungen teilnahmen, kamen sie in den Genuss des ‹privilegium clericale› und galten als Kleriker, als Weltgeistliche. Die Studia der Mendikanten hingegen waren in erster Linie für die bei diesen Orden äußerst hoch veranschlagte Ausbildung der eigenen Mönche bestimmt, auch wenn möglicherweise Weltgeistliche und Laien an den Lehrveranstaltungen teilnehmen durften. Zwischen diesen beiden sehr verschiedenen Typen von Bildungseinrichtungen bestand auch eine scharfe organisatorische Trennung, das Erfurter Studium generale umspannte nur die Schulen des Marien-, Severiund Reglerstiftes sowie des Schottenklosters und vielleicht zeitweilig auch des Petersklosters. Aber nach einer anderen Seite hin wird man mit einem Einfluss der Mendikantenstudien auf das Erfurter Schulleben rechnen müssen, und zwar im wissenschaftlichen Bereich. Lehrer wie der Franziskaner Johannes de Erfordia, der Dominikaner Meister Eckhart sowie die Augustinereremiten Heinrich von Friemar d. Ä. und Hermann von Schildesche werden wohl nicht ganz ohne Ausstrahlung auf das geistige Leben in der Stadt geblieben sein.“󰀁󰀈 Lorenzʼ Vermutung trifft auf Eckhart, wie man jetzt sieht, zumindest zu, wenigstens entspricht es eben durchaus Eckharts Auffassung, die Welt der Ausbildung ‚seiner‘ Dominikaner nicht im strikten Sinn geschlossen zu halten, sondern durchlässig zu gestalten.󰀁󰀉 󰀁󰀈. Sönke Lorenz, Studium Generale Erfordense. Zum Erfurter Schulleben im 󰀁󰀃. und 󰀁󰀄. Jahrhundert (Stuttgart, 󰀁󰀉󰀈󰀉), XV. 󰀁󰀉. Dass es sogar ‚wissenschaftliche Querverbindungen‘ gab, kann Lorenz für einen späteren Zeitpunkt nachweisen, „wenn 󰀁󰀃󰀅󰀉 oder kurz vorher der Cursor am Erfurter Dominikaner-Studium,

󰀉󰀆

F REIMUT L ÖSER

Die Erkenntnise der schuole müssen in Eckharts Sicht weiter vermittelt werden, denn die wahre Schule Christi ist die des Lebens außerhalb der schuole. Die großen Fragen der großen Gelehrten in der schuole kreisen dabei um einen Punkt: Wie ist es der Seele möglich, daz si got bekennen müge. Und wie geht man damit um, dass die Heilige Schrift so voll ist, dass man sie nit bedeütten moͤg also bloß, als sy ist. Dabei ist bemerkenswert, dass die Überfülle der Schrift sich nicht aus der Quantität in der Breite ergibt, sondern dass sie so voll ist, dass niemand das allerkleinste Wort ergründen kann. Der Weg Eckharts zur Ergründung der Schrift führt nicht über die Theorie der schuole, sondern über die vernunft, über Demut und Einfalt. Und in einem Band über Eckhart und Thomas von Erfurt könnte es von Belang sein, dass es bei der Ergründung der Schrift für Eckhart um daz allerminste wort geht und die Frage, wie man, obwohl man einer gleichnuß bedarf, dazu durchdringen kann, die Schrift zu bedeütten, also bloß als sy ist. Man wird annehmen müssen, dass Eckhart der Gedanke der wort-Genauigkeit nicht fremd war. II. Exegese und Grammatik Der Grammatikunterricht in der schuole wird – ähnlich wie die Beschäftigung der kleinen meister mit den Seinskategorien des Aristoteles – in Eckharts Werken als solcher letztlich nur einmal erwähnt.󰀂󰀀 Im Erfurter ‚Schulleben‘ spielt er eine zentrale Rolle. So hat Lorenz auf der Basis eigener Untersuchungen und wegweisender Studien anderer „ein Bild gewonnen“, das „die Bedeutung des Erfurter Schullebens vor 󰀁󰀃󰀀󰀀 durch den Grammatikunterricht zeigt“.󰀂󰀁 Aber anders als die philosophischen und theologischen Autoritäten werden die – zeitgenössischen – Autoritäten oder Theoretiker der Grammatik, auch die Modisten, bei Eckhart nicht erwähnt (zu suchen wäre nach Boethius de Dacia, Johannes Dacus, Simon Dacus, Michael von Marbois, Siger von Courtrai, besonders nach Thomas von Erfurt oder in diesem Zusammenhang auch Johannes Duns Scotus, dem Thomasʼ Traktat ‚Novi modi significandi‘ noch in der Johannes von Stendal, auf Bitte der Erfurter Magister und Studenten eine Vorlesung über die Einführung des al-Quabisi in der Astrologie hält“ (S. Lorenz, Studium Generale Erfordense [󰀁󰀉󰀈󰀉], XV-VI). 󰀂󰀀. Pr. 󰀉 (DW I 󰀁󰀅󰀄,󰀇-󰀈) siehe dazu unten. 󰀂󰀁. S. Lorenz, Studium Generale Erfordense (󰀁󰀉󰀈󰀉), 󰀇󰀅.

M EISTER E CKHART ,

DIE SCHUOLE , DIE

G RAMMATIK

UND DIE

B IBEL

󰀉󰀇

Neuzeit zugeschrieben wurde, nach Rudolphus Brito, dem Thomas in der grammatischen Doktrin folgt, oder nach Martinus de Dacia, als dessen Gegenstück sich Thomasʼ Traktat präsentiert󰀂󰀂). Aber wenn Eckhart, wie oben gesehen, die meister von Paris zitiert, dann eben nicht die Mitglieder der Artistenfakultät. In der Debatte um Thomas von Erfurt und um die modistische Grammatik hat Eckhart nie Stellung bezogen. Dabei steht außer Frage, dass Eckhart schon von seiner eigenen Ausbildung her mit der Auffassung der Modisten vertraut gewesen sein muss. G. L. Bursill-Hall hat über Thomas von Erfurt bemerkt: „His teaching may, for all we know, have been created in a climate of opinion in Erfurt in which grammatical speculation could prosper.“󰀂󰀃 Das ist u. a. durch Bursill-Hall selbst, zahlreiche Arbeiten Jan Pinborgs und Lorenzʼ belegt. Die präzise Zusammenfassung durch Lorenz trifft den Kern der Sache, wenn er zeigt, „wie sehr […] Erfurt zum Zentrum einer modistischen Sprachwissenschaft geworden“󰀂󰀄 ist: „Mit Thomas wird erstmals im Erfurter Schulleben ein Repräsentant des neuesten Forschungs- und Erkentnisstandes einer Wissenschaft fassbar. Mit ihm bewegte sich der Grammatikunterricht in Erfurt auf der Höhe der Zeit, auf einem Niveau, zu dem gerade erst eben eine in ihrer letzten Phase fast stürmisch zu nennende Entwicklung geführt hatte, auf das engste mit dem Pariser Studienbetrieb verknüpft. Nach Pinborg war es Thomasʼ Ziel, unter Einbeziehung der Errungenschaften späterer Modisten ein Gegenstück zu den Modi significandi des Martinus de Dacia zu schreiben, ‹eine Übersicht per modum tractatus, die als Lehrbuch bei seinem Unterricht in Erfurt verwendet werden sollte›. Das Ergebnis war eine vorzügliche Darstellung, die klar und übersichtlich eine gute Einführung in die Problematik der modistischen Grammatik bietet. Die ‹Novi modi significandi› wurden das am weitesten verbreitete Lehrbuch der Modisten in ganz Mitteleuropa. Die handschriftliche Überlieferung legt den Schluss nahe, dass dieses Werk nicht von Paris, sondern 󰀂󰀂. Vgl. zu dieser Reihe: Michael Stolz, ʻTumʼ-Studien. Zur dichterischen Gestaltung im Marienpreis Heinrichs von Mügeln (Tübingen und Basel, 󰀁󰀉󰀉󰀆), Kap. 󰀆.󰀃. Spekulative Grammatik, bes. 󰀄󰀀󰀉-󰀁󰀀 mit Anm. 󰀁󰀄󰀂󰀁; dort weitere Literaturangaben. 󰀂󰀃. G.L. Bursill-Hall, Thomas of Erfurt. Grammatica speculativa. An edition with translation and commentary (London, 󰀁󰀉󰀇󰀂), 󰀂󰀈. 󰀂󰀄. S. Lorenz, Studium Generale Erfordense (󰀁󰀉󰀈󰀉), 󰀇󰀉.

󰀉󰀈

F REIMUT L ÖSER

von Erfurt aus seinen Siegeszug angetreten hat, wie denn auch Thomasʼ Beinamen ‹de Erfordia› nicht auf den Ort seiner Herkunft, sondern auf sein Wirkungsfeld hinzuweisen scheint. Auf alle Fälle haben die ‹Novi modi significandi›, wie die modistische Wissenschaft überhaupt, im Erfurter Schulleben eine bedeutende Rolle gespielt.“󰀂󰀅 Wenn man wissen will, ob und wie sich bei Eckhart diese Bedeutung spiegelt, könnte (und müsste) man seine sprach- und zeichentheoretischen Ansätze klären und mit Thomas vergleichen, indem man etwa fragt, wie in den Beispielen, die Eckhart verwendet, die ratio consignificandi, mithin die „Relation zwischen Bezeichnungsweise (modus significandi) und Seinsweisen (proprietas rei, modus essendi)“ definiert wird und ob und wie sie der modistischen Auffassung (und deren drittem modus intelligendi) entspricht.󰀂󰀆 Man könnte auch, was wohl schwierig sein dürfte, ermitteln, ob Eckhart mit der für Thomasʼ charakteristischen Auffassung der Wortklassen konform geht.󰀂󰀇 Hier soll zunächst ein anderer Weg gewählt werden. In der Annahme, dass sich Eckharts Auffassung der Grammatik und speziell der modi significandi auch dort besonders zeigt, wo er besonders bewusst mit Sprache umgeht und wo dieser Umgang durch mögliche Vergleiche evident wird, wird seine Schriftauslegung und hier besonders die Art seiner gleichzeitigen Übersetzung der Schrift kurz und an wenigen Einzelbeispielen diskutiert. Dass die Exegese dabei auch in besonderer Nähe zur schuole steht, hat sich ja bereits gezeigt. Ich hatte 󰀂󰀀󰀀󰀄 zugespitzt formuliert, „dass es sich nahezu bei dem gesamten erhaltenen Werk Eckharts um ‚Schriftauslegung‘ handelt. [...] Der Prediger erklärt die Schrift. Diese Sicht verdient deshalb hervorgehoben zu werden, weil sie bei der heute so kontrovers geführten Debatte, ob Eckhart ‚Mystiker‘ oder ‚Philosoph‘ war, generell zu kurz zu kommen droht. Eckhart war Prediger (als Mitglied des Predigerordens sogar in zweifacher Hinsicht) und Exponent der Heiligen Schrift (auch dies in doppelter Bedeutung).“󰀂󰀈 󰀂󰀅. Ibid. 󰀇󰀇-󰀈. 󰀂󰀆. Vgl. M. Stolz, ʻTumʼ-Studien (󰀁󰀉󰀉󰀆), 󰀄󰀁󰀁 und dessen Vergleich zwischen Mügeln und Thomas von Erfurt. 󰀂󰀇. Vgl. wiederum für Thomas und Heinrich von Mügeln: M. Stolz, ʻTumʼ-Studien (󰀁󰀉󰀉󰀆), 󰀄󰀂󰀀-󰀂. 󰀂󰀈. Freimut Löser, ,Lateinische Bibel und volkssprachliche Predigt. Meister Eckhart als Übersetzer von Bibelstellen‘, in Ralf Plate und Andrea Rapp (Hgg.), Metamorphosen der Bibel. Beiträge zur

M EISTER E CKHART ,

DIE SCHUOLE , DIE

G RAMMATIK

UND DIE

B IBEL

󰀉󰀉

Meister Eckharts exegetische Methode und seine Schriftauslegung war Ziel einzelner Untersuchungen vor allem von Konrad Weiss󰀂󰀉, Josef Koch 󰀃󰀀, Eberhard Winkler 󰀃󰀁, Frank Tobin 󰀃󰀂, Susanne Köbele 󰀃󰀃 und zuletzt, soweit ich sehe, Martina Roesner󰀃󰀄. Von Ausnahmen bei Tobin und Köbele abgesehen hat allerdings das deutsche Werk dabei nur eingeschränkte Berücksichtigung gefunden. Insbesondere die Übersetzungsproblematik zwischen Latein und Deutsch spielt keine zentrale Rolle (mit einer Ausnahme bei Köbele). Das könnte mit einer frühen Festlegung der Forschung zu tun haben: Die Monographie zu Eckharts exegetischen Methoden (Winklers Buch von 󰀁󰀉󰀆󰀅) formuliert als Verdikt: „Die deutschen Predigten zeigen uns in hervorragender Weise den Mystiker Eckhart; von seinem exegetischen Können lassen sie wenig spüren.“󰀃󰀅 Dass Eckharts Exegese aber grundsätzlich eine Übersetzungsproblematik aufweist und dass sich Eckhart dessen sehr bewusst ist, habe ich 󰀂󰀀󰀀󰀄 klarzustellen versucht.󰀃󰀆 Zu vergleichbaren Ergebnissen kam mit anderen Methoden und Beispielen Nadia Bray nur ein Jahr später.󰀃󰀇 Tagung ʽWirkungsgeschichte der Bibel im deutschsprachigen Mittelalterʼ vom 󰀄. bis 󰀆. September 󰀂󰀀󰀀󰀀 in der Bibliothek des Bischöflichen Priesterseminars Trier, Vestigia Bibliae 󰀂󰀃/󰀂󰀅 (Bern u. a., 󰀂󰀀󰀀󰀄), 󰀂󰀀󰀉-󰀂󰀇; vgl. diesen Beitrag in manchem ausführlicher und mit anderer Zielsetzung auch zum Folgenden. 󰀂󰀉. Konrad Weiss, ,Meister Eckharts biblische Hermeneutik‘, in La Mystique rhénane. Colloque de Strasbourg 󰀁󰀆-󰀁󰀉 mai 󰀁󰀉󰀆󰀁 (Paris, 󰀁󰀉󰀆󰀃), 󰀉󰀅-󰀁󰀀󰀉. 󰀃󰀀. Josef Koch, ,Sinn und Struktur der Schriftauslegungen Meister Eckharts‘, in Udo Nix OP und Raphael Öchslin OP (Hgg.), Meister Eckhart, der Prediger. Festschrift zum Eckhart-Gedenkjahr (Freiburg i. Br. u. a., 󰀁󰀉󰀆󰀀), 󰀇󰀃-󰀁󰀀󰀃, wieder in Josef Koch, Kleinere Schriften, 󰀂 Bde., Storia e Letteratura 󰀁󰀂󰀇 (Rom, 󰀁󰀉󰀇󰀃), Bd. 󰀁, 󰀃󰀉󰀉-󰀄󰀂󰀈 (zit.). 󰀃󰀁. Eberhard Winkler, Exegetische Methoden bei Meister Eckhart, Beiträge zur Geschichte der biblischen Hermeneutik 󰀆 (Tübingen, 󰀁󰀉󰀆󰀅); id., ,Wort Gottes und Hermeneutik bei Meister Eckhart‘, in Udo Kern (Hg.), Freiheit und Gelassenheit. Meister Eckhart heute (München, 󰀁󰀉󰀈󰀀), 󰀁󰀆󰀂-󰀈󰀂. 󰀃󰀂. Frank Tobin, ,Creativity and Interpreting Scripture: Meister Eckhart in Practice‘, Monatshefte für deutschen Unterricht, deutsche Sprache und deutsche Literatur 󰀇󰀄 (󰀁󰀉󰀈󰀂), 󰀄󰀁󰀀-󰀈. 󰀃󰀃. Susanne Köbele, ,Primo aspectu monstruosa. Schriftauslegung bei Meister Eckhart‘, Zeitschrift für deutsches Altertum und deutsche Literatur 󰀁󰀂󰀂 (󰀁󰀉󰀉󰀃), 󰀆󰀂-󰀈󰀁; vgl. ibid. 󰀁󰀁󰀀-󰀄, Rezension zu LW [Anm. 󰀁]. Bd. 󰀂. Heribert Fischer, Josef Koch, und Konrad Weiss (Hgg.) (Stuttgart u. a., 󰀁󰀉󰀉󰀂). 󰀃󰀄. Martina Roesner, ,Im Netz der Wahrheit. Meister Eckharts an-archisches Textverständnis als hermeneutisches Grundprinzip seiner Schriftauslegung‘, in Christine Büchner und Freimut Löser (Hgg.), Meister Eckhart und die Freiheit, Meister-Eckhart-Jahrbuch 󰀁󰀂 (Stuttgart, 󰀂󰀀󰀁󰀈), 󰀂󰀂󰀅-󰀄󰀅. 󰀃󰀅. E. Winkler, Exegetische Methoden (󰀁󰀉󰀆󰀅), 󰀁󰀁󰀃. 󰀃󰀆. F. Löser, ,Lateinische Bibel‘ (󰀂󰀀󰀀󰀄). 󰀃󰀇. Nadia Bray, ,Deutsche Bibelzitate in den Predigten Meister Eckharts‘, in Andreas Speer und Lydia Wegener (Hgg.), Meister Eckhart in Erfurt, Miscellanea Mediaevalia 󰀃󰀂 (Berlin und New York NY, 󰀂󰀀󰀀󰀅), 󰀄󰀀󰀉-󰀂󰀆.

󰀁󰀀󰀀

F REIMUT L ÖSER

Eckhart weist zu Beginn seiner deutschen Predigt a) auf den liturgischen Bezug und b) auf die lateinische Sprachgestalt hin: Ich hân ein wörtelîn gesprochen in dem latîne, daz liset man hiute in der epistel [...] (Pr. 󰀁󰀆b, DW I 󰀂󰀆󰀃,󰀂-󰀃). Ich hân ein wort in latîne gesprochen, daz sprichet unser herre in sînem êwangeliô [...] (Pr. 󰀁󰀇, DW I 󰀂󰀈󰀁,󰀂-󰀃). So lauten zwei für Eckhart typische Predigt-Anfänge. Beachtenswert erscheint hier die Verbindung mit der Liturgie, sichtbar an Formulierungen der Predigtanfänge, wie diesen: Disiu wort, diu ich gesprochen hân in der latîne, diu liset man von der hôchzît in der messe [...]󰀃󰀈; Ich hân ein wort gesprochen in der latîne, daz sprichet sant Paulus in der epistel.󰀃󰀉 Mir scheint es aber auch höchst bemerkenswert, dass in mehr als der Hälfte der von mir ausführlich und systematisch untersuchten ersten 󰀃󰀀 Predigten der Quintʼschen Edition Eckharts nicht nur der liturgische Bezug klargestellt, sondern auch das Sprachproblem thematisiert wird. Dem Verhältnis von Latein und Deutsch bei Meister Eckhart hat sich die Forschung gewidmet.󰀄󰀀 Die Tatsache, dass dieses Sprachproblem zu Beginn von Eckharts deutschen Predigten aber regelhaft die lateinische Form der Lectio und deren sprachliche Wiedergabe im Deutschen betrifft, ist meines Wissens bisher nicht systematisch analysiert worden. Dabei erwähnt Eckhart nicht nur in den schon genannten Fällen ausdrücklich, dass das Bibelwort in lateinischer Sprache verlesen wurde. Seine Hinweise auf den zweisprachigen Charakter greifen den lateinisch verlesenen Text auf und leiten gleichzeitig eine deutsche Übersetzung ein. Eckhart bringt die Tatsache, dass sein Bibeltext ein Übersetzungstext ist, oft zur Sprache: Diz wort, daz ich gesprochen hân in latîne, daz ist ge s c h r ib e n in der epistel [...] und sp richet daz wort ze tiutsche alsô [...] (Pr. 󰀁󰀀, DW I 󰀁󰀆󰀁,󰀂-󰀄). Diz wort, daz ich gesprochen hân in latîne, daz stât ge s c h r ib e n in dem heiligen êwangeliô und sprichet als vil ze tiutsche [...] (Pr. 󰀂󰀂, DW I 󰀃󰀇󰀅,󰀂-󰀃). Ich hân ein wörtelîn gesprochen des êrsten in dem latîne, daz stât geschriben in dem êwangeliô und sprichet alsô ze tiutsche [...] (Pr. 󰀂, DW I 󰀂󰀄,󰀃-󰀄).

󰀃󰀈. Pr. 󰀂󰀉 (DW II 󰀇󰀃,󰀂-󰀃). 󰀃󰀉. Pr. 󰀂󰀁 (DW I 󰀃󰀅󰀇,󰀂-󰀃). 󰀄󰀀. Siehe z. B. Burkhard Hasebrink, ,Grenzverschiebung. Zu Kongruenz und Differenz von Latein und Deutsch bei Meister Eckhart‘, Zeitschrift für Deutsches Altertum und deutsche Literatur 󰀁󰀂󰀁 (󰀁󰀉󰀉󰀂), 󰀃󰀆󰀉-󰀉󰀈.

M EISTER E CKHART ,

DIE SCHUOLE , DIE

G RAMMATIK

UND DIE

B IBEL

󰀁󰀀󰀁

Auffällig daran ist nicht nur die Übersetzung von einer Sprache in die andere, sondern auch der transitorische Charakter zwischen schriftlich fixiertem lateinischem Bibeltext und der Oralität der Predigtsituation: Eckhart betont zu Beginn seiner Predigten, dass die Evangelien- oder Episteltexte während der Messe zunächst (des êrsten) lateinisch verlesen wurden: Das Schriftwort wurde zu Beginn (des êrsten) lateinisch g e s p r o c h e n (verlesen), steht aber an sich geschrieben; es wird dann in der aktuellen Predigtsituation als erstes direkt in die deutsche Sprache gebracht. Unter dem Gesichtspunkt von Schriftlichkeit und Mündlichkeit ist auch hervorzuheben, dass Eckhart, indem er darauf hinweist, das lateinisch verlesene Wort stehe geschriben, von einer schriftlich fixierten lateinischen Vorlage ausgeht. Zu Beginn der Predigt wird vor dem Predigtpublikum das herausgegriffene geschriebene Bibelwort stets zunächst vorgelesen und erst dann als Textgrundlage der Predigt übersetzt. Es ist mithin die erste Aufgabe des Predigers, den lateinischen Bibeltext ins Deutsche zu transponieren. Das ist an sich nicht überraschend, verdient aber die Aufmerksamkeit der Forschung mehr als bisher. Denn es bedeutet, Eckhart verfügte nicht über eine fertige, fixierte deutsche Übersetzung der Perikopen, die er mit dem Publikum jedes Mal hätte teilen können und nur hätte vorlesen müssen; er übersetzt vielmehr die einzelnen lateinischen Stellen, die seiner Auslegung in der Predigt zugrundeliegen, ad hoc jeweils neu – und in verschiedenen Predigten zum selben Schrifttext übrigens durchaus unterschiedlich.󰀄󰀁 Eckharts Verfahren schwankt bei diesen Übersetzungen zwischen einer teilweisen sehr genauen Wörtlichkeit und scheinbar großen Freiheiten (und dies sowohl bei seinem Textauswahlverfahren wie bei der Übertragung einzelner Lexeme oder in der Syntax).󰀄󰀂 Dass übersetzerische ‚Freiheiten‘ dabei auf Eckharts exegetischen Willen deuten und dass er damit auf den Textkern zielt, wie er ihn sieht, liegt auf der Hand, etwa wenn Eckhart in Predigt 󰀆 das Wort des Apostels Paulus 󰀂Cor 󰀃:󰀁󰀈 aufgreift. In eandem imaginem transformamur wird wiedergegeben als: Wir werden alzemâle transformieret in got und verwandelt.󰀄󰀃 Bei Eckhart werden wir nicht nur (wie später in Luthers Übersetzung) 󰀄󰀁. Vgl. F. Löser, ,Lateinische Bibel‘ (󰀂󰀀󰀀󰀄), 󰀂󰀁󰀈; zu einem ähnlichen Ergebnis gelangt auch N. Bray, ,Deutsche Bibelzitate‘ (󰀂󰀀󰀀󰀅). 󰀄󰀂. Vgl. F. Löser, ,Lateinische Bibel‘ (󰀂󰀀󰀀󰀄), 󰀂󰀁󰀈, 󰀂󰀁󰀉, 󰀂󰀂󰀁-󰀂 und N. Bray, ,Deutsche Bibelzitate‘ (󰀂󰀀󰀀󰀅), 󰀄󰀁󰀆-󰀇. 󰀄󰀃. Pr. 󰀆 (DW I 󰀁󰀁󰀀,󰀈).

󰀁󰀀󰀂

F REIMUT L ÖSER

verkleret in dasselbige Bilde, sondern wir werden eben i n G o tt s e l b s t transformieret und verwandelt. Konsequent ist dann auch in derselben Predigt die Wiedergabe von 󰀁Io 󰀃:󰀂. Im Johannesbrief heißt es: similes ei erimus; quoniam videbimus eum sicuti est. Eckhart verändert zu: Alsô werden wir in got verwandelt, daz wir in bekennen suln, als er ist. (Pr. 󰀆, DW I 󰀁󰀁󰀅,󰀁-󰀂). Eckhart zielt hier mit seiner Bibelexegese auf den Kern seiner Lehre. Seine Übersetzung ist seinem Konzept der Einheit geschuldet: Wir sind nicht nur in Gottes imago, sondern in Gott selbst verwandelt; wir sind nicht nur similes Gottes, sondern in ihn selbst transformiert. Hier sollen sechs kurze Beispiele vorgestellt werden, in denen aus der Übersetzung heraus (und aus der Benutzung der „Übersetzungsgrammatik“ gewissermaßen) ein für Eckhart charakteristischer exegetischer Funke geschlagen wird:󰀄󰀄 󰀁. Das erste Beispiel, der Beginn von Predigt 󰀇, lautet so: Populi eius qui in te est, misereberis. Der prophête sprichet: ›herre, des volkes, daz in dir ist, des erbarme dich‹ [Os 󰀁󰀄:󰀄]󰀄󰀅. Das ist gwissermaßen der biblische ‚Vorspann‘ der Predigt. Aber Eckhart predigt anfangs gar nicht über dieses von ihm vorgestellte Textwort der Epistel. Er fährt vielmehr fort: Ein wort nime ich, daz ›der pharisêus begerte, daz unser herre mit im æze‹ [Lk 󰀇:󰀃󰀆], und ›unser herre sprach ze der vrouwen: vade in pace, ganc in den vride‹ [Lk 󰀇:󰀅󰀀]󰀄󰀆. Hier seien zwei mögliche Beobachtungen dazu hervorgehoben: Erstens: Eckhart kombiniert die Epistel Hoseas 󰀁󰀄:󰀄-󰀅 mit dem Tagesevangelium Lk 󰀇:󰀃󰀆 und 󰀇:󰀅󰀀. Zweitens: Seine Übersetzung ist bereits Interpretation: vade in pace wird als ganc in den vride übersetzt und dann so ausgelegt: Man sol loufen in den vride, man ensol niht anevâhen in vride󰀄󰀇. Wer aus Gott geboren ist, sagt Eckhart, der ist in einem beständigen Lauf in den Frieden hinein. Aus dem Epistelzitat, um das es geht (populi eius qui in te est misereberis), ergibt sich für Eckhart die Frage, was es heißt, in Gott zu sein. Für ihn heißt dieses In-Gott-Sein mit dem durch die – verschobene – Übertragung im Deutschen neu gewonnenen 󰀄󰀄. Vgl. F. Löser, ,Lateinische Bibel‘ (󰀂󰀀󰀀󰀄), 󰀂󰀁󰀉. 󰀄󰀅. Pr. 󰀇 (DW I 󰀁󰀁󰀇,󰀁-󰀃). 󰀄󰀆. Ibid. (󰀁󰀁󰀇,󰀅-󰀆). 󰀄󰀇. Ibid. (󰀁󰀁󰀇,󰀈).

M EISTER E CKHART ,

DIE SCHUOLE , DIE

G RAMMATIK

UND DIE

B IBEL

󰀁󰀀󰀃

Evangelientext, in den Frieden zu laufen. In Gott zu sein heißt, Gott in einem ständigen Prozess stets neu zu erringen. Göttlicher Friede ist für Eckhart in dieser Predigt nicht etwas, was man ein für alle Mal erworben hat und in dem man ein für alle Mal bleiben könnte, sondern etwas, das man stets neu erringen muss. Frieden, so gesehen, ist prozessual, nicht statisch. Diese Sicht aber wird erst durch einen übersetzungstechnischen Kniff und erst im Deutschen möglich gemacht: in pace wird unmerklich (und im Deutschen unhörbar) verschoben zu in pacem, denn Eckhart fragt nicht, wo man sein soll, sondern wohin man laufen soll: in den Frieden. Seine Übersetzung setzt also seine folgende Exegese voraus und ermöglicht sie erst. Dazu zwei Bemerkungen: Erstens: Die an der Grammatik orientierte Deutung des Satzes vade in pace(m) = ganc in den vriden könnte einen Bezug zur modistischen Grammatik zeigen, etwa wenn Thomas von Erfurt die „Funktion des Zielpunktes beim Akkusativ“󰀄󰀈 hervorhebt. (Thomas Beispiel: vado ad plateam). Ich zitiere die Übersetzung des ʽTractatus de Modi Significandiʼ durch Stephan Grotz: „Entsprechend der erwähnten Flexion […] ist der akkusativische Kasus das Verhalten, ein Ding als vom Zielpunkt (eines Bezuges) anzuzeigen und darüber hinaus in der Verhaltensweise, dass dieses Ding als das ‹Wen› (für sein Bezugsglied fungiert). So ist in der Wortfolge ‹amo Deum (ich liebe Gott)› der Akkusativ ‹Deum› in der Verhaltensweise bedeutsam, dass er den Zielpunkt für die Tätigkeit und für die Abhängigkeit des Verbs ‹amo› darstellt und dass er dabei als das ‹Wen› fungiert. Als Akkusativ wird er bezeichnet, da er sozusagen das Ziel einer Handlung darstellt.“󰀄󰀉 Für Eckhart ist der göttliche Friede Zielpunkt einer Handlung, Zielpunkt eines Prozesses. Die grammatische Struktur, die er der Stelle gibt, entspricht in perfekter Weise dem Gehalt der von ihm intendierten Aussage des Bibelverses. Zweitens: Nadia Bray hat zu solchen Eckhartschen Verfahren generell und absolut treffend formuliert: 󰀄󰀈. Thomas von Erfurt, Abhandlung über die bedeutsamen Verhaltensweisen der Sprache (Tractatus de Modis significandi), aus dem Lateinischen übersetzt und eingeleitet von Stephan Grotz (Amsterdam und Philadelphia, 󰀁󰀉󰀉󰀈), 󰀃󰀅. 󰀄󰀉. Ibid. 󰀃󰀄.

󰀁󰀀󰀄

F REIMUT L ÖSER

„Als geübter Thetoriker verwandelt Eckhart den Nachteil, nicht auf eine verbindliche Übersetzung der Bibel zurückgreifen zu können, in eine rhetorische Möglichkeit; wenn er sagt: „diz wort stât geschriben in dem buoche der wîsheit“ oder: „in dem heiligen êwangeliô, daz uns Johannes schrîbet, liset man“, und dann unbekannte Formulierungen einführt, zwingt er uns zu wählen: sie entweder als Flüchtigkeitsfehler zu betrachten oder ihren Charakter gedanklicher Schärfe anzuerkennen und aufmerksam und ernsthaft jeden Schritt seiner Argumentation zu studieren, um den Grund zu verstehen. Man kann sich nur schwer vorstellen, dass die Adressaten von Eckharts Predigten nicht mit Überraschung auf den ungewöhnlichen Charakter mancher seiner Übersetzungen reagierten. Sehr wahrscheinlich kannten sie die lateinischen Bibelverse auswendig und akzeptierten seine extravaganten Lösungen nur unter der Bedingung einer befriedigenden Erklärung. Wenn Eckhart Neuheiten einführte, auch bei der schlichten Übersetzung biblischer Zitate, so hat er immer […] einen guten Grund.“󰀅󰀀 Dem kann man nur zustimmen, indem man wohl aber doch einige Akzente etwas anders setzt: Die Tatsache, dass Eckhart eine ‚verbindliche‘ Bibelübersetzung nicht vorlag, ist kein eigentlicher ‚Nachteil‘ in diesem Sinn, und ist dies generell nie gewesen. Einem mittelalterlichen Exegeten wird es immer um die Freilegung des eigentlichen Textsinns gehen. Übersetzungen können und wollen dafür nur Hilfskonstrukte sein. Kein mittelalterlicher geistlicher Orden (nicht der Predigerorden Eckharts, nicht die Franziskaner) hat eine ‚verbindliche‘ deutsche Bibelübersetzung vorlegen können, vorgelegt, oder auch nur vorlegen wollen; der ‚verbindliche‘ deutsche Text ist ein Streben, das aus der frühen Neuzeit stammt. Der Gedanke an ‚Flüchtigkeitsfehler‘, die Eckhart quasi nebenbei und durch Unaufmerksamkeit machte, wird angesichts seines absichtsvollen Vorgehens wohl weder bei seinem damaligen Publikum noch beim heutigen Betrachter entstehen. So lässt er uns keine ‚Wahl‘, sondern seine bewusst gemachten (!) ‚Fehler‘ legen absichtsvoll, gezielt und demonstrativ den Fokus auf die Textstelle und ihre Übersetzung. Sie machen den Text zum Brennpunkt und zum Zentrum einer Interpretation, die 󰀅󰀀. N. Bray, ,Deutsche Bibelzitate‘ (󰀂󰀀󰀀󰀅), 󰀄󰀂󰀆.

M EISTER E CKHART ,

DIE SCHUOLE , DIE

G RAMMATIK

UND DIE

B IBEL

󰀁󰀀󰀅

überraschen soll. Dabei geht es Eckhart um jene nova et rara, die er in seiner Einleitung zum opus tripartium ankündigt und zum Zielpunkt seiner Auslegung erklärt. Dabei wird der Vorstellung des Werkes der Auslegung, zu dem in Eckharts Konzept übrigens die Predigt gehört, der breiteste Raum schon im Prolog eingeräumt; Eckhart spricht von raras expositiones, die er seinen Zuhörern und Lesern biete, und erläutert diese „ungewöhnlichen Auslegungen“ so: „In his potissime quae se legisse alias non recolunt vel audisse, praesertim quia dulcius irritant animum nova et rara quam usitata, quamvis meliora fuerint et maiora.“ 󰀅󰀁 Ob aber tatsächlich die Adressaten, alle Adressaten, der deutschen Predigt mit Überraschung auf den ungewöhnlichen Charakter reagierten und diesen erkannten, weil sie die lateinischen Bibelworte auswendig kannten (und verstanden), scheint doch zweifelhaft. Aber: Erstens kann Eckhart ja den lateinischen Text zuvor verlesen haben (siehe oben); zweitens weist er ja selbst auf seinen ‚Fehler‘ hin und charakterisiert ihn als absichtsvoll, indem er seine Übertragung und die herkömmliche kontrastiert: „ʻ[…] vade in pace, ganc in den vrideʼ. Ez ist guot, der von vride ze vride kumet, ez ist lobelich; och ist ez gebrestenlich. Man sol loufen in den vride, man ensol niht anevâhen in vride. Got wil sprechen man sol gesast sîn in vride und gestôzen sîn in vride und sol enden in dem vride.“ 󰀅󰀂 Joseph Quint hat Eckharts Impetus genau getroffen: „Eckhart schätzt den Frieden am höchsten, wenn er das Endstadium eines Kampfes ist, eines aktiven Bemühens um den 󰀅󰀁. Prologus generalis in Opus tripartitum, n. 󰀂 (LW I/󰀁 󰀁󰀄󰀈,󰀁󰀃-󰀁󰀄󰀉,󰀂); Übersetzung Weissʼ: „besonders solcher, die sie ihrer Erinnerung nach sonst nicht gelesen oder gehört haben, weil Neues und Ungewöhnliches ja einen angenehmeren Reiz auf den Geist ausübt als Gewohntes, möge dies auch besser und bedeutender sein.“ (LW I/󰀁 󰀁󰀄󰀈-󰀉), vgl. Freimut Löser, ,,Werkkonzept‘ und ‚Individualisierung‘ bei Eckhart, Tauler und Seuse‘, in Freimut Löser und Dietmar Mieth (Hgg.), Religiöse Individualisierung in der Mystik, Meister-Eckhart-Jahrbuch 󰀈 (Stuttgart, 󰀂󰀀󰀁󰀄), 󰀁󰀄󰀅-󰀈󰀀. 󰀅󰀂. Pr. 󰀇 (DW I 󰀁󰀁󰀇,󰀆-󰀁󰀁󰀈,󰀂); Übersetzung Quints: „[…] ‚vade in pace, geh in den Frieden‘ ‹Luk. 󰀇,󰀃󰀆/󰀅󰀀›. Es ist gut, wenn man vom Frieden zum Frieden kommt, es ist löblich; trotzdem ist es mangelhaft. Man soll laufen in den Frieden, man soll nicht anfangen im Frieden. Gott ‹= unser Herr› will sagen: Man soll versetzt und hineingestoßen werden in den Frieden und soll enden im Frieden.“ (DW I 󰀄󰀅󰀆).

󰀁󰀀󰀆

F REIMUT L ÖSER

Frieden, der am Anfang noch nicht da ist […]. Vgl. In Gen. I n. 󰀂󰀆󰀃: ›… Et illud verum est, quod exitus de labore ad quietem est maior delectatio quam continue quiescere‹.“󰀅󰀃 Alle diese sehr scharfen Beobachtungen Eckharts nehmen von einer Beobachtung zu einer schlichten kleinen Präposition ihren Ausgang: in. Heißt dies im Frieden hingehen oder in den Frieden hineingehen? Regiert Lateinisch in den Ablativ oder sollte es nicht den Akkusativ regieren? Das ist kein Flüchtigkeitsfehler beim Übersetzen, auch keine, wie oben gesagt, ‚unmerkliche‘ Verschiebung, sondern eine ‚merkliche‘. Die Bedeutung des biblischen Satzes vade in pace ergibt sich nicht durch ihre Wortbedeutung, sondern durch die grammatische Funktion der Wörter im Satzgefüge und durch die Frage, wie im Zusammenspiel mit Präpositionen Ausgang und Zielpunkt einer Handlung sprachlich bestimmt werden. Exegese zielt damit auf die innere Bedeutung grammatischer Funktionen, deren Beachtung den Sinn eines Satzes erst wahrhaft freilegt. Die Tiefenbedeutung der Heiligen Schrift liegt nicht nur in der Bedeutung der einzelnen Wörter, sondern in deren Verbindung; sie liegt in ihrer grammatischen Struktur. Das Wechselspiel zwischen Latein und Deutsch schärft das Bewusstsein dafür. 󰀂. Auf das zweite Beispiel, die bekannte Predigt 󰀉 (Quasi stella matutina), die im Rahmen des durch diesen Band gestellten Themas wahrscheinlich häufiger analysiert werden wird,󰀅󰀄 sei hier nur kurz eingegangen (ich stelle Eckharts deutschen Text über den lateinischen Text der Epistel): ›Als ein morgensterne miten in dem nebel Quasi stella matutina in medio nebulae und als ein voller mâne in sînen tagen et quasi luna plena in diebus suis lucet und als ein widerschînendiu sunne et quasi sol refulgens, alsô hât dirre geliuhtet in dem tempel gotes‹. sic iste refulsit in templo dei [Sir 󰀅󰀀:󰀆f.]. [...] Waz ist ›got‹ und waz ist ›tempel gotes‹?󰀅󰀅 󰀅󰀃. Quint in DW I 󰀁󰀁󰀈, Anm. 󰀁. 󰀅󰀄. Vgl. die Beiträge von C.T. Jones (S. 󰀇󰀀f.) und M. Vinzent (S. 󰀂󰀅-󰀂󰀆). 󰀅󰀅. Pr. 󰀉 (DW I 󰀁󰀄󰀁,󰀁-󰀇); Übersetzung Quints: „ʽWie ein Morgenstern mitten im Nebel und wie ein voller Mond in seinen Tagen und wie eine strahlende Sonne, so hat dieser geleuchtet im Tempel Gottesʼ ‹Jes. Sir. 󰀅󰀀, 󰀆/󰀇›. […] Was ist ʽGottʼ, und was ist ʽTempel Gottesʼ?“ (DW I 󰀄󰀆󰀂).

M EISTER E CKHART ,

DIE SCHUOLE , DIE

G RAMMATIK

UND DIE

B IBEL

󰀁󰀀󰀇

Die Übersetzung ist hier (man sieht das an der Wortsynopse) recht genau. Die Predigt ist auch weniger durch die Übersetzung auffällig als vielmehr dadurch, dass sich Eckhart in einer „grammatischen Spekulation“ mit dem Wörtchen quasi beschäftigt: Ich meine daz wörtelîn ›quasi‹, daz heizet ›als‹, daz heizent diu kint in der schuole ein bîwort (Pr. 󰀉, DW I 󰀁󰀅󰀄,󰀇-󰀈). Eckharts Auslegung, die von der Grammatik und der Übersetzung von quasi (= als) inspiriert ist, gipfelt dann in der Feststellung: Der mensche [...] sol sîn als ein morgensterne: iemermê gote gegenwertic und iemermê bî und glîch nâhe und erhaben über alliu irdischiu dinc und bî dem worte [das Gott ist] sîn ein bîwort (Pr. 󰀉, DW I 󰀁󰀅󰀆,󰀉-󰀁󰀅󰀇,󰀂). Man könnte sagen, dass sich Eckharts Theologie hier erneut der grammatischen Ebene bedient: Das lateinische quasi oder das mittelhochdeutsche als (nhd. ‚wie‘) werden nicht von ihrer Semantik oder Wortbedeutung her ausgelegt, sondern von ihrer grammatikalischen Funktion und ihrer Wortklasse her gesehen: Quasi ist ein bîwort; also signalisiert es, dass wir bî dem wort ein bî-wort sein sollen. Das Verhältnis Gott–Mensch funktioniert hier wie das Verhältnis von Wort und ‚Bei-Wort‘. Frank Tobin hat sowohl auf die Bedeutung der Grammatik wie auf die Doppeldeutigkeit des mittelhochdeutschen bîwort hingewiesen: „Eckhartʼs point here is perhaps more complex than we might first think. Bîwort is used to indicate different parts of speech, usually an adjective or adverb. Thus we should, like quasi, be the bîwort, dependent on the divine wort. However, bîwort also means allegory, and Eckhart continues by explaining the allegory of the morning star (which we should be) which always stays equally close to the sun (God) not allowing anything to separate it further from the sun. Whether we treat this passage as a case of poetic ambivalence or a coincidence, Eckhart is in any case using the structure of language as a symbol for a spiritual truth.“󰀅󰀆 An Eckharts Umgang mit der Stelle ist weiter sein deutscher Wortgebrauch ebenso interessant wie seine Einordnung: Nach Eckharts Auskunft wird in der schuole für diese Wortklasse der deutsche Terminus bîwort verwendet. Dies zeigt, wenn Eckhart hier nicht selbst den eigentlichen in der schuole gebrauchten lateinischen Terminus ad hoc selbst überträgt, 󰀅󰀆. F. Tobin, ,Creativity and Interpreting Scripture‘ (󰀁󰀉󰀈󰀂), 󰀄󰀁󰀁-󰀂.

󰀁󰀀󰀈

F REIMUT L ÖSER

abermals das Vordringen des Deutschen in den Unterricht. Eckharts Bezeichnung (und die der kint in der schuole) ist bîwort. Eckharts sehr viel jüngerer Noch-Zeitgenosse Heinrich von Mügeln gebraucht den Terminus im Deutschen mehrfach, freilich immer als zuwort.󰀅󰀇 Dies ist die im Mittelalter (einzig) gängige deutschsprachige Bezeichnung, wenn man Diefenbachs Glossar heranzieht: Adverbium zuwort, ein zugelegt wort.󰀅󰀈 Der Fall sollte nicht überbewertet werden, denn Eckharts bîwort könnte nicht ganz so singulär sein; tatsächlich sind vor dem 󰀁󰀅. Jahrhundert deutsche Bezeichnungen grammatischer Termini, wie Annette Volfing festgestellt hat, extrem selten.󰀅󰀉 Aber die Texte, die Volfing im Zusammenhang ihrer Mügeln-Studie freigelegt hat, verwenden eben alle zuwort. Nur im Würzburger Donat-Fragment (um 󰀁󰀃󰀀󰀀) kommt Eckharts bîwort vor.󰀆󰀀 Nun ist aber Eckharts Gebrauch des deutschen Terminus bîwort alles andere als Zufall. Er braucht ihn. Ihm wäre ein additives zuwort, ein zugelegt wort (s. o.) oder die Variante zuoze deme verbo󰀆󰀁 wenig hilfreich gewesen. Ein Vergleich mit Predigt 󰀆 macht unmittelbar einsichtig, warum dies so ist. Von den gerehten, die im Zentrum der Predigt stehen, wird gesagt: Sant Johannes sprichet:,daz wort was bî gote‘. Ez was alzemâle glîch und was bî neben, noch undenân, noch obenân, sunder glîch. Dô got den menschen machete, dô machete er die vrouwen von des mannes sîten, dar umbe daz si im glîch wære. Er machete sie niht von dem houbete noch von den vüezen, daz si im wære weder vrouwe 󰀅󰀇. M. Stolz, ʻTumʼ-Studien (󰀁󰀉󰀉󰀆), 󰀄󰀂󰀁. 󰀅󰀈. Lorenz Diefenbach, Glossarium Latino-Germanicum Mediae et Infimae Aetatis (Frankfurt am Main, 󰀁󰀈󰀅󰀇; Nachdruck Darmstadt, 󰀁󰀉󰀉󰀇), 󰀁󰀄. 󰀅󰀉. Vgl. Annette Volfing, Heinrich von Mügeln ›Der meide Kranz‹. A commentary, Münchener Texte und Untersuchungen zur deutschen Literatur des Mittelalters 󰀁󰀁󰀁 (Tübingen, 󰀁󰀉󰀉󰀇), 󰀆󰀃-󰀄 mit Anm. 󰀁󰀃. 󰀆󰀀. Siehe die Tabelle bei ibid. 󰀆󰀅. Diesen Befund bestätigen die mittelhochdeutschen Wörterbücher, die unter dem Lemma bîwort als Entsprechung von Adverb ausschließlich Meister Eckhart als Beleg heranziehen (vgl. Georg Benecke, Wilhelm Müller, Friedrich Zarncke [Hgg.], Mittelhochdeutsches Wörterbuch, Dritter Band T – Z [Hildesheim u. a., 󰀁󰀉󰀈󰀆], 󰀈󰀀󰀈; Matthias Lexer, Mitelhochdeutsches Handwörterbuch, Erster Band A – M [Stuttgart, 󰀁󰀉󰀇󰀉], 󰀂󰀉󰀂; Mittelhochdeutsches Wörterbuch, Band 󰀁 a – êvrouwe, hgg. unter der Leitung von Klaus Grubmüller, Karl Stackmann, Kurt Gärtner, Ralf Plate, Uta Störmer-Caysa [Stuttgart, 󰀂󰀀󰀁󰀃], 󰀈󰀄󰀃). Für die Bedeutung ‚Spruch‘, ‚Sprichwort‘ und ‚Gleichnis‘ werden einige Belege angeführt. 󰀆󰀁. Nachgewiesen bei A. Volfing, Heinrich von Mügeln (󰀁󰀉󰀉󰀇), 󰀆󰀅.

M EISTER E CKHART ,

DIE SCHUOLE , DIE

G RAMMATIK

UND DIE

B IBEL

󰀁󰀀󰀉

noch man, sunder daz si glîch wære. Alsô sol diu gerehte sêle glîch bî gote sîn und bî neben gote, rehte glîch, noch unden noch oben.󰀆󰀂 Eckharts rehte glîch, eben auch auf gleicher Ebene, ergibt sich aus seinem Verständnis von bî = ‚bei, neben‘. Ebenso wichtig ist die Semantik von bî: Wir sind nicht ein Additivum Gottes, Gott irgenwie zu-gefügt im Sinne gar des ‚zu-fälligen‘ Accidens, wie sich dies aus zuwort ergäbe, sondern wir sollen bî got, glîch nâhe sein. Alles in allem zeigt die Stelle: Der Sinn entschlüsselt sich primär nicht aus der Wortbedeutung des quasi, sondern aus seiner grammatischen Funktion als bîwort bei Gott, der das Wort ist. Wort und bîwort stehen nebeneinander und sind aufs engste miteinander verbunden. Vielleicht könnte man sagen, dass auf diese Weise der modus significandi zu tieferem Sinn führt. Eckharts Analyse beruht zum einen auf der Semantik, aber nicht auf der von quasi oder als, sondern auf der von bîwort (wörtlich gewandt: wir sind bî wort, also bei Gott, der das Wort ist). Eckharts interpretatorischer Ansatz für Quasi stella beruht damit nicht nur (oder sogar weniger) auf der Bedeutung eines Wortes (quasi) auf lexikalischer Ebene. Es ist die grammatikalische Ebene (des bî-wort), die die Bedeutung trägt. Dies scheint mir ein stark modistisch geprägtes Verfahren. Zu dessen Erklärung sei die Einleitung Stephan Grotzʼ zu seiner deutschen Thomas von ErfurtAusgabe zitiert: „Das darüber Entscheidende, dass und wie die universalen Prinzipien für die Verwirklichung eines grammatisch korrekten Verbandes entdeckt werden können, liegt nun für die spekulative Grammatik eben darin, dass eine dictio mit und jenseits ihrer lexikalischen Bedeutung als pars orationis so oder so bedeutsam ist: ein bestimmtes bedeutsames Verhalten (modus significandi) aufweist. Insofern mit einem bestimmten lexikalischen Sprachzeichen stets sein grammatischer Charakter als pars orationis zum Vorschein kommt, es sich also zugleich als Vertreter der nominalen, verbalen, partizipialen oder einer anderen Wortklasse präsentiert, ist für dieses Sprachzeichen sein jeweiliger pars orationis-Charakter 󰀆󰀂. Pr. 󰀆 (DW I 󰀁󰀀󰀆,󰀅-󰀁󰀀󰀇,󰀄); Übersetzung Quints: „Sankt Johannes spricht:,Das Wort war bei Gott’ ‹Joh. 󰀁,󰀁.›. Es war völlig gleich und daneben, nicht darunter noch darüber, sondern gleich. Als Gott den Menschen schuf, da schuf er die Frau aus des Mannes Seite, auf dass sie ihm gleich wäre. Er schuf sie weder aus dem Haupte noch aus den Füßen, auf das sie weder unter noch über ihm wäre, sondern dass sie gleich wäre. So auch soll die gerechte Seele gleich bei Gott sein und neben Gott, ganz gleich, weder darunter noch darüber.“ (DW I 󰀄󰀅󰀄).

󰀁󰀁󰀀

F REIMUT L ÖSER

eine Zusatzbestimmung (ratio dictioni superaddita) zu seiner wesentlichen Formalbestimmung, ein mit Bedeutung versehener Laut (vox significativa) zu sein. Semantisch gewendet: Neben seiner Bestimmung, eine spezifische Bedeutung auf der lexikalischen Ebene zu zeitigen (ratio significandi), tritt ein Sprachzeichen stets mit der Bestimmung auf, als Vertreter einer Wortklasse ‹noch› eine Mitbedeutung zu zeitigen (ratio consignificandi).“󰀆󰀃 Jedenfalls gilt: Eckharts Verständnis des biblischen Satzes (dass wir nicht Gott gleichen, sondern ihm gleich sein müssen!) ergibt sich nicht aus der Wortbedeutung von quasi (dann wären wir nur quasi Gott, als Gott, wie Gott), sondern er ergibt sich aus seiner Bedeutung in der Syntax. In diesem Fall ist es die ratio consignificandi der Wortklasse des ‚bîworts‘ quasi, die die Bedeutung enthüllt. Nur Reflexion über den grammatikalischen Gehalt des Satzes macht Eckhart und den Zuhörern diese Deutung möglich. Tobin hat zwei ähnliche Beispiele aus dem lateinischen Werk angeführt: „In a Latin sermon on the text ‘Estote misericordes, sicut et pater vester’ (Luke 󰀆, 󰀃󰀆), the preacher describes estote as a verbum substantivum drawing on the terminology of Priscian. With no other connection to the text than this, he then interprets substantivum: sub as denoting humility and stantivum denoting stability or constancy. Since this sermon exists only in a form that probably represents notes for a sermon rather than full-blown expression of his ideas, it is difficult to know if this example proves more than that Meister Eckhart had a sense of humor. However, the following example, since it appears in the general prologue to the Opus Tripartium, has to be taken seriously. He takes the first verse of Genesis: ‘In principio creavit deus coelum et terram’ as proving that all of creation was finished and perfect (perfectum et terminatum) in the act of creation because creavit is a verb denoting a perfect tense (praeteritum perfectum) (LW I 󰀁󰀆󰀀).“󰀆󰀄 Tobins Beispiele sollten ernst genommen werden: Sie zeigen, dass Eckharts Heranziehung der Wortklasse zur Freilegung einer Bedeutung des biblischen Satzes im Fall des bîworts „quasi“ keineswegs einmalig ist, sondern dass er auch im lateinischen Werk die Etymologie der Wortklassenbezeichnung nutzt. Und sie zeigen generell, dass Grammatik für ihn eine Methode der Bibelauslegung darstellt. 󰀆󰀃. S. Grotz, Abhandlung über die bedeutsamen Verhaltensweisen (󰀁󰀉󰀉󰀈), xxiii. 󰀆󰀄. F. Tobin, ,Creativity and Interpreting Scripture‘ (󰀁󰀉󰀈󰀂), 󰀄󰀁󰀂.

M EISTER E CKHART ,

DIE SCHUOLE , DIE

G RAMMATIK

UND DIE

B IBEL

󰀁󰀁󰀁

󰀃. Eckharts Umgang mit dem Bibeltext ist grundsätzlich dadurch gekennzeichnet, dass er seine eigenen Themen sucht und findet. Inzwischen bekannt geworden ist die Stelle aus der bürgelîn-Predigt. Sie beginnt mit Lk 󰀁󰀀:󰀃󰀈: Intravit Jesus in quoddam castellum et mulier quaedam, Martha nomine, excepit illum […]. Ich hân ein wörtelîn gesprochen des ersten in dem latîne, daz stât geschriben in dem êwangeliô und sprichet alsô ze tiutsche: ,unser herre Jêsus Kristus der gienc ûf in ein bürgelîn und wart enpfangen von einer juncvrouwen, diu ein wîp was.‘ 󰀆󰀅 Mulier wird – bar jedes Bezugs im Ausgangstext – wiedergegeben als juncvrouwe, diu ein wîp was; dadurch kann Eckhart dann die gesamte Predigt strukturieren in die Gedanken der Reinheit und Fruchtbarkeit. Man sieht je t zt aber auch: Die bekannte Stelle der bürgelîn-Predigt ist alles andere als ein Einzelfall. Eckhart greift stets dort in den Text ein, wo er es für nötig hält.󰀆󰀆 So auch im Beispiel aus Predigt 󰀃: Act 󰀁󰀂:󰀁󰀁 (Nunc scio vere, quia misit dominus angelum suum) wird zunächst recht genau wiedergegeben: ›nû weiz ich wærlîche, da z mir got sînen engel hât gesant.‹ Dann aber sagt Eckhart: Nû kêren wir daz wort umbe und sprechen: w an mir got sînen engel hât gesant, dâ von bekenne ich wærlîche󰀆󰀇. Mittelalterliche Wörterbücher geben für quia die Bedeutung daz an, aber auch darumb und wan (= ‚weil‘).󰀆󰀈 Eckhart hat beide sich daraus ergebenden Varianten übersetzt. Die Stelle der Vulgata (Act 󰀁󰀂:󰀆ff.) berichtet von der wundersamen Befreiung des Petrus aus dem Gefängnis durch den Engel des Herrn; beide treten auf die Gasse, der Engel hat Petrus verlassen; hier setzt Act 󰀁󰀂,󰀁󰀁 an; mit Luthers Worten: 󰀆󰀅. Pr. 󰀂 (DW I 󰀂󰀄,󰀃-󰀆); Übersetzung Quints: „Ich habe ein Wörtlein gesprochen, zunächst auf lateinisch, das steht geschrieben im Evangelium und lautet zu deutsch also: ʽUnser Herr Jesus Christus ging hinaus in ein Burgstädtchen und ward empfangen von einer Jungfrau, die ein Weib warʼ ‹Luk. 󰀁󰀀,󰀃󰀈›.“ (DW I 󰀄󰀃󰀄). 󰀆󰀆. Vgl. zum Folgenden: F. Löser, ,Lateinische Bibel‘ (󰀂󰀀󰀀󰀄), 󰀂󰀂󰀅-󰀆. 󰀆󰀇. Pr. 󰀃 (DW I 󰀄󰀈,󰀁-󰀇); Übersetzung Quints: „ʽNun weiß ich wahrhaft, dass Gott mir seinen Engel gesandt und mich erlöst hat aus der Gewalt des Herodes und aus den Händen der Feinde.ʼ ‹Apg. 󰀁󰀂,󰀁󰀁; vgl. auch Ps. 󰀁󰀇,󰀁›. Nun kehren wir dieses Wort um und sagen: Weil Gott mir seinen Engel gesandt hat, deshalb erkenne ich wahrhaft“ (DW I 󰀄󰀃󰀉). Vgl. zur Stelle die Notiz bei F. Tobin, ,Creativity and Interpreting Scripture‘ (󰀁󰀉󰀈󰀂), 󰀄󰀁󰀆. 󰀆󰀈. Vgl. z. B. L. Diefenbach, Glossarium Latino-Germanicum (󰀁󰀈󰀅󰀇; 󰀁󰀉󰀉󰀇), 󰀄󰀇󰀉; K. Grubmüller, B. Schnell et al., Vocabularius ex quo (󰀁󰀉󰀉󰀈-󰀂󰀀󰀀󰀁), Bd. V, Sp. 󰀂󰀂󰀁󰀈, Q 󰀁󰀁󰀄.

󰀁󰀁󰀂

F REIMUT L ÖSER

„Vnd da Petrus zu jm selber kam /sprach er / Nu weis ich warhafftig / das der Herr seinen Engel gesandt hat / vnd mich errettet aus der Hand Herodis.“󰀆󰀉 Wieder ist es bei Eckhart eine Relektüre der grammatischen Struktur des Satzes, seines syntaktischen Gefüges, die ihn dazu bringt, quia nicht im Sinn eines finalen, sondern eines kausalen Nebensatzes zu lesen. Ein anderes deutsches Verb (bekenne statt weiz) und eine Umstellung der Satzglieder im Deutschen genügen dann, dass sich Eckhart in der Folge einem seiner Zentralthemen widmen kann: dem Vorrang der bekantnisse: Petrus sprichet als vil als bekantnisse. Um dorthin zu gelangen, bedient sich Eckhart einer syntaktischen Operation, die er auch ankündigt: Er kehrt daz wort umbe. Es ist hier also die Ordnung der einzelnen Satzglieder und deren Reihenfolge, die die Bedeutung trägt: quia misit dominus angelum suum, hunc sicio vere = wan mir got sînen engel hât gesant, dâvon bekenne ich waerlîche. Eckhart geht es nicht um das herkömmliche Verständis des Satzes (die Erkenntnis, dass Gott einen rettenden Engel gesandt hat), sondern darum, dass mithilfe des von Gott gesandten Engels die wahre Erkenntnis Gottes möglich ist. Dahin führt eine schlichte Umkehrung von Haupt- und Nebensatz und der syntaktischen Anordnung. 󰀄. Welche Bedeutung beim Übersetzen, Verstehen und Auslegen gerade der Wortstellung zukommen kann, demonstriert Eckhart eindrucksvoll in Predigt 󰀃󰀀: Ich saz gester an einer stat, dô sprach ich ein wörtelîn, daz stât in dem pater noster und sprichet: ›dîn wille der werde!‹ Mêr: ez wære bezzer: ›werde wille dîn!‹; daz mîn wille sîn wille werde, daz ich er werde: daz meinet daz pater noster.󰀇󰀀 Die Stelle ist der Forschung aufgefallen, und Susanne Köbele󰀇󰀁 hat mit vollem Recht betont, Eckhart beziehe hier ausdrücklich Stellung gegen 󰀆󰀉. D. Martin Luther, Die Gantze Heilige Schrift Deutsch (Wittenberg, 󰀁󰀅󰀄󰀅); ähnlich auch heute in der Einheitsübersetzung der neuen Jerusalemer Bibel: „Da kam Petrus zu sich und sagte: Nun weiß ich wahrhaftig, dass der Herr seinen Engel gesandt hat und mich der Hand des Herodes entrissen hat.“ 󰀇󰀀. Pr. 󰀃󰀀 (DW II 󰀉󰀉,󰀁-󰀃); Übersetzung Quints: „Ich saß gestern an einer Stätte, da sprach ich ein Wörtlein, das steht im Paternoster und lautet: ʽDein Wille werde!ʼ ‹Matth. 󰀆,󰀁󰀀› Besser aber wäre: „Werde Wille dein!“; dass mein Wille sein Wille werde, dass ich er werde: das meint das Paternoster.“ (DW II 󰀆󰀅󰀇). 󰀇󰀁. S. Köbele, ,Primo aspectu monstruosa‘ (󰀁󰀉󰀉󰀃), 󰀆󰀂-󰀈󰀁. Vgl. schon den kurzen Hinweis bei F. Tobin, ,Creativity and Interpreting Scripture‘ (󰀁󰀉󰀈󰀂), 󰀄󰀁󰀆.

M EISTER E CKHART ,

DIE SCHUOLE , DIE

G RAMMATIK

UND DIE

B IBEL

󰀁󰀁󰀃

die Konvention und orientiere die ungewöhnliche deutsche Wortfolge exakt am Lateinischen (fiat voluntas tua = werde wille dîn). Eckhart hat sich bekanntlich in einem (in der Forschung lange unterschätzten) eigenen Traktat, der durch die Neuausgabe, Kommentierung und Neu-Interpretation von Markus Vinzent in der Neubewertung von Eckharts Umgang mit seinen Quellen eine Aufwertung erfuhr, eigens mit dem Paternoster beschäftigt.󰀇󰀂 Hier aber, in seiner deutschen Predigt, kommt er zu einer erstaunlichen Umwertung der Textstelle. Wegweisend ist Susanne Köbeles Interpretation: „Die verblüffende Sinnverschiebung, die Eckhart vornimmt, zerschlägt den wörtlichen Zusammenhang des Bibeltextes, im Fall des Paternosters eines Bibeltextes von außerordentlicher Dignität, vor der sich der Erwartungsbruch umso schroffer ausnehmen mußte. Der Eckhart-Herausgeber J. Quint hat das Verfahren kritisch vermerkt; in der Anmerkung zur Stelle heißt es: ›Eckhart macht die Paternoster-Bitte gewaltsam seinem Gedanken vom Ledigwerden des Menschen [...] dadurch dienstbar, daß er willkürlich und dem eindeutigen objektiven Sinn des fiat voluntas tua widersprechend den Text interpretiert.‹ Hermeneutische ‚Willkür‘? ›Arbitrarisierung der Interpretation‹? In allen Epochen kontroverser Eckhartdeutung, bis in die jüngste Zeit, findet sich diese Einschätzung: negativ als Vorwurf der Planlosigkeit und getrübten Durchsichtigkeit – gemessen am Maßstab scholastischer Exegesepraxis –, positiv‘ als ‚absolute‘, geniale Originalität, als voraussetzungslos Neues. Eckhart selbst charakterisiert seine Schriftauslegungen – hier die des lateinischen Werks – so, daß sie „auf den ersten Blick ungeheuerlich, zweifelhaft oder falsch“ seien (primo aspectu monstruosa, dubia aut falsa).“󰀇󰀃 Dass Eckhart dem Publikum mit seinen Auslegungen nova et rara präsentieren will, wurde schon gesagt. Wie erreicht er diese? Im Fall der hier vorliegenden Paternoster-Auslegung ist es Köbeles Verdienst, das, was als willkürliche Handhabung der exegetischen Methoden erschien,󰀇󰀄 durchsichtig gemacht zu haben: 󰀇󰀂. Vgl. Markus Vinzent, Meister Eckhart, On the Lord’s Prayer. De oratione Dominica. Introduction, Text, Translation, Commentary, Eckhart: Texts and Studies 󰀂 (Leuven, 󰀂󰀀󰀁󰀂). 󰀇󰀃. S. Köbele, ,Primo aspectu monstruosa‘ (󰀁󰀉󰀉󰀃), 󰀆󰀂-󰀃. 󰀇󰀄. Vgl. E. Winkler, Exegetische Methoden (󰀁󰀉󰀆󰀅), 󰀁󰀁󰀃.

󰀁󰀁󰀄

F REIMUT L ÖSER

„Eckhart zitiert vorab die geläufige mittelhochdeutsche Übersetzung der dritten Bitte [...]. Diese stellt das Nomen als Sinnwort voran an die Stelle, die den Redeton hat, als Nominativus pendens. Dann widerruft er ausdrücklich diese Übersetzung zugunsten einer neuen. Diese verändert die Position des Verbums (Erststellung) und die des Possessivpronomens (Nachstellung hinter das Nomen): werde wille dîn. Diese Korrektur bringt die Satzteile vorerst in ein vages Verhältnis: Die Ambiguität ist interpretierbar durch die doppelte Klassifikation sowohl von werde (einstelliges oder zweistelliges Verb?) wie auch von dîn (attributiver oder prädikativer Bezug?). Unmerklich bereitet die modifizierte Übersetzung eine Sinnverschiebung vor, die Verschiebung des Verbums fieri in seiner Funktion als Vollverb mit der Bedeutung ‘geschehen’ hin zu einer neuen Funktion als Hilfsverb mit der Bedeutung ‘werden zu’. Die folgende Auslegung beseitigt die Ambiguität. Das einstellige Verb, das eine Aussage über Gott (Gottes Willen) trifft, kann abgelöst werden von einem zweistelligen Verb, von einer Aussage, die Gott zum Menschen in Relation setzt (den göttlichen zum menschlichen Willen): [...] daz mîn wille sîn wille werde.“󰀇󰀅 Man mag ein solches Vorgehen für willkürlich halten. Es ist das Gegenteil. Diese Klarstellung ist abermals Köbele zu verdanken: „Eckharts Umformulierung werde wille dîn übernimmt [...] exakt die Wortfolge des lateinischen fiat voluntas tua! Der invertierte Satz folgt interlinear der Vorlage. Als deren präzise formale Entsprechung weiß er sich dem Original näher als die übliche, von Eckhart zuerst eingeführte Übersetzung, und gerade diese dem Original nähere Vorlage ist es, die den Sinn aufs schärfste zuspitzt. [...] Die Volkssprache ordnet sich unter, gegen ihre eigenen Sprachregeln. Damit erscheint sie als Interpretamentsprache des Lateinischen, wie man es kennt von den frühen (karolingischen) Paternostererklärungen, die die lateinische Wortstellung fast ausnahmslos beibehalten. Der Folgesatz macht dann die mangelnde Grammatikalität unsichtbar, und das interlinear übertragene Bibelwort – zunächst in einer Brückenfunktion – verselbständigt sich mit einer eigenen Deutung. Mit diesem Anspruch ist die Übersetzung mehr als nur Lesehilfe zum Original.“󰀇󰀆 󰀇󰀅. S. Köbele, ,Primo aspectu monstruosa‘ (󰀁󰀉󰀉󰀃), 󰀇󰀁-󰀂. 󰀇󰀆. Ibid. 󰀇󰀃-󰀄.

M EISTER E CKHART ,

DIE SCHUOLE , DIE

G RAMMATIK

UND DIE

B IBEL

󰀁󰀁󰀅

Eckhart weiß sich hier auf seine Weise dem lateinischen Original näher, als ihm die übliche deutsche Übersetzung („Dein Wille werde“) je kommen könnte. Es ist gerade diese dem Original nähere – transsprachliche – Version, die Latein und Deutsch verbindet, „die den Sinn aufs schärfste zuspitzt“. Das heißt: Die genaue Übersetzung eines lateinischen biblischen Satzes auch in der Wortstellung (werde wille dîn) löst eine theologische Reflexion aus, die wieder in der Vereinigung von Mensch und Gott gipfelt. Erst die Übertragung der lateinischen Worstellung ins Deutsche verändert die Subjekt-Objekt-Relation des Satzes: Der Wille des Menschen soll mit dem Willen Gottes identisch werden: werde wille dîn. Und das heißt eben mehr als dass Gottes Wille werden (= geschehen) soll, nämlich dass der Wille (mein Wille) zu seinem Willen werden soll. Das aber ist Gottes Wille, dass ich er werde! Dagmar Gottschall hat zu dieser Stelle noch klargestellt: Eckhart „liest das intransitive Vollverb fieri, das im lateinischen Original mit seinem Subjekt voluntas tua verbunden ist, als Hilfsverb, das ein Prädikatsnomen erfordert. Nur so kann Eckhart ,übersetzen‘: werde [mîn] wille dîn [wille]: Eckhart nimmt,fiat voluntas tua‘ nicht als Satz, sondern als drei Wörter.“󰀇󰀇Man mag ein solches Vorgehen eine maximale Freiheit des Übersetzens nennen oder eine maximale Vorlagengebundenheit – oder Bibelexegese auf der Grundlage der Grammatik. Dass dieser ‚Eingriff‘ nicht ‚fälschlich‘ zufällig oder willkürlich, sondern reflektiert geschieht, belegt Eckharts Hinweis auf die traditionelle Formulierung und seine Abgrenzung: „Mêr: (= ‚Aber‘) ez wære bezzer!“ Eckhart ist also durchaus der Meinung, dass seine ungewöhnliche Übertragung die bessere ist. Auch hier scheint mir ein modistischer Einfluss denkbar. Man sieht dies etwa daran, welche Rolle bei den Modisten die „concepts of primum and posterius constructibile“ spielen. Darüber hat auch die Spezialforschung (man denke etwa an Jan Pinborgs Beitrag ʽSome Syntactical Concepts in Medieval Grammarʼ) nicht letzte Klarheit gewinnen können. Soviel aber ist eindeutig, dass dabei „the order of words“ – genau wie hier bei Eckhart – im Zentrum der Überlegungen steht.󰀇󰀈 Eckhart übersteigt die Tradition und ruht gleichzeitig auf ihr auf; er ist sich im Prolog zum opus tripartium ja auch durchaus bewusst, dass 󰀇󰀇. Dagmar Gottschall, ,„Man möhte wunder tuon mit worten“ (Predigt 󰀁󰀈). Zum Umgang Meister Eckharts mit Wörtern in seinen deutschen Predigten‘, in Andreas Speer und Lydia Wegener (Hgg.), Meister Eckhart in Erfurt, Miscellanea Mediaevalia 󰀃󰀂 (Berlin und New York, 󰀂󰀀󰀀󰀅), 󰀄󰀂󰀆-󰀄󰀉, 󰀄󰀄󰀈. 󰀇󰀈. Jan Pinborg, ,Some Syntactical Concepts in Medieval Grammar‘, in Jan Pinborg und Sten Ebbesen (Hgg.), Medieval Semantics (London, 󰀁󰀉󰀈󰀇), 󰀄󰀉󰀆-󰀅󰀀󰀉, 󰀅󰀀󰀃 und 󰀅󰀀󰀄.

󰀁󰀁󰀆

F REIMUT L ÖSER

das Gewohnte durchaus „besser und bedeutender sein kann“.󰀇󰀉 Er sucht die von Köbele so in den Vordergrund gestellten Wendungen, die primo aspectu monstruosa, dubia aut falsa erscheinen mögen. Auf den zweiten Blick verändert sich das aber eben auch, denn, wie Eckhart sagt: „Anders aber verhält es sich, wenn man es mit Scharfsinn und größerer Hinwendung durchdenkt. Dann wird man finden, dass die Wahrheit und das Gewicht der Heiligen Schrift […] für das Gesagte hellleuchtendes Zeugnis ablegt.“󰀈󰀀 󰀅. Im gerade besprochenen Beispiel ist es die genaue Wort-für-WortÜbersetzung, die eine neue, überraschende Wendung mit sich bringt (die Veränderung, um in Thomasʼ von Erfurt Terminologie zu sprechen, von primum und posterius constructibile). In derselben Predigt schafft aber auch umgekehrt die übersetzerische Vielfalt neue interpretatorische Möglichkeiten. Der Beginn dieser Predigt 󰀃󰀀 bezieht sich auf die Stelle Praedica verbum (󰀂Tim 󰀄:󰀂) und lautet so (Beispiel 󰀅): Ein wörtelîn liset man hiute und morne von mînem herren sant Dominicus, und schrîbet daz sant Paulus in der epistel und sprichet ze tiutsche alsô: ›sprich daz wort, sprich ez her ûz, sprich ez her vür, brinc ez her vür und gebir daz wort!‹󰀈󰀁 Eckhart gibt fünf Übersetzungen für zwei Wörter, alle fünf sind nicht zufällig gewählt und nicht zufällig gereiht. Die verschiedenen Übersetzungsangebote, die Eckhart für praedica verbum ‚vorschlägt‘, steuern deutlich auf ein Ziel hin: Am Festtag seines Ordensgründers Dominicus muss Eckhart über sein Zentralthema von der Gottesgeburt handeln: Und so wird eben aus praedica verbum Schritt für Schritt gebir daz wort, was dann die Möglichkeit gibt, von der Geburt Gottes zu handeln. Das ist nicht Willkür, sondern graduelle Aufdeckung der Bedeutung eines Lexems. So wird von einem Schritt zum nächsten ‚wahre‘ Bedeutung freigelegt.󰀈󰀂 󰀇󰀉. F. Löser, ,Werkkonzepte‘ (󰀂󰀀󰀁󰀄), 󰀁󰀄󰀈. 󰀈󰀀. Prologus generalis in Opus tripartitum, n. 󰀇; Übersetzung: LW I/󰀁 󰀁󰀅󰀂 (leicht verändert); lat. Text nach der Neuedition Sturleses LW I/󰀂 (Rec. L): Secus autem si sollerter et studiosus pertractentur. Luculenter enim invenietur (invenientur Rec. E) dictis attestari veritas et auctoritas ipsius sacri canonis seu alicuius sanctorum aut doctorum famosorum. 󰀈󰀁. Pr. 󰀃󰀀 (DW II 󰀉󰀃,󰀁-󰀄); Übersetzung Quints: „Ein Wörtlein liest man heute und morgen über meinen Herrn Sankt Dominikus, und Sankt Paulus schreibt es in der Epistel, und es lautet zu deutsch so: ʽSprich das Wort aus, sprich es hervor, bring es hervor und gebier das Wortʼ ‹󰀂 Tim. 󰀄,󰀂›“ (DW II 󰀆󰀅󰀆). 󰀈󰀂. Vgl. dazu auch Freimut Löser, ,Predigt 󰀁󰀉 “Stâ in porta”‘, in Georg Steer und Loris Sturlese (Hgg.), Lectura Eckhardi I. Predigten Meister Eckharts von Fachgelehrten gelesen und gedeutet (Stuttgart u. a., 󰀁󰀉󰀉󰀈), 󰀁󰀁󰀇-󰀅󰀀.

M EISTER E CKHART ,

DIE SCHUOLE , DIE

G RAMMATIK

UND DIE

B IBEL

󰀁󰀁󰀇

󰀆. Übersetzen biblischer Stellen ist bei Eckhart also stets von theologischer Reflexion begleitet. Was der Text eigentlich meint, wird durch Arbeit am Text erschlossen. Genaues Übersetzen ist Reflexion über den Inhalt des Textes. Man sieht dies jetzt auch am sechsten, letzten Beispiel, nämlich an der neuen Ausgabe und Übersetzung von Predigt 󰀆󰀃, die Walter Haug in den Lectura Eckhardi vorgelegt hat󰀈󰀃 und die das Verständnis der Predigt erst wirklich ermöglicht. Dabei spielt der bestimmte Artikel eine alles entscheidende Rolle. Der Bibeltext ist 󰀁Io 󰀄:󰀁󰀆: Deus caritas est, et qui manet in caritate, in deo manet, et deus in eo. Man liset hütt da heimē in der epistel, das sanctus Iohannes spricht: ›got ist die mynne, vnd der in der mynne ist, der ist in got, vnd got ist in im‹. Nun sprich ich: ›got ist mynne [Quint: die mynne], vnd der in mynne [Quint: in der mynne] ist, der ist in got, vnd er ist in im‹. Das ich sprich: ›got ist mynne [Quint: die mynne]‹, das tůn ich dar vmb, das man beleibe pey ain. Nu merckent! Wenn man spricht: ›got ist die mynne‹, da möchti ain frag in uallen, wely mynne er wäre, wann me mynn ist denn aini, vnd da mit so gieng man von ain. Vnd dar vmbe, das man beleibe bey ain, so sprich ich: ›got ist mynn‹.󰀈󰀄 Eckhart führt eine feine Unterscheidung ein: Entgegen dem deutschen Usus got ist d ie mynne sagt er genau wie im Lateinischen (Deus caritas est): got ist mynne. Damit meint er, Gott sei nicht die oder die, diese oder jene minne, sondern minne schlechthin. Quint hatte in seiner Edition durch die Einführung des bestimmten Artikels in allen Fällen dieses Verständnis verunklart, Walter Haug hat es wieder freigelegt, indem er den üblichen Gebrauch im Deutschen (die mynne) von Eckharts Gebrauch (mynne) unterscheidet; dort eben, wo Eckhart „Liebe schlechthin“ meint. Eckhart will damit sicherstellen, dass jedes partikuläre Verständnis überstiegen wird hin zur Einen Liebe schlechthin. Und er macht 󰀈󰀃. Walter Haug, ,Predigt Nr. 󰀆󰀃 “got ist mynne”‘, in ibid. 󰀂󰀀󰀁-󰀁󰀇. 󰀈󰀄. Pr. 󰀆󰀃, G. Steer und L. Sturlese, Lectura Eckhardi I (󰀁󰀉󰀉󰀈); Übersetzung Haugs, ibid. 󰀂󰀀󰀃: „Man liest heute bei uns in der Epistel, dass der Hl. Johannes sagt: ʽGott ist die Liebe, und wer in der Liebe ist, der ist in Gott, und Gott ist in ihm.ʼ Doch ich sage: ʽGott ist Liebe, und wer in Liebe ist, der ist in Gott, und er ist in ihm.ʼ Wenn ich sage ʽGott ist Liebeʼ, dann deshalb, damit das Einzig-Eine im Blick bleibe. Denn bedenkt: Wenn man sagt, Gott ist d i e Liebe, so könnte einem die Frage einfallen, welche Liebe er sei, denn es gibt mehr als eine Liebe, und damit wendete man sich vom Einzig-Einen ab. Damit aber das Einzig-Eine im Blick bleibe, sage ich: ʽGott ist Liebe.ʼ“ Vgl. schon den Hinweis bei F. Tobin, ,Creativity and Interpreting Scripture‘ (󰀁󰀉󰀈󰀂), 󰀄󰀁󰀃.

󰀁󰀁󰀈

F REIMUT L ÖSER

dieses Verständnis am Gebrauch oder Nicht-Gebrauch des bestimmten Artikels fest, den er kommentiert. Nimmt man die Beispiele zusammen, ergibt sich: Das bîwort in der schuole ist kein Einzelfall. Eckhart hebt die Grenze zwischen dem Unterricht in der schuole und der Unterrichtung des Publikums in seinen deutschen Predigten weitgehend auf. Sein Konzept von schuole ist ein umfassendes. Seine Übersetzung und Exegese bedient sich ,schulischer‘ Mittel und setzt diese bewusst ein. Eckharts Übersetzungen sind von einem hohen Reflexionsgrad, seine Übersetzung ist schon Exegese, und die Grammatik und ihr Gebrauch schärfen nicht nur seine exegetische Methode. Sie sind Mittel (und Kategorien) der Gotteserkenntnis. Die Theologie der Einheit fußt – auch – auf einer Grammatik der Einheit zwischen Deutsch und Latein, zwischen den Zeichen und dem Bezeichneten; eine Grammatik der Einheit, die gerade durch die Zweisprachigkeit genaue Analysemethoden zur Verfügung stellt. Eckhart nutzt die grammatischen Gegebenheiten des Textes und die Methoden des Grammatikers als Sonde, um zur Bedeutung des wortes auf allen Ebenen durchzudringen, um die Heilige Schrift zu ‚durchgraben‘. Nach den Schritten dieses Beitrags könnte man sagen: Die Gelehrsamkeit aus Paris und die Weisheit der Schule ist einerseits noch nicht der wahre Schlüssel zu Gott. Die diffizilen Fragen der Gelehrtenwelt sind andererseits kein verschlossener Elfenbeinturm. Der Turm der Wissenschaft öffnet sich auch dem Publikum der deutschen Predigten. Die Wahrheiten der Wissenschaft gehen alle an. Die Wissensbarriere ist niedergerissen und die Sprachbarriere ist überschritten. Die Universität Paris steht dabei vor allem für die Überprüfung der ‚Korrektheit‘ theologischer Lehre, für die großen Debatten der Gelehrten, für die Fragen nach dem Vorrang von vernünfticheit oder wille, für die Frage nach der Gotteserkenntnis und der Gottessohnschaft des Menschen, nach den Kräften der Seele, der Erfüllung der Heiligen Schrift und ihrem rechten Verständnis. Die schuole bringt Eckhart ins Wort, wenn er betonen will, dass der rechte Lehrmeister für das wahre Leben Christus ist, mehr noch aber, wenn die 󰀁󰀀 Seinskategorien des Aristoteles (als Gegenstand der ‚Kleinen Meister‘), die Lehre vom Bild, abermals die Frage der Schriftauslegung, besonders aber der Grammatikunterricht angesprochen werden.

M EISTER E CKHART ,

DIE SCHUOLE , DIE

G RAMMATIK

UND DIE

B IBEL

󰀁󰀁󰀉

In seinen deutschen Predigten rekurriert Eckhart auf die Universität und die schuole gleichermaßen dort, wo die sprachliche und inhaltliche Seite der Schriftauslegung betroffen ist. Der Gebrauch der Grammatik und die Reflexion darüber spielt besonders im Bereich der Übertragung von Schriftworten vom Lateinischen ins Deutsche und bei der Auslegung eben dieser Schriftworte eine bedeutende Rolle (im zweifachen Sinn des Wortes). Eckharts Grammatik ist in den deutschen Predigten Methode der Exegese und selbst Gegenstand der Reflexion. Aber erst der wissenschaftlich geschulte Umgang mit der Grammatik und deren Gebrauch können die Heilige Schrift ‚durchgraben‘, den Charakter der gleichnuß gleichzeitig offenlegen und dorthin vorzudringen versuchen, wo man die heilig geschrifft [...] bedeutten moͤg also bloß, als sy ist. Dazu bedarf es beim Übersetzen, das oft zu verblüffenden Ergebnissen kommt, der Abweichung von Gewohntem und des Nachdenkens über Wortarten, Kasus, Modi, Zeitenfolge und Syntax. Eckhart erweist sich in der deutschprachigen Bibelübersetzung und -exegese als versierter Grammatiker.

Deconstructing Sophisms in Meister Eckhart CHRISTOPHER M. WOJTULEWICZ LEUVEN, BELGIUM󰀁 Abstract Whilst sophisms were in common use in the late thirteenth and early fourteenth centuries as a logical exercise, Meister Eckhart makes rare use of them in his works. Nevertheless, in the one example he uses, not originally intended for use within Trinitarian debates, Eckhart develops an interesting use of language which sets his consideration of the sophism distinct from others. Eckhart plays on the linguistic frustrations the sophism evokes in order to achieve the communication of a complex reality he sees about Trinitarian life. His use of the sophism is not as a device for training in grammar or dialectic, like a riddle to be solved; but is an opportunity to question his understanding of the relationship between language and reality, including the problems of applying language to God. I argue that Modism introduces what I am terming an ‘onto-syntactic’ calculation of the analogical relationship between God and language. This is distinguished, but not separated, from the semantic meaning, on which the question of analogical relationship would normally rest. Exploring Eckhart’s use of a sophism allows us to consider Modistic influence, and to understand his broader conception of the relationship between language and reality. Sophismata Literature

T

he history of the use of sophisms in theological literature is not entirely established. Yet it seems that, at least by the early-mid fourteenth century, sophismata were beginning to be used within the 󰀁. Christopher M. Wojtulewicz is currently a Free Research Associate in both the Research Unit of History of Church and Theology, and the Institute for the Study of Spirituality at KU Leuven.

󰀁󰀂󰀂

C HRISTOPHER M. W OJTULEWICZ

confines of the ‘logical matters of revelational theology’.󰀂 The most prominent example, it would seem, of the ‘systematic application of sophistic technique to theology’, and the ‘only known example of purely theological sophismata’ (the Centiloqium theologicum), came from Arnold of Strelley.󰀃 We must note that Eckhart uses, although only in one instance, a sophism within the context of his Commentary on Wisdom, and that this would, if Gelber is correct, constitute one of the earliest examples – probably earlier than Strelley – of such a mixing of sophismata and theology. But the evolution of the use of sophismata, or their constitutive problems at least, is difficult to categorise authoritatively, so such a claim about Eckhart would be hard to substantiate. If Ebbesen is correct, it is in fact the theologians’ preoccupation (from at least the twelfth-century) with ‘syncategoremes or other difficult words’ (tantum, solus etc.) which goes on to influence the rise of sophismata literature, and that from ‘the second half of the 󰀁󰀃th century the current goes the other way’.󰀄 Nevertheless, Eckhart’s evoking of a sophism distinctly diverges from the sophistic tradition as it had emerged, in that it is quoted in the context of a broader argument in his biblical commentary, and not in the quaestio structure usual to sophismatic explanation.󰀅 As a result, his deployment of it serves a distinct aim. There are a number of concerns we will turn our attention to here: 󰀁. 󰀂. 󰀃. 󰀄.

Some of the various ways the sophism Eckhart uses is dealt with in the medieval period. The broader elements of Modistic grammar we need to keep in mind. The context and meaning of Eckhart’s use of the sophism. Eckhart’s understanding of language from the perspectives of correlative terms, the use of the exclusive particle tantum, and the analogical or dialectical dimensions of his thought regarding negation or exclusion.

󰀂. Simo Knuuttila, ‘Trinitarian Sophisms in Robert Holcot’s Theology’, in Stephen J. Read (ed.), Sophism in Medieval Logic and Grammar, Nijhoff International Philosophy Series 󰀄󰀈 (Dordrecht, 󰀁󰀉󰀉󰀃), 󰀃󰀄󰀈-󰀅󰀆, here 󰀃󰀄󰀉. 󰀃. Hester Goodenough Gelber, It Could Have Been Otherwise: Contingency and Necessity in Dominican Theology in Oxford 󰀁󰀃󰀀󰀀-󰀁󰀃󰀅󰀀 (Leiden, 󰀂󰀀󰀀󰀄), 󰀈󰀁. 󰀄. Sten Ebbesen, ‘Tantum unum est. 󰀁󰀃th-Century Sophismatic Discussions Around the Parmenidean Thesis’, The Modern Schoolman LXXII (󰀁󰀉󰀉󰀅), 󰀁󰀇󰀅-󰀉󰀉, here 󰀁󰀈󰀀. 󰀅. Ibid., 󰀁󰀇󰀉.

D ECONSTRUCTING S OPHISMS

IN

M EISTER E CKHART

󰀁󰀂󰀃

The sophism Eckhart uses is ‘si tantum pater est, non tantum pater est’.󰀆 We will term this the ‘pater-sophism’. Perhaps it is most likely that Eckhart would have encountered this sophism when studying in Cologne or Paris, but what we wish to do here is consider some of the ways in which Eckhart’s thought seems to suggest Modistic influences and thus the possibility of the influence of his Erfordian counterpart, Thomas of Erfurt. One of these ways is to suggest that Eckhart does put stress on the ability to speak about things ‘in different ways’;󰀇 ways which perhaps are seemingly paradoxical, not to engineer a conflict, but to use seemingly contradictory statements to capture the reality of the divinity that Eckhart wishes to signify. As the influence of Modism is a question of the way in which language is conceived as related to reality, in some measure it must take into account Eckhart’s understanding of analogy and dialectic. In this latter sense, in dialectic, we are considering something which is suggested to belong to Eckhart’s rejection or modification of Thomistic theories of analogy;󰀈 but it is also a question of the relationship between opposites: between assertion and negation, as far as language is concerned. One of the most common problems faced by the scholastic in dealing with sophismata was what to do with the particle of exclusion (solus, tantum etc.) with respect to the Parmenidean thesis regarding the unity of being.󰀉 Another popular sophism of his time, which considers the difficulty similarly, is ‘tantum unum est’; but the pater-sophism, not so obviously related to the Parmenidean thesis,󰀁󰀀 is the one Eckhart uses and the focus of our attention. Sten Ebbesen has already conducted considerable research into the use of this particular sophism in the thirteenth and fourteenth centuries, as well as the appearance of other sophisms that made use of the particle of exclusion. Eckhart’s pater-sophism was widely used in the medieval period because of its relevance in commenting on 󰀆. For an exploration of some of the other uses of this particular sophism, see Sten Ebbesen, ‘Si tantum pater est, non tantum pater est: An English Sophisma from the Late Thirteenth Century’, Vivarium 󰀅󰀃 (󰀂󰀀󰀁󰀅), 󰀃󰀃󰀆-󰀅󰀂. 󰀇. Christopher M. Wojtulewicz, Meister Eckhart on the Principle (Leuven, 󰀂󰀀󰀁󰀇), 󰀃󰀅-󰀄󰀀. 󰀈. See McGinn’s brief summary of this issue, and the related literature in Bernard McGinn, The Mystical Thought of Meister Eckhart: The Man From Whom God Hid Nothing (New York, NY, 󰀂󰀀󰀀󰀁), 󰀉󰀂-󰀃. 󰀉. S. Ebbesen, ‘Tantum unum est’ (󰀁󰀉󰀉󰀅), 󰀁󰀇󰀅-󰀉󰀉, here 󰀁󰀇󰀆. 󰀁󰀀. Ibid.

󰀁󰀂󰀄

C HRISTOPHER M. W OJTULEWICZ

Aristotle’s Physics I.󰀂 (󰀁󰀈󰀅a).󰀁󰀁 There, Aristotle made use of the analysis of the term principium in order to explain that when one has a principium it necessarily follows that there is a principiatum because it is integral to the definition that principium must be the principle of something.󰀁󰀂 Although we must note that Aristotle does not treat correlative terms (which are integral to Eckhart’s sophism) in this part of the Physics, Eckhart’s sophismatic problem, so to say, begins with the application of an exclusive particle; hence the scholastics pose the question ‘whether an operator of exclusion when added to one of two correlatives excludes the other’.󰀁󰀃 So the first problem that the sophism poses is what to do with the operator or particle of exclusion, tantum, when it is applied to the correlative term pater? Two Ways of Dealing with the Sophism For the purposes of our discussion here, I want to highlight two ways that this was dealt with in the medieval period. The first is the use of two ways that the term on which the particle of exclusion operates can be understood – one categorematic, the other syncategorematic. The second is the use of symmetry and asymmetry between the two correlative terms. In both instances it changes the function of the relationship between the particle of exclusion and the correlative terms. We here observe one of the reasons why this sophism was only ever used as an exercise, and not in relation to the Trinity. Many of the solutions offered were based on the fact that the correlative term used was a ‘concrete accidental’,󰀁󰀄 by which is meant that two constituents are posited of a noun: ‘substance and quality’.󰀁󰀅 The idea, then, is that the particle of exclusion may be said to work on one, and not the other; thus, it may exclude one in the first instance (‘tantum pater est’), but not necessarily deny the other to the correlative term in the second instance (‘non tantum pater est’). Thus in the case of the pater-sophism, the question would be: does the particle of exclusion (tantum) operate on pater understood as a form (the form of being a father) or as both form and substance (an 󰀁󰀁. Ibid., 󰀁󰀇󰀈. 󰀁󰀂. Ibid., 󰀁󰀇󰀇. 󰀁󰀃. Ibid. 󰀁󰀄. Ibid., 󰀁󰀈󰀂. 󰀁󰀅. Ibid., 󰀁󰀈󰀉.

D ECONSTRUCTING S OPHISMS

IN

M EISTER E CKHART

󰀁󰀂󰀅

actual, existing father, or even this or that father). In the first case the sophism could be rendered: ‘only “father” is’; in the second: ‘only a/the father is’. The first way – a ‘categorematic’󰀁󰀆 explanation – renders the sophism unproblematic in the sense that the tantum does not deny the possibility of there being many instances of ‘father’. The second way – a ‘syncategorematic’󰀁󰀇 explanation – identifies the singular instance of being ascribed to a father, and thus denies being to the correlative (a son). Another explanation of this and similar sophisms includes an appeal to the ‘symmetry’ or ‘asymmetry’ of the correlative terms; and where asymmetrical, an independence of the terms exists such that a priority in the two correlatives could be introduced.󰀁󰀈 This immediately breaks down in the application of the pater-sophism to the Trinity, because an asymmetric reading of the two correlatives – the Father and the Son – is to admit of subordinationism; and the symmetric somehow posits both a logical necessity to the two relata, and an identity between the two distinct relations of paternity and filiation on the basis of an identical nature in both relata. In both cases the difficulty of the sophism’s explanatory power with respect to the inner life of the Trinity directly relates to the theoretical relationship between language and reality (there is no substance and quality in the Father; the Father and Son are equal); but not just in terms of the semantic, also in terms of the possibilities and impossibilities in syntax. The syn/categorematic division of substance and quality, matter and form, and so forth, ought to hold our attention as important in considering the Modistic conception of the relationship between language and reality. This is because hylomorphic theory is particularly important to Modistic grammar.󰀁󰀉 Modistic Grammar It is in Modistic theory that the relationship between matter and form has a direct bearing on the syntactical formation of the sentence.󰀂󰀀 󰀁󰀆. Ibid. 󰀁󰀇. Ibid. 󰀁󰀈. Ibid., 󰀁󰀈󰀅. 󰀁󰀉. G.L. Bursill-Hall, Grammatica Speculativa of Thomas of Erfurt (London, 󰀁󰀉󰀇󰀂), 󰀂󰀄. 󰀂󰀀. Elena Lombardi, The Syntax of Desire: Language and Love in Augustine, the Modistae, Dante (Toronto, 󰀂󰀀󰀀󰀇), 󰀇󰀉.

󰀁󰀂󰀆

C HRISTOPHER M. W OJTULEWICZ

One of the important features of Modism was to try and make sense of the general linguistic relationship between the noun and the verb. This is because, at least insofar as analogical language is concerned (how does language about God work?) a central issue is the extent to which language enshrines movement (verb) and fixity (noun). Boethius of Dacia was concerned with the treatment of the noun motus. Even though motion suggests, naturally, that something can be divided into parts, nevertheless the ‘nounal’ nature of the word expresses the fact that the moving thing remains one in essence.󰀂󰀁 Therefore no matter how much one wishes to divide or to ascribe motion, one can still indicate the overall unity of that to which the noun refers. Unity, which for Eckhart is caught up in the dual meaning of unum as both ‘negative’ (indistinct) and ‘affirmative’ (exclusion of non-being by virtue of the ‘negation of negation’),󰀂󰀂 is part of what must be considered in order to understand the relationship between God and the world. With respect to unum, our attention is drawn to the sophism mentioned earlier, which we could term the ‘unum-sophism’. Though the sophism ‘tantum unum est’ is not considered by Eckhart, he does nevertheless use the application of the exclusive particle (tantum) to unum when he considers the indistinct nature of being in the phrase ‘being is God’, which draws on Parmenides, Melissus, and Aristotle.󰀂󰀃 The unum-sophism, which has the same roots in Aristotle’s Physics as the pater-sophism, joins the pater-sophism in evoking the issue of correlative terms (‘one’ as correlative of ‘many’) in the commentary tradition, and can be seen from its full expression: ‘tantum unum est, non ergo multa sunt’.󰀂󰀄 Reliance on Aristotle’s Physics among the Modistae shows the grammatical model of Modism resting on the connection physica has to motus.󰀂󰀅 Thus the motus of physica belongs to the sentence as much as structure and syntax belong to nature. Assessment of Eckhart’s Modistic leanings is, in part, a question of whether, through a reliance on Aristotle’s Physics, his language concerning nouns and verbs draws upon the terminology 󰀂󰀁. See Claire Taylor Jones, ‘The Trouble with Verbs: Meister Eckhart and the Tropology of Modistic Grammar’, Mystics Quarterly 󰀃󰀅, No. 󰀃/󰀄 (󰀂󰀀󰀀󰀉), 󰀉󰀉-󰀁󰀂󰀆, here 󰀁󰀁󰀃. 󰀂󰀂. In Sap. n. 󰀁󰀄󰀇, LW II 󰀄󰀈󰀅,󰀅-󰀇. See also B. McGinn, The Mystical Thought (󰀂󰀀󰀀󰀁), 󰀉󰀃. 󰀂󰀃. Prolog. in Opus propositionum n. 󰀅 LW I/󰀁 󰀁󰀆󰀈,󰀆-󰀁󰀆󰀉,󰀂. 󰀂󰀄. S. Ebbesen, ‘Tantum unum est’ (󰀁󰀉󰀉󰀅), 󰀁󰀇󰀈. 󰀂󰀅. E. Lombardi, The Syntax of Desire (󰀂󰀀󰀀󰀇), 󰀉󰀄.

D ECONSTRUCTING S OPHISMS

IN

M EISTER E CKHART

󰀁󰀂󰀇

which had accrued to the modist position, such as ‘quies [...], terminus, fluxus, successio, distantia’.󰀂󰀆 There is an inherent difficulty with this, however, for Modism is characterised by a shift in emphasis with respect to the essential features of grammatical theory, rather than something completely new, as Kelly illustrates: ‘their change of emphasis is no evidence of the new type of rationality Foucault would expect to see in an intellectual revolution.’󰀂󰀇 Beyond this we can even say that it is more than just a question of reflecting a certain Modistic hylomorphic (and thus ‘desire’ oriented) model of nature in linguistic structure󰀂󰀈 – this mutual reciprocity and circularity between grammar and nature has a theological form through mutual desire, one for the other, and the pursuit of perfect construction as participation in rather than mere reflection of reality. The Modistae, it seems, were less concerned with the communicative qualities of language (what Kelly calls the ‘ideal speaker-hearer’) than with describing how linguistic expression flows from understanding (what Kelly calls the ‘ideal thinker-speaker’).󰀂󰀉 Elena Lombardi makes this Modistic relation between the motion of the world and the syntactic structure of language clear in the following way: ‘when the grammarians pattern their theory of language on nature, they embrace a basic structure of nature as motion – as movement, change, alteration, transformation, birth, death, and decay; and they consider motion as a satisfaction of a potentiality propelled by the mutual desire of matter and form. What in nature is movement, in grammar is construction.’󰀃󰀀 But where does it leave language about God? Lombardi suggests the Modistic desire-ordered, circular nature of perfectio (the completed sentence) is oriented to Aristotle’s unmoved mover.󰀃󰀁 But in another way this is not a question which is to be answered by the grammarian, for it considers semantics more than perfect structure: whether and to what extent the 󰀂󰀆. Ibid. 󰀂󰀇. Louis G. Kelly, The Mirror of Grammar: Theology, Philosophy, and the Modistae (Amsterdam, 󰀂󰀀󰀀󰀂), 󰀂󰀁󰀄. 󰀂󰀈. E. Lombardi, The Syntax of Desire (󰀂󰀀󰀀󰀇), 󰀇󰀈-󰀈󰀀. 󰀂󰀉. L.G. Kelly, The Mirror of Grammar (󰀂󰀀󰀀󰀂), 󰀂󰀁󰀃. 󰀃󰀀. E. Lombardi, The Syntax of Desire (󰀂󰀀󰀀󰀇), 󰀉󰀄. 󰀃󰀁. Ibid., 󰀁󰀂󰀀.

󰀁󰀂󰀈

C HRISTOPHER M. W OJTULEWICZ

meaning in what we say about God can bear any relation to God’s essence, to his nature as it is in Godself. Nevertheless, if language structure is dependent on physica, on motion, it is not simply that God is motionless and thus eternally out of the reach of language; but that the motion of language is the creaturely reality in which the ‘beyond’ of the Divine is found, as the quintessence of the analogical relationship. On this foundation, an entire metaphysics of the creature can be formed. Language which speaks of God, therefore, contains within it, insofar as it is possible to speak correctly or with greater or lesser similarity in what is signified about the Divine, the ‘beyond’ of God. This ‘beyond’ of God is ultimately failed by the creaturely modus of syntactic or semantic content, encountered as it is in an ever-increasing manifestation of unquantifiable dissimilitude between the creature and the Creator. The basis of this greater dissimilitude evinced through every similarity belongs to the Fourth Lateran Council’s declaration against the Trinitarian errors of Joachim of Fiore in 󰀁󰀂󰀁󰀅.󰀃󰀂 The different meanings of the sophism (in terms of the syn/categorematic interpretations) in a sense belong to the same logic as the distinction between what is signified and consignified. Although bearing upon the concrete circumstances which the sentence enacts, consignification is not viewed by the Modistae with any distaste; in fact, for Modism ‘significare is already consignificare’.󰀃󰀃 This is the sense in which reality weighs heavily upon the modist conception of language – all language already bears the imprint of the concrete, of time, space, and so forth. Conversely, where the reality in question is unsignifiable, it is so strictly because it is unknowable (viz. the relationship between the modus intelligendi and the modus significandi) and only by attribution of some other intelligible mode can it in any sense be signified.󰀃󰀄 Signification falls apart when those linguistic operations that necessarily anchor language to reality (in ‘opposition, likeness, or combination’)󰀃󰀅 are frustrated by the 󰀃󰀂. See Heinrich Denzinger, Enchiridion symbolorum definitionum et declarationum de rebus fidei et morum: Compendium of Creeds, Definitions, and Declarations on Matters of Faith and Morals, ed. Peter Hünermann, Helmut Hoping, Robert L. Fastiggi, Anne Englund Nash (San Francisco CA, 󰀂󰀀󰀁󰀂), 󰀂󰀆󰀉. 󰀃󰀃. E. Lombardi, The Syntax of Desire (󰀂󰀀󰀀󰀇), 󰀉󰀉. 󰀃󰀄. Ibid., 󰀁󰀀󰀀. 󰀃󰀅. Ibid.

D ECONSTRUCTING S OPHISMS

IN

M EISTER E CKHART

󰀁󰀂󰀉

unknowable. Without repeated chastisement of one’s choice of mode, one simply attributes to God without caveat things belonging to the created order. In Aquinas (and Eckhart) signification of a truth regarding the Divine Essence is possible (e.g. ‘God is Good’ has some purchase on the res significata of the Divine Essence), but only on the understanding that the manner or mode in which it is signified (the modus significandi) can only ever draw upon the creaturely, on the becoming that belongs to the consignified modi significandi.󰀃󰀆 Between the stability of the noun and the movement that belongs to the verb, which is what is captured in the contructio of the sentence, is the tension that belongs to this distinction between the res significata and the modus significandi with respect to God. This means that the result is a particular kind of silence: not a silence which means straightforwardly ‘no speech’; but an acknowledgement that the res may be signified even if, simultaneously, the modi available to us in (con)signification can never express the truth of how that res is in God – for it is a truth we cannot know. Because we cannot know it, it cannot be signified. For the creature, the modi can be said to consignify differently, as when Eckhart says that the word ‘is’ and the word ‘existence’ ‘signify the same [thing], but by different consignifications’.󰀃󰀇 With respect to God, however, in his Commentary on Genesis, Eckhart states that the ‘Word, which is in the silence of the paternal intellect, is a Word without a word [or verb]’.󰀃󰀈 The juxtaposition of ‘Word’ and ‘silence’ is possible because of the disjunction between the res significata (Word) and the modus significandi (word). Admitting of this dissimilitude between God and the creature is what gives Eckhart license, so to say, to indulge a freedom offered by language – a ‘forcing into the sensuous, material sign the character of its own self-subversion as signifier.’󰀃󰀉

󰀃󰀆. See Thomas Aquinas, Summa Theologica Ia, q. 󰀁󰀃, especially a. 󰀃 and 󰀅. See also Peter Weigel, Aquinas on Simplicity: An Investigation into the Foundations of his Philosophical Theology (Bern, 󰀂󰀀󰀀󰀈), 󰀁󰀉󰀈-󰀂󰀁󰀃 and Erline Jennifer Ashworth, ‘Signification and Modes of Signifying in Thirteenth-Century Logic: A Preface to Aquinas on Analogy’, Medieval Philosophy & Theology 󰀁 (󰀁󰀉󰀉󰀁), 󰀃󰀉-󰀆󰀇. 󰀃󰀇. In Sap. n. 󰀁󰀉, LW II 󰀃󰀄󰀀,󰀇-󰀈. 󰀃󰀈. In Gen. I n. 󰀇󰀇, LW I/󰀁 󰀂󰀃󰀉,󰀄-󰀅. 󰀃󰀉. Denys Turner, Faith, Reason and the Existence of God (Cambridge, 󰀂󰀀󰀀󰀄), 󰀁󰀀󰀂.

󰀁󰀃󰀀

C HRISTOPHER M. W OJTULEWICZ

The Meaning of the Sophism in Eckhart’s Text The context in which the sophism is introduced in the Commentary on Wisdom is especially helpful, in virtue of the degree to which the sophism is quoted in passing. The sophism really ought to grip our attention all the more as a result of the brevity of its treatment, for its value (or even ‘solution’) is a complex matter of logic, making it seem wholly out of place as a quote made in passing. The part of the Commentary in which the sophism appears is on the text of Wisdom 󰀇:󰀁󰀁 ‘all good things came to me together with her’.󰀄󰀀 Koch highlights for us the direction in which we have to travel to understand both this sophism and Eckhart’s use of it. Koch makes the point that it is employed in order to question what exactly an ‘exclusive particle (solus, tantum)’ can be said to include and exclude from a sentence, suggesting that in fact, contrary to the popular opinion of his day, Eckhart thinks it does not exclude the correlative term (Son) in this case.󰀄󰀁 Here we have the sophisticated use of the exclusive particle (tantum), which we must examine on the grounds of the broader grammatical theory of the relationship between language and reality, and the relationship between God and creatures. Nevertheless, Koch highlights that this sophism is not generally used when discussing the Trinity. Whether in fact Eckhart is using it to probe the doctrine of the Trinity remains to be seen: the relation between a father and a son in creatures seems tightly interwoven with that same relation within the life of God in this text. As a result we must bear in mind two things which we must treat cautiously: Koch acknowledging the problem of translating the sophism due to its Latinity (might this indicate that Koch was unsure what to make of Eckhart’s use of it?), and his further suggestion that we must append to the end of the sophism ‘therefore also a Son’.󰀄󰀂 This appendage relates to the essence of what this sophism is asking. Our attention is first drawn to the fact that ‘Father’ is a correlative term; thus to speak of a father is also to make mention of a son, because one cannot have a father without a son, or a son without a father. The initial problem lies in the fact that to assert that ‘only a father is’ simultaneously asserts the existence of the correlative – ‘a son is’ – whilst also (seemingly) 󰀄󰀀. In Sap. nn. 󰀉󰀆-󰀁󰀀󰀉, LW II 󰀄󰀂󰀉,󰀁󰀀-󰀄󰀄󰀅,󰀈. 󰀄󰀁. See the explanatory notes in LW II 󰀄󰀃󰀇. 󰀄󰀂. Ibid.

D ECONSTRUCTING S OPHISMS

IN

M EISTER E CKHART

󰀁󰀃󰀁

denying it. This fell under the specific scholastic question, as noted before, of ‘whether an operator of exclusion when added to one of two correlatives excludes the other.’󰀄󰀃 The sophism that Eckhart quotes falls within a section of his Commentary which seeks to understand the relationship between begetter and begotten. Before quoting the sophism Eckhart takes the common example of fire in order to illustrate this relationship. What Eckhart intends to highlight here is the oneness of the relationship between the Father and the Son according to this mode of analysis. Now Eckhart says, to come to the ad litteram, ‘the Father as Father is not in [that which is] altered, but in the generated Son’.󰀄󰀄 Why ad litteram? It is because Eckhart wants to consider the Father as Father, just as is expressed by tantum pater: what is it that constitutes the Father? This is to suggest that the Father is the Father by virtue of being in the Son, in whom he remains, not by the act of generating the Son. The act of generation, which indeed the Father does, is therefore somehow superfluous to his definition as Father. Eckhart makes the point in a way which contrasts the example of fire and igniting with the example of the Father: ‘there [he] operates, not now [in] the work of igniting, but [in] the work of the fire [...] The Father as Father is not in [that which is] altered, but in the generated Son’.󰀄󰀅 He goes on ‘John 󰀁󰀄: “I am in the Father and the Father is in me”. The Father and the Son are simultaneously [one] nature, work and intellect’.󰀄󰀆 The Father in this sense only passes through the ‘alteration’, but remains in the generated Son or fire. The emphasis, then, is on the stability of remaining within, and the oneness which characterises the ‘nature, work and intellect’ of the Father and the Son. This is the immediate context in which the pater-sophism is then introduced. He says: ‘therefore what we say sophistically: “if only the Father is, [then] not only the Father is”. “The Father”, he says, “remains in me”.’󰀄󰀇

󰀄󰀃. S. Ebbesen, ‘Tantum unum est’ (󰀁󰀉󰀉󰀅), 󰀁󰀇󰀇. 󰀄󰀄. In Sap. n. 󰀁󰀀󰀁, LW II 󰀄󰀃󰀇,󰀃. Emphasis mine. 󰀄󰀅. In Sap. nn. 󰀁󰀀󰀀-󰀁󰀀󰀁, LW II 󰀄󰀃󰀇,󰀁-󰀃: ‘[...] ibi operatur non iam opera igniti sed opera ignis [...] pater ut pater non est in alterato sed in genito filio’. 󰀄󰀆. In Sap. n. 󰀁󰀀󰀁, LW II 󰀄󰀃󰀇,󰀄-󰀅: ‘Ioh. 󰀁󰀄: “ego in patre, et pater in me est”. Pater enim et filius simul sunt natura, opere et intellectu.’ 󰀄󰀇. In Sap. n. 󰀁󰀀󰀁, LW II 󰀄󰀃󰀇,󰀅-󰀆: ‘Propter quod dicunt sophistice: »si tantum pater est, non tantum pater est«. “Pater”, inquit, “in me manens”.’

󰀁󰀃󰀂

C HRISTOPHER M. W OJTULEWICZ

There is much more to the sophism than first appears to be the case, as we have seen. Our contextualisation of the use and treatment of this sophism causes us to consider ideas that we perhaps would not have otherwise considered. The relation between the Father and the Son is understood as permanent – a ‘remaining in’ – separate from the nature of alteration and change. But thinking for a moment about what ‘remaining in’ means is perplexing: ‘in manens’, from which we derive immanence, has the motion or change proper to a verb (manere), yet signifies its opposite in some sense – a ceasing of movement. Eckhart has already said that the ‘fixity’ that comes from the source is ‘in repose and in silence’;󰀄󰀈 so we may say, in a certain sense, manere is a ‘quiet’ or ‘silent’ verb. This description is not without significance relative to the history of the grammarians’ understanding of both the relationship between the noun and the verb, and the general sense of motion which belongs to the formed sentence. Louis Kelly highlights the various forms used by the grammarians of the thirteenth century: the ‘modus habitus’ (note that this is the subject matter of the next part of Eckhart’s Commentary, immediately following the pater-sophism) relates to both the ‘modus fixi’ and ‘modus permanentis’ of ‘noun and pronoun’, but these are ‘eventually overshadowed by the Arab-flavoured modus quietis, which applied equally well to principium and terminus of a motus.’󰀄󰀉 The expression ‘fixity’ is explained elsewhere in reference to God who ‘makes firm’ and ‘stabilises’ by means of ‘fixity and immobility or immutability’.󰀅󰀀 And as Eckhart notes in the Prologue to the Work of Propositions, in receiving its form, fire has stability and ‘fixity’ from the ‘First Cause’.󰀅󰀁 However ‘bitter’ and ‘restless’ the nature of ‘becoming’ may be in itself (as contrary to the fixity of being), the dichotomy between being and becoming is not so strict as to make becoming independent of being: all becoming requires being, Eckhart says, and in this way can be said to nevertheless be ‘still’, ‘quiet’, ‘pleasant’, and ‘sweet’ in the being on which its nature as ‘becoming’ relies.󰀅󰀂 This is a significant concession 󰀄󰀈. In Sap. n. 󰀁󰀀󰀀, LW II 󰀄󰀃󰀆,󰀇. 󰀄󰀉. L.G. Kelly, The Mirror of Grammar (󰀂󰀀󰀀󰀂), 󰀂󰀀󰀄. 󰀅󰀀.  In Gen. I, n. 󰀂󰀇󰀂, LW I/󰀁 󰀄󰀁󰀀,󰀉-󰀁󰀅. 󰀅󰀁.  Prolog. in Opus propositionum, n. 󰀁󰀁, LW I/󰀁 󰀁󰀇󰀂,󰀂-󰀅. 󰀅󰀂. In Sap. n. 󰀁󰀉󰀀, LW II 󰀅󰀂󰀅,󰀅-󰀁󰀁: ‘advertendum est, quod ipsum fieri rerum, quod est a causis mediis et secundariis, utpote imperfectum et citra finem, ex sui natura amarum est, inquietum est. Ipsum autem esse, quod a deo et ab ipso solo est, quietum est, utpote perfectum et finis. Constat

D ECONSTRUCTING S OPHISMS

IN

M EISTER E CKHART

󰀁󰀃󰀃

to make regarding the otherwise highly dialectical opposition between being and becoming because not only is this instructive for the relationship between noun (as being) and verb (as becoming), it is also the basis on which the analogical relationship between God and creatures is to be considered possible. At the very least, the concern for ‘fixity’ relates to Boethius of Dacia, whose Quaestiones super De anima seem particularly concerned with this issue.󰀅󰀃 The motus of the pater-sophism as a sentence draws its dependency from the esse of the subject; but it is precisely in the absence of knowing that modus essendi (qua God) that the patersophism can withstand the frustration of the semantic content. However imperfect the nature of ‘becoming’ may be in itself, it is always dependent on being, and thus the foundation of the analogical is established. In the next part of the Commentary Eckhart more clearly defines the relationship between the fixed and the becoming – and therefore what we can make of the use of verbs or participles at all – by appealing to virtue as an example. Here Eckhart divides virtue into three: there is (󰀁) the ‘habit of virtue’ (the Father ‘in manens’); (󰀂) the ‘disposition’; and (󰀃) ‘virtue itself’.󰀅󰀄 Seemingly unrelated to the previous concerns, Eckhart’s use of these three ways of describing virtue is subtle, and relies on the aforementioned modus habitus. The first – the habit of virtue – he says is virtue which remains with the ‘offspring’.󰀅󰀅 This makes the enacting of virtue straightforward because it is, in a sense, contained within the virtuous person. The second – the disposition – is the opposite of the first, for the virtue is present only, as it were, ‘in passing’,󰀅󰀆 as with igniting wood, rather than the form of fire subsisting in the wood once lit. The result, Eckhart says, is that virtuous acts are met with ‘difficulty and resistance’,󰀅󰀇 much as he stated before with respect autem quod ipsum fieri nec est nec fieri est sine esse, quin immo ipsum fieri semper fundatur et figitur in quodam esse et est quoddam esse; et sic ipsum fieri in ipso esse quiescit et silet et in ipso esse suave fit et dulcescit sibimet et ei quod fit.’ See also In Ioh. n. 󰀁󰀇󰀀, LW III 󰀁󰀄󰀀,󰀆: ‘generatio enim in silentio est’. 󰀅󰀃. See Sten Ebbesen, ‘The Man who Loved Every [sic]: Boethius of Dacia on Logic and Metaphysics’, in Topics in Latin Philosophy from the 󰀁󰀂th-󰀁󰀄th Centuries, Collected Essays of Sten Ebbesen, vol. 󰀂, Ashgate Studies in Medieval Philosophy (Burlington VT, 󰀂󰀀󰀀󰀉), 󰀁󰀆󰀃-󰀇󰀉, especially 󰀁󰀆󰀉-󰀇󰀂. 󰀅󰀄. In Sap. n. 󰀁󰀀󰀂, LW II 󰀄󰀃󰀈,󰀆-󰀇. 󰀅󰀅. In Sap. n. 󰀁󰀀󰀂, LW II 󰀄󰀃󰀈,󰀈-󰀉. 󰀅󰀆. In Sap. n. 󰀁󰀀󰀂, LW II 󰀄󰀃󰀈,󰀉-󰀄󰀃󰀉,󰀂. 󰀅󰀇. In Sap. n. 󰀁󰀀󰀂, LW II 󰀄󰀃󰀉,󰀂.

󰀁󰀃󰀄

C HRISTOPHER M. W OJTULEWICZ

to the ‘imperfection’, ‘dissimilarity’ and the ‘murmuring resistance and opposition’ of alteration.󰀅󰀈 We hear in this something of the Modistic split between the pars orationis of the fixed noun or pronoun, and the becoming of the verb or participle.󰀅󰀉 The source remaining in the thing gives it the ‘nounal’ stability of form and existence, whence comes any alteration or change. The literal sense of the sophism, then, is the ontological confirmation of the correlative existence of the Father in the Son, and the Son in the Father, and thus the particle of exclusion cannot operate on the Father in a way which denies existence to the Son. Exactly the same relationship between being and becoming is set out in the Commentary on the Gospel of John with respect to the form of fire in a lit piece of wood, and the preparatory process (or ‘becoming’) which belongs to the igniting of the wood. Even here, after the disparagingly negative words used of the wood’s resistance to receiving the form (its ‘painful dissimilitude’ and ‘disquiet’), the generation of fire occurs ‘in the silence of every motion, time and dissimilitude’.󰀆󰀀 Once again, the relationship between being and becoming, between fixity and change, is being described in a way which could easily be mistaken as belonging only to the fixity: the motus occurs in ‘silence’. Such a relation, to reiterate, is the basis of a metaphysics of the creature which makes an analogical relationship between God and creatures possible.󰀆󰀁 The pater-sophism is thus introduced within the broader context of the analogia entis, the sophism itself then introducing, in a specific way, the role of negation or exclusion. With respect to the first manner in which Eckhart wishes to understand Wisdom 󰀇:󰀁󰀁, we must note that all convertible things come at once, ‘together’. The recipient determines how this is received – or whether it is received at all. Thus, Eckhart makes use of John 󰀁:󰀅 ‘The light shines in the darkness and the darkness did not comprehend it’.󰀆󰀂 The point is, he says, that the darkness does not comprehend the light, though it does apprehend it. In other words, as with man’s knowledge of God who is 󰀅󰀈. In Sap. n. 󰀁󰀀󰀂, LW II 󰀄󰀃󰀆,󰀅-󰀆. See also In Ioh. n. 󰀁󰀇󰀀, LW III 󰀁󰀄󰀀,󰀅-󰀆. 󰀅󰀉. G.L. Bursill-Hall, Grammatica Speculativa (󰀁󰀉󰀇󰀂), 󰀂󰀃-󰀄. 󰀆󰀀. In Ioh. n. 󰀁󰀂󰀉, LW III 󰀁󰀁󰀁,󰀁󰀀-󰀁󰀅. 󰀆󰀁. This issue was discussed at length by Erich Przywara in his celebrated Analogia Entis, trans. John Betz and David Bentley Hart (Grand Rapids MI, 󰀂󰀀󰀁󰀄). 󰀆󰀂. In Sap. n. 󰀉󰀆, LW II 󰀄󰀃󰀁,󰀂-󰀄.

D ECONSTRUCTING S OPHISMS

IN

M EISTER E CKHART

󰀁󰀃󰀅

unknowable in himself, the darkness is both aware of and shot through by the light, even if it is unable to comprehend it. This captures metaphorically the essence of what we might term Eckhart’s ‘negative theology’. In nn. 󰀇󰀇-󰀇󰀈 of the Commentary on Exodus he makes it clear that the literal and the metaphorical way of speaking about God is to be understood according to Pseudo-Denys and Augustine: ‘literal’ or ‘proper’ names of God are, strictly, affirmative and cannot be negative, because ‘affirmation has and includes existence [within it]’, whereas ‘every negative [statement], and they alone, include non-existence’.󰀆󰀃 The point is then seemingly reversed in n. 󰀇󰀈, when he quotes Pseudo-Denys as saying ‘negations concerning God are true, but affirmations are incompatible [with God]’.󰀆󰀄 In this sense Eckhart means to say that divine perfections are signified according to created being, but because they are abstracted from there, they are necessarily in an inappropriate modus significandi to be applied to God properly or literally, as before with the res significata and the modus significandi. What marks the difference, if any, between these two opposing formulations? The fact that what is true of God is expressed formally as negation of negation and thus affirmation, for this ensures that the fullness of being is ascribed to him – or, at the very least, non-existence is denied of him.󰀆󰀅 And this is the essential point. It is not simply that in the literal sense affirmation must be true and negation false, because existence belongs to the former and non-existence to the latter; but that in the metaphorical sense (that which is analogously signified according to the imperfect modus significandi of created being) that affirmation is false in virtue of its modus, not in virtue of its res. Eadem est scientia oppositorum We must ask whether the particle of exclusion of the pater-sophism applies to that which is correlative (‘Father’, or, conversely, ‘Son’) in the same fashion as the Aristotelian-Thomistic maxim ‘eadem est scientia oppositorum’.󰀆󰀆 This is to say that knowledge of something in the affirmative and 󰀆󰀃. In Ex. n. 󰀇󰀇, LW II 󰀈󰀀,󰀁󰀁-󰀈󰀁,󰀂. 󰀆󰀄. In Ex. n. 󰀇󰀈, LW II 󰀈󰀁,󰀃-󰀄. 󰀆󰀅. In Ex. n. 󰀇󰀄, LW II 󰀇󰀇,󰀉-󰀁󰀂. See also In Sap. n. 󰀁󰀄󰀇, LW II 󰀄󰀈󰀅,󰀆-󰀇. 󰀆󰀆. Aristotle, De interpretatione 󰀆, 󰀁󰀇a, 󰀃󰀃-󰀃󰀅 as quoted in D. Turner, Faith, Reason and the Existence of God (󰀂󰀀󰀀󰀄), 󰀁󰀀󰀁. The same can also be found in Aristotle De Anima 󰀃.󰀆 (󰀄󰀃󰀀b󰀂󰀀-󰀂󰀅).

󰀁󰀃󰀆

C HRISTOPHER M. W OJTULEWICZ

the negative are one and the same knowledge. In the first instance it would seem that this maxim belongs only to what is truly opposite: the negative of a positive statement. Thus, ‘the child has a ball’ is one and the same knowledge as ‘the child does not have a ball’, and the former is only comprehensible as a result of the latter, its opposite. I cannot know what it is for a child to have a ball if I do not also know what it is for him not to have a ball, and vice versa. Yet with the sophism we do not have opposition as, for example, if we said ‘only Socrates is’, the opposite of which would be ‘not only Socrates is’, where existence is predicated of the subject; instead, we have, first of all, a correlative: Father. In our Socrates example, to know what the former (‘only Socrates is’) means is the same as knowing what the latter (‘not only Socrates is’) means. The pater-sophism seems to set out an opposition which appears to function in this fashion. Yet the problem that arises, which does not arise in the case of Socrates, is that the subject is correlative. The question, then, is not whether the knowledge of the opposite (‘not only the Father is’) is the same as the knowledge of the first part (‘only the Father is’), but whether the first part has semantic sense. The fact that we have a syntactically correct sentence (there is nothing at fault in the grammar) does not mean we have a semantically correct sentence. The question, then, is whether the particle of exclusion can apply to a subject which is a correlative. The meaning of ‘Father’ is that there is also the Son, and vice versa. Does the particle of exclusion, the medieval authors therefore ask, get a grip on a correlative term as though a single subject, thus excluding the rest, or must it of necessity include it? This is what we found in the syn/categorematic distinction. This makes it clear, then, that correlatives are not negational opposites, for if they were, they would necessarily have to mutually exclude one another in each instance. In such a case ‘Father’ would already imply ‘no Son’, and ‘Son’ imply ‘no Father’. Yet this is the very opposite of the meaning of ‘correlative’, for they mutually include one another. The Father and the Son are not opposites, but correlatives. According to eadem est scientia oppositorum, however, to know ‘only the Father is’ is to simultaneously know ‘not only the Father is’. Our knowledge is one Turner puts forth a profound reflection on Eckhart’s and Aquinas’ style and rhetoric with respect to divine unknowability and suggests a number of interesting conclusions from this maxim which are worth considering.

D ECONSTRUCTING S OPHISMS

IN

M EISTER E CKHART

󰀁󰀃󰀇

and the same in each, and thus the modus in which we know through the pater-sophism is a means of using this principle of knowledge to assert the truth regarding the correlative terms ‘Father’ and ‘Son’, even though they are not opposed in rebus. Both opposites as just set out, in belonging to one act of knowledge, communicate according to a creaturely modus the consubstantiality of the Father and the Son. The problem has become, therefore, not whether the particle of exclusion includes or excludes the Son; but how their correlation, as Trinitarian Persons, is signified linguistically. This explanation therefore makes sense of the broader analogical context in which Eckhart makes use of the sophism. As earlier, this ties us to the use of this maxim in the context of light and dark. So too in the Commentary on Wisdom n. 󰀁󰀀󰀄, the apprehension of ‘privation’ in ‘habit’ or ‘negation in affirmation’ is so because they ‘pertain to one science’, the ‘one act of knowing and one act of existing’.󰀆󰀇 The point is similarly asserted in the Commentary on the Gospel of John.󰀆󰀈 The pater-sophism therefore gives a means of understanding the unity of the Father and Son through a modus which is true for the creature, if not true of God in himself. Such a modus is enshrined in the logic of the sentence, and thus its effect is much like any other Eckhartian rhetorical device: ‘the performance utters what the utterance performs’.󰀆󰀉 The unity of the knowledge of opposites is analogically related to the correlative nature of the Divine Persons who are one Divine Essence. God is Spirit: Towards the Edge of Divine Linguistics One of the other reasons that makes it clear that Eckhart is applying the sophism to the Trinity is the fact that it contains a two-term proposition (‘pater est’), which, he says, are only applicable to God. McGinn helpfully renders this idea into English by means of writing ‘God is-being’ or ‘God is-good’.󰀇󰀀 Herein of course lies the modus significandi of which Aquinas speaks when he distinguishes that creaturely modus from the res 󰀆󰀇. In Sap. n 󰀁󰀀󰀄, LW II 󰀄󰀄󰀀,󰀁󰀃-󰀄󰀄󰀁,󰀁. Translation as in Bernard McGinn (ed.), Meister Eckhart: Teacher and Preacher, in collaboration with Frank Tobin and Elvira Borgstadt (Mahwah NJ, 󰀁󰀉󰀈󰀆), 󰀁󰀅󰀉. 󰀆󰀈. In Ioh. n. 󰀇󰀅, LW III 󰀆󰀃,󰀇-󰀉. 󰀆󰀉. D. Turner, Faith, Reason and the Existence of God (󰀂󰀀󰀀󰀄), 󰀁󰀀󰀂. 󰀇󰀀. Bernard McGinn, The Mystical Thought of Meister Eckhart: The Man from Whom God Hid Nothing (New York NY, 󰀂󰀀󰀀󰀁), 󰀉󰀁.

󰀁󰀃󰀈

C HRISTOPHER M. W OJTULEWICZ

significata of the propositions. The ‘-’ is as close as we can get to expressing the unity and simplicity of the Divine Essence whilst always falling into the creaturely ascription of ‘attributes’. To put it another way, it signals to us the failure of language to signify the unity and simplicity of the Divine Essence. Eckhart explains this in his Prologue to the Work of Propositions as well as in his Summary of the Prologues to the Three-Part Work, showing three-term propositions to refer to creatures. It is a return to the meaning of esse est deus. Like the argument for the sophism which distinguishes substance and quality regarding the particle of exclusion (the categorematic versus the syncategorematic), Eckhart says ‘we should speak and judge differently of being and this being, and similarly of one and this one [...]’.󰀇󰀁 Existence in these cases, he says, is a ‘third term’ in addition to the ‘subject’ and ‘predicate’ of the sentence.󰀇󰀂 One example Eckhart gives is ‘a rose is red’.󰀇󰀃 This ‘is’ does not mean the rose exists, but acts as the copula. With respect to God however, the best example is to be found in the Commentary on the Gospel of John, where Eckhart speaks of ‘God is spirit’. We can summarise his three ways as follows:󰀇󰀄 󰀁.

󰀂.

󰀃.

‘Spirit is God’ [spiritus est deus] Spirit = subject; God = predicate; is = copula of the subject. Literally: ‘everything that is spirit is properly God [spiritus est deus]’. ‘God is spirit’ [deus est spiritus] God = subject; spirit = predicate; is = copula of the subject. Literally: ‘God is spirit, just as if we were to say, “God is good”’. ‘Spirit-God is’ [spiritus deus est] Spirit-God = subject; is = ‘second component and predicate’. Literally: ‘spirit, which is God, himself is’.

From the three it is clear that Eckhart prefers the third means for God, for in this way the est does not function as a copula, but as the predicate. This is why he concludes his reflection on the various forms of ‘God 󰀇󰀁. Tabula prologorum in Opus tripartitum n. 󰀃, LW I/󰀁 󰀁󰀃󰀁,󰀈: ‘Cum vero dicitur aliquid ens hoc, unum hoc [...]’. Translation as in Armand A. Maurer, Parisian Questions and Prologues (Toronto, 󰀁󰀉󰀇󰀄), 󰀇󰀈. 󰀇󰀂. Tabula prologorum in Opus tripartitum n. 󰀃, LW I/󰀁 󰀁󰀃󰀂,󰀁-󰀂. 󰀇󰀃. Tabula prologorum in Opus tripartitum n. 󰀃, LW I/󰀁 󰀁󰀃󰀁,󰀁󰀅-󰀁󰀆. 󰀇󰀄. In Ioh. n. 󰀃󰀇󰀇, LW III 󰀃󰀂󰀁,󰀄-󰀃󰀂󰀂,󰀂. In the third instance the italicising of ‘is’ is my emphasis.

D ECONSTRUCTING S OPHISMS

IN

M EISTER E CKHART

󰀁󰀃󰀉

is spirit’ by quoting first Augustine as saying ‘when compared to God, nothing is beautiful or good or existence’, and then Jerome, ‘God truly is, compared to which our existence is not’.󰀇󰀅 The point is that the patersophism uses this two-term proposition, and such propositions lead Eckhart to consider the comparison of God with creatures, for only the form as laid out in 󰀁 and 󰀂 above may be predicated of creatures, namely, third-term propositions. Though we say only suited to creatures, insofar as they are predicated of God they do so in a creaturely modus – a mode which knows not how to signify the unity and simplicity of the Divine Essence. Only 󰀃, therefore, incorporates whatever is true of the first two whilst supplanting existence as an affirmed reality, rather than as a copula. In this case, however, the expression spiritus deus est does not overcome the intrinsic problem of language with respect to God; but it does take us, so to say, to the precipice, because the copula has gone, and the negation of all non-existence is affirmed with respect to God. The Work of the Father in the Son: Correlation and Negation It seems clear that Eckhart’s use of the pater-sophism engages with the nature of the relation between the Father and Son. Pertaining to the difficult question of the relationship between Eckhart’s German and Latin works is perhaps the more difficult question of addressing his Trinitarian theology as it appears in both. This is not only because there is already a highly stylised means by which the Trinity is discussed in the schools – stylised in such a way because of its difficulty, and we do find this in Eckhart’s Latin works – but also because his treatment of the Trinity in his German works are particularly cryptic. In his (German) Sermon 󰀅󰀃, Eckhart evokes a relationship between speech and work, between ‘word’ (Logos, Verbum, verb) as spoken and unspoken. This is done with respect to the relationship between the Father and the Son. Much the same is found in the passage in the Commentary on Wisdom where the pater-sophism is used: the relationship between the Father and the Son as explaining the nature of that being ‘in’ the other, the Father working in the Son etc. In a more overarching way, the Commentary on Wisdom and related passages in the Commentary on Exodus 󰀇󰀅. In Ioh. n. 󰀃󰀇󰀇, LW III 󰀃󰀂󰀂,󰀁-󰀂. Emphasis mine.

󰀁󰀄󰀀

C HRISTOPHER M. W OJTULEWICZ

draw on the use of divine names: what is signified by the use of a divine name, to what extent is language capable of doing this, what is signified by the name ‘Father’ or ‘Son’? These questions belong to the same considerations we find in question 󰀁󰀃 of the prima pars of Aquinas’ Summa Theologica. It is not surprising that this emphasis on language (word/ speech), its formation and assumptions, should draw upon grammatical theory. This ought to be obvious, but it is deepened further if the theory drawn upon is in some measure Modistic: deep is the correlation between the formation of language, speech, the sentence, and the reality it signifies. Modism accords to language an ontological shape, the imprinting of the (Platonic) δύναμις of the world upon the structural coherence of syntax. Thus in Sermon 󰀅󰀃, Eckhart says ‘The Father is speaking work, and the Son is working speech’.󰀇󰀆 Shortly after: ‘Certain names signify properties which are attributed to God, such as “son” or “father”. When we think of a father, we think simultaneously of a son. There cannot be a father without a son, nor a son without a father but both contain within themselves an eternal essence which is beyond time.’󰀇󰀇 We might add to this: ‘si tantum pater est, non tantum pater est’. The point is about correlative terms (and whether the particle of exclusion can operate on one of them), which is captured here in Sermon 󰀅󰀃. And in a like manner, though not in the form of chiasmus, the sophism reflects the general inversion or mirroring of the split sentence, as in ‘The Father is speaking work, and the Son is working speech’. We do not need to enter fully into the meaning of this Eckhartian expression, except to note the form of its use as expressive of the ‘remaining in’ of the Father in the Son, and the Son in the Father. The point is once more about the relationship between the Father and Son; the ‘linguistification’󰀇󰀈 of that reality; and the (analogical) nature of that relation within language. The relation of the Father and the Son is based on the fact that both are the Divine Essence. As a result, the inevitable, final point in Sermon 󰀅󰀃 – and in the consideration of divine names in Eckhart’s oeuvre more broadly – is 󰀇󰀆. Pr. 󰀅󰀃, DW II 󰀅󰀂󰀉,󰀇-󰀅󰀃󰀀,󰀁. Translation Oliver Davies, Meister Eckhart: Selected Writings (London, 󰀁󰀉󰀉󰀄), 󰀁󰀂󰀈. 󰀇󰀇. Pr. 󰀅󰀃, DW II 󰀅󰀃󰀂,󰀄-󰀅󰀃󰀃,󰀃. Translation Ibid., 󰀁󰀂󰀈-󰀉. 󰀇󰀈. E. Lombardi, The Syntax of Desire (󰀂󰀀󰀀󰀇), 󰀇󰀉.

D ECONSTRUCTING S OPHISMS

IN

M EISTER E CKHART

󰀁󰀄󰀁

‘God is “above names” and ineffable’.󰀇󰀉 Whatever the exact theory of relationship between language and reality – and we raise this specifically because it pertains to Modism – what happens to the language when, in the final moment, that ‘reality’ is itself unnamable? This is more than asking how the slipping of the semantic away from the questioner is presented in language (apophasis); it is a question of how Divine ineffability is onto-syntactically expressed. Not that the semantic and syntactic are somehow divorced – they are, rather, analogically related in Modism. Instead of the signified of a word expressing, or failing to express, something about God (e.g. in ‘God is Spirit’), it simultaneously expresses a functional and structural relation to the sentence as a whole, carrying with it the signifieds of those functions (dependency, movement, fixity, and so forth). It is not sufficient, then, to consider if ‘spirit’ is analogically predicable of God (in its semantic content); we also have to question its relation is to the copula ‘is’, and through that to the word ‘God’. This is captured in our earlier exploration of Eckhart’s three ways of dealing with the phrase ‘God is Spirit’. The use of the sophism as a tool for communicating the reciprocal relationship of Father and Son – and the mutual reciprocity of correlation generally – more subtly communicates the extrusion of reality into linguistic structure. Though (as we just noted) not chiastic precisely, the sophism nevertheless contains an intentional contrast between two related parts, analogous to the chiasm of Sermon 󰀅󰀃’s ‘the Father is speaking work, the Son working speech’. The analogical relationship between language and God, ‘mediated’, as it were, by the analogy of being, is expressed in (German) Sermon 󰀉 when Eckhart states: ‘when we grasp God in being, we grasp him in his antechamber [vorbürge], for being is the antechamber in which he dwells.’󰀈󰀀 This is not to say grasping God as he is in himself, for he really (eigentlîcher) dwells ‘in his temple’, that is, ‘in intellect’ (vernünfticheit). This is not straightforwardly ‘being versus intellect’ – between things as they are in being (independent of thought), on the one hand, and the capacity to think about or understand those things, on the other. There is an intellect (vernünfticheit) which ‘searches’ – so we might say, 󰀇󰀉. Pr. 󰀅󰀃, DW II 󰀅󰀃󰀄,󰀉. Translation O. Davies, Meister Eckhart (󰀁󰀉󰀉󰀄), 󰀁󰀂󰀉. 󰀈󰀀. Pr. 󰀉, DW I 󰀁󰀅󰀀,󰀁-󰀇. English translation from B. McGinn, Meister Eckhart: Teacher and Preacher (󰀁󰀉󰀈󰀆), 󰀂󰀅󰀇.

󰀁󰀄󰀂

C HRISTOPHER M. W OJTULEWICZ

apprehends in being – and ‘another intellect’ which does not.󰀈󰀁 Being is thus the antechamber, and the (higher) intellect the temple. There is therefore an analogical relationship between grasping God in being and grasping God in intellect; not that God is in one (intellect) but not the other (being). That being, in this sense, is coextensive with language manifests the aforementioned relationship between language and reality, the grasping of God analogically within the onto-syntax of language. A final affirmation of the analogical nature of the ‘remaining in’ (the quintessence of the context in which the pater-sophism is quoted) is established through an appeal to that same relationship between being and becoming, which we considered earlier. Thus in (German) Sermon 󰀆, Eckhart says: ‘[a]cting and becoming are one. God and I are one in operation: he acts and I become’.󰀈󰀂 This only makes sense on the basis of the ‘silent’ dependency of becoming on the fixity of esse. Schürmann seems to find what we are expressing here in the meaning of the Middle High German ‘Wesene’, which he describes as ‘an event or a process by which a thing reaches its full essence. The word thus means both coming forth and fulfillment.’󰀈󰀃 It is precisely in being able to express both that the term displays semantically what we have already observed onto-syntactically; namely, the absorption of the analogical structure of metaphysics into language. If the final word on the pater-sophism relates to the means of expressing divine unity and simplicity in the correlative terms, then we must conclude with a note on the impetus of the negation in tantum. In this sense, the particle of exclusion is evoking much more than the question of inclusion or exclusion: it must also be an expression of Eckhart’s principle of negating negation as the only form of negation truly applicable to God. Whilst McGinn describes the negation of negation as ‘simultaneously total emptiness and supreme fullness’,󰀈󰀄 we must add that this is true only insofar as simultaneity is neither ‘at the same time’ nor ‘across time’; that 󰀈󰀁. Pr. 󰀇󰀁, DW III 󰀂󰀁󰀅,󰀉-󰀁󰀀: ‘Über die vernünfticheit, diu dâ suochende ist, sô ist ein ander vernünfticheit, diu dâ niht ensuochet [...]’. 󰀈󰀂. Pr. 󰀆, DW I 󰀁󰀁󰀄,󰀂-󰀅. Translation Reiner Schürmann, Wandering Joy: Meister Eckhart’s Mystical Philosophy (Great Barrington MA, 󰀂󰀀󰀀󰀁), 󰀁󰀈󰀃. See also In Gen. I n. 󰀁󰀁󰀅, LW I/󰀂 󰀁󰀅󰀅,󰀂󰀄󰀇. 󰀈󰀃. R. Schürmann, Wandering Joy (󰀂󰀀󰀀󰀁), 󰀁󰀈󰀄. 󰀈󰀄. B. McGinn, The Mystical Thought (󰀂󰀀󰀀󰀁), 󰀉󰀄.

D ECONSTRUCTING S OPHISMS

IN

M EISTER E CKHART

󰀁󰀄󰀃

is, as congruent with divine unity, simplicity, and eternity, not conceived of according to the modus significandi of the creature. Ontologically speaking, it is the ‘exclusion of non-being’ in God.󰀈󰀅 Yet to exclude exclusion is to maintain an exclusion all the same. This exclusion cannot exclude itself, or else we cannot say anything. But is this not the point at this juncture – that we cannot say anything? In one language register this is indeed the case, for the dissimilarity between God and creatures is infinite. If we exclude exclusion a new relationship to exclusion emerges, and it is this that Eckhart is deeming ‘utterly pure affirmation’.󰀈󰀆 Without compondendo et dividendo, without eadem est scientia oppositorum, without inclusion and exclusion, there is no operation of intellection at all – at least insofar as we are speaking of ‘ratiocination’.󰀈󰀇 Thus we must either be reconciled to the maintenance of a form of exclusion, or else we must give up altogether. In the infinite dissimilarity between God and creatures, the negation of negation does not get us any further than ‘mere’ negation alone, stating only in other words (‘supreme fullness’, or pure affirmation) the same thing: nothing of the creaturely can be applied to God, or no concept is able to adequately express the absolute transcendence of God. The ‘affirmation’ signifies the fact that not only are creaturely modi not applicable to God, even the creaturely conception of lack or absence, resulting from negation, does not apply to God. The negation of negation does not affirm in spite of the absence of the creaturely; it extends the consideration of just how unknowable God is in himself. Whatever results is, we may say, not anyone’s guess, but no-one’s guess. The same may be said of Eckhart’s understanding of distinction/ indistinction. The way in which God is ‘one’ is both in negation (God is indistinct) and affirmation (distinct, via the negation of negation).󰀈󰀈 If God is indistinct, he cannot be distinct by anything, except as predicated from our (creaturely) side. Therefore insofar as we do say he is either distinct or indistinct, he is truly neither – he is pure distinction, we could say, to borrow the expression from the negation of negation; but only if we understand that distinction fails in the manner of pure affirmation. 󰀈󰀅. Ibid. 󰀈󰀆. In Sap. n. 󰀁󰀄󰀇, LW II 󰀄󰀈󰀅,󰀆-󰀇. 󰀈󰀇. Thomas Aquinas, Summa Theologica Ia, q. 󰀈󰀅, a. 󰀅, co. Compare this with the operation of angelic intellection in ibid., q. 󰀅󰀈, a. 󰀄. 󰀈󰀈. See n. 󰀂󰀂 above.

󰀁󰀄󰀄

C HRISTOPHER M. W OJTULEWICZ

Pure affirmation grasps nothing more than negation (indistinction) because it is as much not nothing as it is not something. In that it adds nothing to our unknowing besides its underscoring, it serves as a good example of Eckhart heaping the ‘pressure of excessive forces’󰀈󰀉 upon language. Yet the pure distinction of God, as we just described, is as much an expression of divine unknowability by virtue of indistinction as it is of unknowability via an ‘excess of determinacy’:󰀉󰀀 if any thing is known insofar as it is in actuality, God is unknowable in virtue of his pure actuality – he is ‘too comprehensively determinate, too actual’.󰀉󰀁 What the pater-sophism highlights is both modes of unknowing in its semantic and onto-syntactical content – God as unknowable because of his infinite dissimilarity to the created order, and God as unknowable because of his inaccessibly excessive determinacy. As an exercise of its application in the broader context of analogy, the pater-sophism is a linguistic tool for Eckhart’s restless apophaticism: an expression of divine unknowability within the onto-syntactic structure afforded to language in virtue of its ability to apprehend but not to comprehend. It is clear that the distinctive quality of Eckhart’s use draws upon both the sophism’s placement within his Commentary on Wisdom, and its application to the Trinity. In both of these ways at least the influence of Modism can be seen, if not directly asserted. The broader context shows how Eckhart uses the various frustrations inherent within the sophism to advance a subtle point regarding the relationship between God and language. The very reasons the sophism was not typically used in discussing the Trinity are therefore the grounds for Eckhart’s deployment of it.

󰀈󰀉. D. Turner, Faith, Reason and the Existence of God (󰀂󰀀󰀀󰀄), 󰀁󰀀󰀂. 󰀉󰀀. Ibid., 󰀁󰀈󰀉. 󰀉󰀁. Ibid.

Peirce als Modist? Die grammatica speculativa und das Erbe Thomas von Erfurts GESCHE LINDE, ROSTOCK Abstract The article discusses the reception of Thomas of Erfurt by Charles Peirce (󰀁󰀈󰀃󰀉-󰀁󰀉󰀁󰀄) who, at his time, used to know Thomas under the name of Duns Scotus. Peirce explicitly drew on Thomas of Erfurt’s Modi significandi in the third of a series of lectures on British logicians delivered at Harvard University in the winter of 󰀁󰀈󰀆󰀈/󰀁󰀈󰀆󰀉, at a time when his own realistic position (as opposed to nominalism) took more and more shape, but Thomas’ influence may also be found elsewhere in Peirce’s writings of that period. Even though direct dependence of Peirce on Thomas cannot be demonstrated, Peirce clearly shared a number of philosophical concerns with him, and showed approving interest in his arguments: Peirce’s notion of abstraction bears similarities to Thomas’ concept of distinctio formalis; his assumption that ‘cognizability’ and ‘being’ be synonymous terms echoes in a certain way Thomas’ thesis of the material identity between the modus essendi, the modus intelligendi passivi, and the modus significandi passivi; he agreed with Thomas in that language can be analyzed by using the notion of sign; and he praised Thomas for the first attempt of a philosophy of grammar, just as his own essay ‘On a New List of Categories’ (󰀁󰀈󰀆󰀇) intended to present a grammatica speculativa, a philosophy of the universal structure of thought. It may be concluded that studying Thomas of Erfurt helped Peirce in finding his own philosophical position during the crucial years of the second half of the 󰀁󰀈󰀆󰀀s, and beyond. 󰀁. Einleitung: Peirce als Logikhistoriker

I

m Winter des Jahres 󰀁󰀈󰀆󰀉/󰀇󰀀, vom 󰀁󰀄. Dezember bis zum 󰀁󰀅. Januar, fand an der Harvard University eine Kette von Vorträgen zur Geschichte der britischen Logik statt. Sie war ihrerseits Teil einer umfassenden

󰀁󰀄󰀆

G ESCHE L INDE

philosophischen Vorlesungsreihe (mit optionaler Abschlussprüfung), die der frisch gekürte Universitätspräsident Charles William Eliot in Auftrag gegeben hatte, um den Aufbau einer Graduiertenschule vorzubereiten.󰀁 Über den siebenten der erwähnten Vorträge󰀂 am 󰀂󰀈. Dezember 󰀁󰀈󰀆󰀉 zum philosophischen Nominalismus John Stuart Mills󰀃 erfahren wir aus einem Kommentar, den einer der Hörer, William James, brieflich gegenüber einem Freund abgab, dass er ohne schriftliche Notizen gehalten worden und von bewundernswerter Klarheit gewesen sei: „Niemals habe ich jemanden den Dingen so intensiv und sorgfältig auf den Grund gehen sehen“.󰀄 Die abgekürzten und in Klammern gesetzten Selbstanweisungen 󰀁. Vgl. Max H. Fisch, Introduction, ch. 󰀁: ‚The Decisive Year and Its Early Consequences‘, in Writings of Charles S. Peirce, vol. 󰀂, 󰀁󰀈󰀆󰀇-󰀁󰀈󰀇󰀁, hg. v. Edward C. Moore u.a. (Bloomington, 󰀁󰀉󰀈󰀄) [nachfolgend zitiert als: W 󰀂], xxi-xxxvi, hier S. xxiv: ‚He [Eliot] arranged two such sequences for 󰀁󰀈󰀆󰀉-󰀇󰀀; one in philosophy, the other in modern literature. For philosophy he enlisted Francis Bowen, John Fiske, Peirce, F. H. Hedge, J. Elliott Cabot, Emerson, and G. P. Fisher, in that order. Peirce’s fifteen lectures, from 󰀁󰀄 December to 󰀁󰀅 January, were on the history of logic in Great Britain from Duns Scotus to Mill.‘ 󰀂. Nach M.H. Fisch, ‚The Decisive Year‘ (󰀁󰀉󰀈󰀄), 󰀁󰀅 an der Zahl, siehe Zitat Anm. 󰀁; so auch die Angabe des Robin-Katalogs zu MS 󰀅󰀈󰀄. Vgl. aber Peirce selbst, W 󰀂, 󰀃󰀁󰀀 (MS 󰀅󰀈󰀅): ‚The president requested me to deliver nine lectures upon the history of logic‘, 󰀃󰀁󰀁: ‚If I were to devote the whole of my nine lectures to medieval philosophy [...]‘. Parallelversion MS 󰀅󰀈󰀄: ‚I was asked by the President to give nine lectures on the History of Logic. Vastly too wide a subject to be treated in nine lectures. I have therefore restricted myself to British Logicians – that being as small a branch of the subject as occurred to me, at once. Yet, even this would require 󰀉󰀀 lectures instead of 󰀉 to be adequately treated‘. Ebenso William James in seinem Brief an Henry Pickering Bowditch, Cambridge, 󰀂󰀉.󰀁󰀂.󰀁󰀈󰀆󰀉 (The Correspondence of William James, Bd. 󰀄, 󰀁󰀈󰀅󰀆-󰀁󰀈󰀇󰀇, hg. v. Ignas K. Skrupselis und Elizabeth M. Berkeley unter Mitarb. v. Wilma Bradbeer und Bernice Grohskopf [Charlottesville und London, 󰀁󰀉󰀉󰀅], 󰀃󰀉󰀈): ‚I heard Chas. Peirce lecture yesterday ̶ one of his 󰀉 on „British Logicians“.‘ – Die Diskrepanz der Zahlenangaben wird in The Correspondence of William James, Bd. 󰀄, 󰀄󰀀󰀀, Anm. 󰀂󰀀, von den Herausgebern wie folgt erläutert: ‚In 󰀁󰀈󰀆󰀉-󰀇󰀀 Charles Sanders Peirce gave a series of lectures at Harvard titled „British Logicians“, the series growing to fifteen lectures from the nine originally planned‘. 󰀃. The Correspondence of William James, 󰀄󰀀󰀀, Anm. 󰀂󰀀: ‚WJ attended the one on John Stuart Mill on 󰀂󰀈 December 󰀁󰀈󰀆󰀉‘. 󰀄. The Correspondence of William James, Bd. 󰀄, 󰀃󰀉󰀈 (Brief an Henry Pickering Bowditch, Cambridge, 󰀂󰀉.󰀁󰀂.󰀁󰀈󰀆󰀉): ‚I heard Chas. Peirce lecture yesterday – one of his 󰀉 on „British Logicians“. It was delivered without notes, and was admirable in matter manner, & clearness of statement. He has recently been made assistant astronomer with 󰀂󰀅󰀀󰀀 a year. But I wish he could get a professorship of philosophy somewhere. That is his forte, and therein he is certainly très-fort. I never saw a man go into things so intensely & throroughly‘. Ebenfalls zitiert bei: Joseph Brent, Charles Sanders Peirce: A Life (Bloomington/Indianapolis, 󰀁󰀉󰀉󰀈), 󰀇󰀅; und in deutscher Übersetzung bei: Klaus Oehler, Charles Sanders Peirce, Beck’sche Reiher Denker 󰀅󰀂󰀉 (München, 󰀁󰀉󰀉󰀃), 󰀁󰀅; sowie teilweise bei: M.H. Fisch, ‚The Decisive Year‘ (󰀁󰀉󰀈󰀄), xxiv-xxv – Vgl. aber auch den Brief William James’ an Henry Pickering Bowditch vom 󰀂󰀄. Januar 󰀁󰀈󰀆󰀉 (The Correspondence of William James’, Bd. 󰀄, 󰀃󰀆󰀁 = The Letters of William James, ed. by his son Henry James, Bd. 󰀁 [Boston, 󰀁󰀉󰀂󰀀], 󰀁󰀄󰀉): ‚I have just been quit by Chas. S. Peirce, with whom I have been talking about a couple of articles in

P EIRCE

ALS

M ODIST ?

󰀁󰀄󰀇

an den Vortragenden, wie sie in eines der ausgearbeiteten und erhaltenen Vorlesungsmanuskripte, MS 󰀅󰀈󰀅,󰀅 eingestreut sind, lassen vermuten, dass er auch bei den anderen Gelegenheiten großenteils frei extemporiert habe, wie dies überhaupt sein Vortragsstil gewesen zu sein scheint.󰀆 the St. Louis „Journal of Speculative Philosophy“ by him, which I have just read. They are exceedingly bold, subtle and incomprehensible, and I can’t say that his vocal elucidations helped me a great deal to their understanding, but they nevertheless interest me strangely. The poor cuss sees no chance of getting a professorship anywhere, and is likely to go into the observatory for good. It seems a great pity that as original a man as he is, who is willing and able to devote the powers of his life to logic and metaphysics, should be starved out a career, when there are lots of professorships of the sort to be given in the country to ‚safe,‘ orthodox men. He has had good reason, I know, to feel a little discouraged about the prospect, but I think he ought to hang on, as a German would do, till he grows gray‘. Auch zitiert bei Brent, Charles Sanders Peirce, 󰀇󰀄. 󰀅. Robin-Zählung (Mikrofilmrolle Nr. 󰀁󰀃); die Writings weisen dem Text die Writings-eigene MS-Nr. 󰀁󰀆󰀀 zu. 󰀆. Christine Ladd-Franklin berichtete 󰀁󰀉󰀁󰀆 aus ihrer eigenen Erfahrung als Hörerin an der Johns Hopkins University in Baltimore (Christine Ladd-Franklin, ‚Charles S. Peirce at the Johns Hopkins‘, The Journal of Philosophy, Psychology and Scientific Methods 󰀁󰀃 [󰀁󰀉󰀁󰀆/󰀂󰀆], 󰀇󰀁󰀅-󰀂󰀂, 󰀇󰀁󰀆): ‚Sylvester and Peirce both possessed recognized elements of the temperament of genius [...] but that temperament was exhibited in them in very different forms. Sylvester was as oblivious as Peirce of the presence of his audience [...] Peirce [...] was of the brooding type. He sat when he addressed his handful of students [...] and he had all the air, as has been noted by Professor Jastrow, of the typical philosopher who is engaged, at the moment, in bringing fresh truth by divination out of some inexhaustible well. He got his effect not by anything that could be called an inspiring personality [...] but rather by creating the impression that we had before us a profound, original, dispassionate and impassioned seeker of truth. No effort was made to create a connected and not inconsistent whole out of the matter of each lecture‘. – Joseph Jastrow, ‚Charles S. Peirce as a Teacher‘, The Journal of Philosophy, Psychology, and Scientific Methods 󰀁󰀃 (󰀁󰀉󰀁󰀆/󰀂󰀆), 󰀇󰀂󰀃-󰀆, 󰀇󰀂󰀃: ‚To record an impression of Charles S. Peirce as a teacher is a grateful opportunity. A deep conviction of the significance of the problems presented and a mastery of the intellectual processes were his sole and adequate pedagogical equipment. [...] His knowledge never gave the impression of a burden, but of strength. His command of the history of science was encyclopedic in the best sense of the word. The hypotheses of the great thinkers of the past were transformed into logical exercises for the present-day student. [...] The history of science was a record of man’s growth in logical stature. [...] The irrelevant was discarded, the significant composition revealed. The chips fell away and the statue in the block appeared. This sense of masterly analysis accomplished with neatness and dispatch, all seemingly easy, but actually the quality of the highest type of keen thinking remains as the central impression of a lecture by Professor Peirce. When I came to the Johns Hopkins University in the autumn of 󰀁󰀈󰀈󰀂, Mr. Peirce’s career was well established‘. 󰀇󰀂󰀄: ‚[...] the interplay of logical and psychological trends [...] he developed as a fertile principle of interpretation. Logic was an emanation of habit; the trend was biological, the product required the schooling of discipline and the inspiration of genius. It was this side of his teaching that gave the humanistic value; out of it grew the insight that made him the father of pragmatism. [...] My predilections at that formative period were, I must confess, rather negative. My college course had left me with a series of dislikes, not violent, but distinctive. By elimination I enrolled as a student in philosophy. Mr. Peirce’s courses in logic gave me my first real experience of intellectual muscle‘. 󰀇󰀂󰀅: ‚Mr. Peirce’s personality was affected by a superficial reticence often associated with the scientific temperament. He readily gave the impression of being unsocial, possibly cold, more truly retiring. At bottom the trait was in the

󰀁󰀄󰀈

G ESCHE L INDE

Ob er seine Hörer mit den langen lateinischen Textpassagen, die das Manuskript zur dritten Vorlesung vorsieht,󰀇 quälte oder aber StegreifÜbersetzungen formulierte, ist nicht überliefert; doch dürfte sein Latein nature of a refined shyness, an embarrassment in the presence of the small talk and introductory salutations intruded by convention to start one’s mind. His nature was generously hospitable; he was an intellectual host. In that respect he was eminently fitted to become the leader of a select band of disciples. Under more fortunate circumstances, his academic usefulness might have been vastly extended. For he had the pedagogic gift to an unusual degree, had it by dower of nature, as some men handle a pencil and others the bow of a violin. It may be an inevitable result of the conventional system of education, but it is none the less a sad one, that his type of ability does not flourish readily in an institutionalized atmosphere; and no university had a more wholesome atmosphere than had Johns Hopkins in those days. The moral, if there be one, is that systems must give way to personalities, if the best talents of the best men are to be available. The young men in my group who were admitted to his circle found him a most agreeable companion. The terms of equality upon which he met us were not in the way of flattery, for they were too spontaneous and sincere. We were members of his „scientific“ fraternity; greetings were brief, and we proceeded to the business that brought us together, in which he and we found more pleasure than in anything else. This type of cooperation and delegation of responsibility came as near to a pedagogical device as any method that he used. One instance of it stands out with embarrassing clearness. To my consternation I was informed by Mr. Peirce that he would be absent at the time of the next lecture in logic, and that he would like me to present the next stage in the development of his topic to the class of graduate students. About half the hour was over, when Mr. Peirce walked in, took his place and insisted upon my concluding the exercise. I know of no more enlightening comment upon the atmosphere of the place and the day than that the procedure was accepted naturally by all concerned except myself‘. 󰀇󰀂󰀆: ‚To those who believe that for the training of the leaders of men, nothing is more inspiring and more helpful than training by example – than the privilege of association in the cooperative spirit with a master mind – the example of Charles S. Peirce will continue to remain a cherished memory. An educational policy that makes it possible to find a place for such men as Peirce in the faculties of the great universities is a worthy ambition for those who control the educational future of America‘. 󰀇. Die Passagen aus Thomas von Erfurt (d.h. die ersten sechs Kapitel der Modi significandi) haben die Herausgeber des zweiten Bandes der Writings, Edward C. Moore, Max H. Fisch, Christian J. W. Kloesel, Don D. Roberts und Lynn A. Ziegler [Bloomington IN, 󰀁󰀉󰀈󰀄], auf Englisch eingefügt (ebenso wie die aus Ockham), und zwar, wie aus der Bibliographie hervorgeht, in der Übersetzung von Bursill-Hall (Thomas of Erfurt, Grammatica Speculativa: An edition with translation and commentary by Geoffrey Leslie Bursill-Hall [London, 󰀁󰀉󰀇󰀂]), die zugleich die einzige verfügbare englische Version bildet. Im Manuskript steht schlicht folgende Leseanweisung: ‚[Read them.]‘ Zu Ockham, Kap. I, heißt es ‚Read three definitions whole chapter]‘, zu Kap. IV ‚[Read it to bottom of column]‘; ähnliches gilt für Kap. XII, XIII und andere Stellen. Die Mitherausgeberin des zweiten Bandes der Writings, Lynn A. Ziegler, kommentiert in ihrem ‚Essay on Editorial Method‘, 󰀅󰀆󰀉-󰀈󰀁, 󰀅󰀈󰀀: ‚The few manuscript notes we have for Peirce’s British Logicians lecture series present one feature beyond those we have so far mentioned. They did evolve into a final form, of sorts – the spoken word. [...] As was his established practice, he carried the books to the lecture and read directly from them. At such points the manuscript contains only the bracketed instructions to himself to read a specific passage to his audience. Moreover, these instructions clearly indicate Peirce was using Latin editions of both these works [sc. Ockham’s Summa logicae und Thomas von Erfurts Grammatica speculativa]. Following Peirce’s instructions, we insert into the text those quoted passages for which the manuscript gives only the references, though we use standard English translations rather than the Latin editions Peirce used‘.

P EIRCE

ALS

M ODIST ?

󰀁󰀄󰀉

jedenfalls flüssig genug gewesen sein, um ihm letzteres ohne weiteres erlaubt zu haben. Der Redner war Charles Peirce, zu diesem Zeitpunkt 󰀃󰀀 Jahre alt, ohne philosophischen Abschluss und dennoch am Beginn einer Karriere als Universitätsphilosoph, die gut vier Jahre zuvor mit seinen Harvard Lectures von 󰀁󰀈󰀆󰀅 zur Schlussfolgerungslogik󰀈 eingesetzt hatte und erst 󰀁󰀈󰀈󰀄 ein abruptes Ende nehmen sollte. Nach eigener Aussage war ihm das Thema von Eliot aufgetragen worden, doch hatte er sich zugleich bereits seit einigen Jahren verstärkt mit mittelalterlicher Logik befasst. In den einleitenden Bemerkungen zur ersten Vorlesung nennt Peirce die Kriterien, aufgrund derer ihm britische Logikgeschichte als ein eigenständiger und abgrenzbarer Vortragsgegenstand erscheint: die „family resemblance“󰀉 zwischen den britischen Logikern,󰀁󰀀 die sich historisch schon sehr früh bemerkbar gemacht habe und die in einer Tendenz zum Nominalismus, in einer Anbahnung naturwissenschaftlicher Methoden und in einer Affinität zu mathematischen Formalisierungen bestehe. Alle drei Merkmale wird Peirce, wenngleich er betont, dass seine Vorlesungen der Geschichte und nicht der Logik zuzuordnen seien, dass er also Positionen referiere, anstatt über Geltungsansprüche zu urteilen, auch mit Seitenblick auf die eigene Person hervorgehoben haben: Er hatte sich bereits ausgiebig mit der Mathematisierbarkeit von Logik beschäftigt und sich zu diesem Zweck der Boole’schen Algebra zugewandt; er hatte sein Studium am Harvard College mit dem Bachelor of Science in Chemie abgeschlossen und war hauptberuflich als Geodät und Astronom tätig; und er hatte sich in der Vergangenheit als (allerdings gemäßigter) Nominalist positioniert󰀁󰀁 – in der Tat ist es sicher nicht nur, aber vielleicht 󰀈. ‚On the Logic of Science‘, abgedruckt in Writings of Charles Peirce. A Chronological Edition, Bd. 󰀁, 󰀁󰀈󰀅󰀇-󰀆󰀆, hg. v. Max H. Fisch u.a. (Bloomington, 󰀁󰀉󰀈󰀂) [nachfolgend zitiert als: W 󰀁], 󰀁󰀆󰀂-󰀃󰀀󰀂. 󰀉. W 󰀂, 󰀃󰀁󰀀. – Vgl. auch W 󰀂, 󰀄󰀆󰀄 (‚Fraser’s Berkeley‘, 󰀁󰀈󰀇󰀁): ‚The mediæval metaphysic is so entirely forgotten, and has so close a historic connection with modern English philosophy [...]‘. 󰀁󰀀. In MS 󰀅󰀈󰀄 findet sich unter dem Titel ‚List of British Logicians‘ eine lange Liste von Namen und zu deren Schluß folgende Aufstellung: ‚󰀁. Alcuin and Joannes Scotus Erigena 󰀂. Robert Pulleyn, Adelard of Bath, John of Salisbury, and the [fehlt] 󰀃. John of Salisbury and the context of Nominalism & Realism 󰀄 William Sherwood 󰀅 Robert Bacon, John Basingstokes, Robert Grosseteste, Robert Kilwardby John Peck[ham] 󰀆 John Duns Scotus, Richard Middleton, Walter Burleigh, John Baconthorpe 󰀇. Scotus and William Occam 󰀈 Francis Bacon 󰀉. Thomas Hobbes etc. 󰀁󰀀, 󰀁󰀁, 󰀁󰀂, Stuart Mill 󰀁󰀃 Sir W. Hamilton 󰀁󰀄, 󰀁󰀅, De Morgan 󰀁󰀆, 󰀁󰀇, 󰀁󰀈 George Boole‘. 󰀁󰀁. Zu der Debatte um Pierces ‚Nominalismus‘ siehe unten, Anm. 󰀂󰀁.

󰀁󰀅󰀀

G ESCHE L INDE

auch die Beschäftigung mit den Modi significandi des Thomas von Erfurt gewesen, die ihn dazu veranlasste oder zumindest darin bestärkte, seine diesbezügliche Haltung zu ändern und zu schärfen. Für das vorliegende Thema, die Begegnung Pierces mit Thomas, ist der Entwurf zum dritten Vortrag, ein Teil von MS 󰀅󰀈󰀅,󰀁󰀂 von Interesse, der allerdings so umfangreich ist, dass er für deutlich mehr als nur eine einzige Vorlesung Stoff geboten habe dürfte. In dem genannten Manuskript bringt Peirce William of Ockham und Thomas󰀁󰀃 – letzteren unter dem eingeführten Namen Duns Scotus󰀁󰀄 – miteinander ins Gespräch, um die Alternative zwischen einer nominalistischen und einer realistischen Position in Bezug auf die lang vergessene Frage zu erörtern, ob Universalien real seien. Zu einem späteren Zeitpunkt wird Peirce verdeutlichen, dass er die realistische Beantwortung der Universalienfrage für eine „Bedingung der Möglichkeit von Wissenschaft“󰀁󰀅 überhaupt, insbesondere von 󰀁󰀂. MS 󰀅󰀈󰀄 enthält ‚Lecture I. Early nominalism and realism‘, MS 󰀅󰀈󰀅 bietet ‚Ockam. Lecture 󰀃‘, außerdem ein Skript zu ‚History of Logic in England from Ockam to Bacon‘, das nach wenigen Seiten abbricht und wie folgt einsetzt: ‚Scholasticism after Ockam grew more and more scholastic in one sense, less & less so in another. Nominalism more nonsensical if possible than realism because more separated from religion‘. 󰀁󰀃. Zu den wenigen biographischen Nachrichten, die über Thomas vorliegen, siehe: Sönke Lorenz, Studium Generale Erfordense. Zum Erfurter Schulleben im 󰀁󰀃. und 󰀁󰀄. Jahrhundert, Monographien zur Geschichte des Mittelalters 󰀃󰀄 (Stuttgart, 󰀁󰀉󰀈󰀉), 󰀃󰀁󰀂-󰀂󰀈, 󰀇󰀇ff. 󰀈󰀇f. 󰀁󰀄. Die Scotus-Ausgabe, die Peirce höchstwahrscheinlich vorgelegen hat und die den Thomas-Traktat enthält, ist die unter dem Titel The complete works of Scotus von Luke Wadding herausgegebene, die 󰀁󰀆󰀃󰀉 in 󰀁󰀂 Bänden bei L. Durand in Lyon erschien und auf die Peirce sich noch 󰀁󰀉󰀀󰀂/󰀁󰀁 in seinem (teils zusammen mit Christine Ladd-Franklin verfassten) Artikel zu ‚Signification and Application‘ in Baldwin’s Dictionary of Philosophy and Psychology, Bd. 󰀂, bezog (vgl. Collected Papers of Charles Sanders Peirce, Bde. 󰀁-󰀆, hg. v. Charles Hartshorne und Paul Weiss [Cambridge MA, 󰀁󰀉󰀃󰀁-󰀁󰀉󰀃󰀅], Bde. 󰀇-󰀈, hg. v. Arthur W. Burks, ebd. 󰀁󰀉󰀅󰀈 [nachfolgend zitiert als ‚CP‘, mit Bandzahl und durch Punkt abgetrennter Paragraphenzahl], hier 󰀂.󰀄󰀃󰀄), obwohl zu diesem Zeitpunkt bereits der 󰀁󰀈󰀉󰀁-󰀁󰀈󰀉󰀅 bei Louis Vivès in Paris erschienene 󰀂󰀆bändige Reprint vorlag. Als echte Scotus-Schrift werden die Modi significandi auch noch von Carl Prantl bezeichnet, den Peirce gründlich gelesen hat (Geschichte der Logik im Abendlande, Bd. 󰀃 [Hildesheim u.a., 󰀁󰀉󰀉󰀇 (Nachdr. d. Ausg. Leipzig, 󰀁󰀉󰀆󰀇)], 󰀂󰀀󰀂-󰀃, 󰀂󰀁󰀅-󰀆). Erst Martin Grabmann wies 󰀁󰀉󰀂󰀂 (‚De Thoma Erfordiensi auctore grammaticae quae Joanni Duns Scoto adscribitur speculativae‘, Archivum Franciscanum Historicum 󰀁󰀅 [󰀁󰀉󰀂󰀂], 󰀂󰀇󰀃-󰀇; sowie ‚Die Entwicklung der mittelalterlichen Sprachlogik [Tractatus de modis significandi]‘, Philosophisches Jahrbuch 󰀃󰀅 (󰀁󰀉󰀂󰀂), 󰀁󰀂󰀁-󰀃󰀅, 󰀁󰀉󰀉-󰀂󰀁󰀄, hier bes. 󰀁󰀃󰀂-󰀅, 󰀁󰀉󰀉-󰀂󰀀󰀂) nach, dass trotz inhaltlicher Nähen es sich bei dem Autor des Traktats nicht um Duns Scotus, sondern um Thomas von Erfurt handelt (vgl. auch ders., ‚Thomas von Erfurt und die Sprachlogik des mittelalterlichen Aristotelismus. Vorgetragen am 󰀂󰀄. Oktober 󰀁󰀉󰀄󰀂‘, Sitzungsberichte der Bayerischen Akademie der Wissenschaften 󰀁󰀉󰀄󰀃/󰀂 (München, 󰀁󰀉󰀄󰀃). 󰀁󰀅. Ludger Honnefelder, Scientia transcendens. Die formale Bestimmung der Seiendheit und Realität in der Metaphysik des Mittelalters und der Neuzeit (Duns Scotus – Suárez – Wolff – Kant – Peirce), Paradeigmata 󰀉 (Hamburg, 󰀁󰀉󰀉󰀀), 󰀃󰀈󰀄.

P EIRCE

ALS

M ODIST ?

󰀁󰀅󰀁

moderner Naturwissenschaft, halte, sofern diese nach Regularitäten suche, Prognosen über die Zukunft aufstelle und sie experimentell teste.󰀁󰀆 Doch seine Hörer zu Harvard, die das Universalienproblem für ein rein akademisches gehalten haben mögen, warnt er zu Abschluss des Manuskripts lediglich, dass es sich tatsächlich um eine Frage von eminent praktischen bzw. ethischen Konsequenzen handele – praktisch insofern, als allein die realistische Position, indem sie einer Universalie wie ‚Mensch‘ Realität über die Gesamtheit der Einzelwesen hinaus zuspreche, so etwas wie ein Handeln auf eine mit der Realie ‚Mensch‘ implizit vorausgesetzte Gemeinschaft hin ermögliche, während der Nominalismus, der nur Individuen statt der Gattung anerkenne, Gemeinschaft letztlich verunmögliche: „But it is not true that it is of no practical moment whether we believe in Nominalism or Realism, whether we believe that eternal verities are confined entirely to the other world (for a Nominalist may certainly 󰀁󰀆. CP 󰀅.󰀁󰀂󰀁 (‚Lectures on Pragmatism‘, 󰀁󰀉󰀀󰀃): ‚Reality consists in regularity. Real regularity is active law‘. – CP 󰀄.󰀁 (‚Detached Ideas on Vitally Important Topics‘, 󰀁󰀈󰀉󰀈): ‚[...] in using the word law, or regularity, we bring into prominence the kind of universals to which modern science pays most attention. Roughly speaking, the nominalists conceived the general element of cognition to be merely a convenience for understanding this and that fact and to amount to nothing except for cognition, while the realists, still more roughly speaking, looked upon the general, not only as the end and aim of knowledge, but also as the most important element of being. Such was and is the question. It is as pressing today as ever it was, Ernst Mach, for example, holding that generality is a mere device for economising labor while Hegeler, though he extols Mach to the skies, thinks he has said that man is immortal when he has only said that his influence survives him. According to the nominalistic view, the only value which an idea has is to represent the fact, and therefore the only respect in which a system of ideas has more value than the sum of the values of the ideas of which it is composed is that it is compendious; while, according to the realistic view, this is more or less incorrect depending upon how far the realism be pushed. Dr. [F. E.] Abbot in his Scientific Theism (󰀁󰀈󰀈󰀅) has so clearly and with such admirable simplicity shown that modern science is realistic that it is perhaps injudicious for me to attempt to add anything upon the subject.‘ – CP 󰀈.󰀁󰀅󰀃 (‚Karl Pearson, The Grammar of Science‘, ca. 󰀁󰀉󰀀󰀀): ‚It seems clear, to begin with, that to prove law a figment would be to prove all science to be a delusion and a Grammar of Science an idle pastime.‘ CP 󰀈.󰀁󰀄󰀅: ‚[...] is there anything that is really and truly a law of nature, or are all pretended laws of nature figments, in which latter case, all natural science is a delusion, and the writing of a grammar of science a very idle pastime?‘ – Vgl. aber auch CP 󰀆.󰀆󰀁󰀀 (‚Reply to the Necessitarians; Rejoinder to Dr. Carus‘, 󰀁󰀈󰀉󰀃), wo Peirce von der Idee einer abolut zu setzenden Universalität abrückt: ‚Socialistic, or as I prefer to term it, agapastic ontology seems to me likely to find favour with many minds at an early day, because it is a natural path by which the nominalist may be led into the realistic ways of thought, ways toward which many facts and inward forces impel him. It is well, therefore, to call attention to the circumstances that the realism to which it leads is a doctrine which declares general truths to be real – independent of the opinions of any particular collection of minds – but not to be destined, in a strictly universal, exact, and sure acceptation, to be so settled, and established. Now to assert that general truths are objectively real, but to deny that they are strictly universal, exact, and certain, is to embrace the doctrine of absolute chance.‘

󰀁󰀅󰀂

G ESCHE L INDE

be a Spiritualist or even a Platonist) or that they are matters of everyday consequence, whether we believe that the Genus homo has no existence except as a collection of individuals and that therefore individual happiness, individual aspirations, and individual life is alone of account or that men really have something in common – and that their very essence [sic] – so that the Community is to be regarded as something of more consequence and of more dignity than any single men“.󰀁󰀇 Damit setzt Peirce eines der großen metaphysischen Probleme scholastischer Philosophie unter eine moderne, nämlich sozialphilosophische Perspektive. Bei diesem Verfahren handelt es sich nicht einfach um einen gewandten intellektuellen Hakenschlag, um ein bloßes Reframing, mit dem Peirce hoffen mochte, das Interesse seines mutmaßlich gelangweilten Auditoriums zurückzugewinnen, sondern um den Vorboten eines philosophischen Programms, das William James in einer 󰀁󰀈󰀉󰀈 in Berkeley gehaltenen Vorlesung󰀁󰀈 ‚Pragmatismus‘ taufen sollte und das Peirce erstmals 󰀁󰀈󰀇󰀈 󰀁󰀇. W 󰀂, 󰀃󰀃󰀆 (󰀁󰀈󰀆󰀉). 󰀁󰀈. William James, ‚Philosophical Conceptions and Practical Results‘, in William James, Pragmatism, hg. v. Fredson Bowers and Ignas K. Skrupskelis (Cambridge MA, 󰀁󰀉󰀇󰀅) [The Works of William James], 󰀂󰀅󰀇-󰀇󰀀 (󰀂󰀅󰀅-󰀇󰀄), hier 󰀂󰀅󰀈-󰀉: ‚I will seek to define with you merely what seems to be the most likely direction in which to start upon the trail of truth. Years ago this direction was given to me by an American philosopher whose home is in the East, and whose published works, few as they are, are no fit expression of his powers. I refer to Mr. Charles S. Peirce, with whose very existence as a philosopher I dare say many of you are unacquainted. He is one of the most original of contemporary thinkers; and the principle of practicalism or pragmatism, as he called it, when I first heard him enunciate it at Cambridge in the early 󰀇󰀀s is the clue or compass by following which I find myself more and more confirmed in believing we may keep our feet upon the proper trail. Peirce’s principle, as we may call it, may be expressed in a variety of ways, all of them very simple. In the Popular Science Monthly for January, 󰀁󰀈󰀇󰀈, he introduces it as follows: The soul and meaning of thought, he says, can never be made to direct itself towards anything but the production of belief, belief being the demicadence which closes a musical phrase in the symphony of our intellectual life. Thought in movement has thus for its only possible motive the attainment of thought at rest. But when our thought about an object has found its rest in belief, then our action on the subject can firmly and safely begin. Beliefs, in short, are really rules for action; and the whole function of thinking is but one step in the production of habits of action. If there were any part of a thought that made no difference in the thought’s practical consequences, then that part would be no proper element of the thought’s significance. Thus the same thought may be clad in different words; but if the different words suggest no different conduct, they are mere outer accretions, and have no part in the thought’s meaning. If, however, they determine conduct differently, they are essential elements of the significance. „Please open the door“, and, „Veuillez ouvrir la porte“, in French, mean just the same thing; but „D--n you, open the door“, although in English, means something very different. Thus to develop a thought’s meaning we need only determine what conduct it is fitted to produce; that conduct is for us its sole significance. And the tangible fact at the root of all our thought-distinctions, however subtle, is that there is no one of them so fine as to consist in anything but a possible difference of practice. To attain perfect clearness in our thoughts of an object, then,

P EIRCE

ALS

M ODIST ?

󰀁󰀅󰀃

deutlich formulierte: „Consider what effects that might conceivably have practical bearings you conceive the objects of your conception to have. Then, your conception of those effects is the whole of your conception of the object“.󰀁󰀉 Obwohl Peirce selbst sich in MS 󰀅󰀈󰀅 noch nicht expressis verbis festlegt, auf welche Seite er sich zu schlagen gedenkt, sondern die Frage bewusst in der Schwebe hält,󰀂󰀀 können doch seine Ausführungen eine gewisse Parteinahme zugunsten der realistischen Position, für die er außer Duns Scotus Thomas von Erfurt immerhin mit beansprucht, nicht verbergen; und in der Tat fällt seine Vortragsreihe, und damit auch die Auseinandersetzung mit den Modi significandi, just in die Zeit, in der er nach dem Urteil Max Fischs und Nathan Housers den Schritt vom Nominalismus zum Realismus vollzog oder in der, zurückhaltender geurteilt, sein Realismus immer deutlichere Konturen annahm.󰀂󰀁 Damit stellt we need only consider what effects of a conceivably practical kind the object may involve – what sensations we are to expect from it, and what reactions we must prepare. Our conception of these effects, then, is for us the whole of our conception of the object, so far as that conception has positive significance at all. This is the principle of Peirce, the principle of pragmatism. I think myself that it should be expressed more broadly than Mr. Peirce expresses it. The ultimate test for us of what a truth means is indeed the conduct it dictates or inspires. But it inspires that conduct because it first foretells some particular turn to our experience which shall call for just that conduct from us. And I should prefer for our purposes this evening to express Peirce’s principle by saying that the effective meaning of any philosophic proposition can always be brought down to some particular consequence, in our future practical experience, whether active or passive; the point lying rather in the fact that the experience must be particular, than in the fact that it must be active‘. 󰀁󰀉.  CP 󰀅.󰀄󰀀󰀂 (‚How to Make our Ideas Clear‘, 󰀁󰀈󰀇󰀈) = Writings of Charles S. Peirce. A Chronological Edition, Bd. 󰀃, 󰀁󰀈󰀇󰀂-󰀁󰀈󰀇󰀈, hg. v. Christian J. W. Kloesel u.a. (Bloomington, 󰀁󰀉󰀈󰀆) [im folgenden zitiert als: W 󰀃], 󰀂󰀆󰀆. 󰀂󰀀. Vgl. W 󰀂, 󰀃󰀂󰀇 (󰀁󰀈󰀆󰀉): ‚You see here how differently Scotus and Ockam regard the same question, how much more simple and lucid Ockam’s view is, and how much more certain Scotus’s complex theory is to take into account all the facts than Ockam’s simple one. I wish to lean a little towards the side of Scotus in what I say because I fear that you will lean very much the other way. To understand the historical position, you ought not to lean either way.‘ – 󰀃󰀃󰀆: ‚But perhaps by calling the Controversy of Nominalism and Realism trivial it is meant that any reasonable being can decide it in a jiffy. If you think then that all men who disagree with you on this question are foolish, I can only remark that whichever way your opinion lies there are certainly many men quite as competent in mental power, training, and information, who think that you have not fully probed the question. However though it doesn’t seem to me so, yet to others whom I must respect, it does seem easy to decide the question. Let it be so then [...]‘. – 󰀃󰀂󰀁: ‚[...] there is such a distinction as the Scotistic distinctio formalis. You will understand that I say this not because I believe it to be true or wish you to do so, – for throughout this course I care nothing whatever for the truth of logical doctrines – but only because I want to point out how differently a Scotist would regard this matter from what Ockham does‘. 󰀂󰀁. Vgl. M.H. Fisch, ‚The Decisive Year‘ (󰀁󰀉󰀈󰀄), xxvii. Ders., ‚Peirce’s Progress from Nominalism toward Realism‘, Monist 󰀅󰀁 (󰀁󰀉󰀆󰀇), 󰀁󰀅󰀉-󰀇󰀈, 󰀁󰀆󰀀: ‚When did he [sc. Peirce] take his first intended

󰀁󰀅󰀄

G ESCHE L INDE

er sich neben Kant, dem er nur kurze Zeit später eine „passage from the nominalistic to the realistic view of reality“󰀂󰀂 bescheinigen wird. Was sind die spezifisch von Thomas – und nicht von Duns – aufgeworfenen Topoi, mit denen Peirce sich in MS 󰀅󰀈󰀅 auseinandersetzt und die er für erwägenswert hält? Das lässt sich letztlich nur sehr eingeschränkt entscheiden, da MS 󰀅󰀈󰀅 im wesentlichen eine Vorleseanweisung für die ersten sechs Kapitel des Thomas-Traktats󰀂󰀃 enthält, ohne irgendwelche schriftlichen Erläuterungen dazu anzubieten,󰀂󰀄 und keinerlei Hinweis darauf liefert, dass Peirce außer der Einleitung auch noch die step toward realism? In 󰀁󰀈󰀆󰀈, in his three papers on cognition in the Journal of Speculative Philosophy (󰀅.󰀂󰀁󰀃-󰀃󰀅󰀇). His second? In 󰀁󰀈󰀇󰀁, in his article on Fraser’s edition of Berkeley in the North American Review (󰀈.󰀇-󰀃󰀈). Was it by gradual further steps that he reached what he called the extreme realism of his later years? He thought so, and so do I [...]‘. – Etwas vorsichtiger, aber letztlich in Übereinstimmung mit Fisch urteilt Nathan Houser, ‚Introduction‘, in Nathan Houser und Christian Kloesel (Hg.), The Essential Peirce. Selected Philosophical Writings, Bd, 󰀁, 󰀁󰀈󰀆󰀇-󰀉󰀃 (Bloomington IN, 󰀁󰀉󰀉󰀂), xxiv: ‚Probably the most significant development in Peirce’s intellectual life was the evolution of his thought from its quasi-nominalist and idealist beginnings to its broadly and strongly realist conclusions‘. – Noch zögernder, und dies meines Erachtens zu Recht, äußert sich John F. Boler, ‚Peirce and Medieval Thought‘, in Cheryl Misak (Hg.), The Cambridge Companion to Peirce (Cambridge a.o., 󰀂󰀀󰀀󰀄), 󰀅󰀈-󰀈󰀆, 󰀇󰀅: ‚But I have my doubts about the „nominalism to realism“ story as the best format for understanding Peirce’s overall development‘. 󰀇󰀆: ‚[...] a youthful espousal of nominalism does not seem to me to provide a very solid base from which to view Peirce’s subsequent development. At that time, being a nominalist was the politically correct stance for someone who wanted to give the impression of having a hard-headed and scientific outlook. It is unlikely, moreover, that even if Peirce held a number of „nominalistic“ positions, he was committed at that time to anything like a developed theory of nominalism‘. Vgl. auch CP 󰀆.󰀆󰀀󰀅 (‚Reply to the Necessitarians; Rejoinder to Dr. Carus‘, 󰀁󰀈󰀉󰀃): ‚Yet be it known that never, during the thirty years in which I have been writing on philosophical questions, have I failed in my allegiance to realistic opinions and to certain Scotistic ideas [...]‘. – Die einzige längere Passage, die mir einen substantiellen Hinweis auf eine „nominalistische“ Position des jungen Peirce zu enthalten scheint – wenngleich eine, die bereits „realistische“ Elemente enthält –, entstammt einem Text aus dem Jahre 󰀁󰀈󰀆󰀅: ‚An Unpsychological View of Logic to which are appended some applications of the theory herein contained to Psychology and other subjects‘, abgedruckt in: W 󰀁, 󰀃󰀁󰀀-󰀂󰀁, vgl. hier bes. 󰀃󰀁󰀁-󰀄. 󰀂󰀂. W 󰀂, 󰀄󰀇󰀀 (‚Fraser’s Berkeley‘, 󰀁󰀈󰀇󰀁). 󰀄󰀇󰀀-󰀁: ‚It was the essence of his philosophy to regard the real object as determined by the mind. That was nothing else than to consider every conception and intuition which enters necessarily into the experience of an object, and which is not transitory and accidental, as having objective validity. In short, it was to regard the reality as the normal product of mental action, and not as the incognizable cause of it‘. 󰀂󰀃. Die ersten sechs Kapitel der von Wadding herausgebenen Scotus-Ausgabe (I.󰀁-VI.󰀈) entsprechen den ersten sechs Kapiteln der Grotz-Übersetzung (I.󰀁.-VI.󰀈, S. 󰀁-󰀈) und den ersten sechs Kapiteln der Bursill-Hall-Ausgabe (hier I.󰀁-VI.󰀁󰀂, S. 󰀁󰀃󰀅-󰀄󰀉). Kapitel VII verlässt den einleitenden Überblick, um zu den speziellen aktivischen Bedeutungsmodi zu wechseln. 󰀂󰀄. Zu Ende der ersten sechs Kapitel der Modi significandi, die Peirce mit den ersten 󰀁󰀇 Kapiteln aus dem ersten Teil der Summa Logicae William of Ockhams (außerdem mit Teilen aus weiteren Kapiteln) kontrastiert, heißt es nur knapp (W 󰀂, 󰀃󰀂󰀇): ‚You see here how differently Scotus and Ockam regard the same question, how much more simple and lucid Ockam’s view is, and how much more certain Scotus’s complex theory is to take into account all the facts than Ockam’s simple one‘.

P EIRCE

ALS

M ODIST ?

󰀁󰀅󰀅

restlichen 󰀄󰀇 Kapitel des Traktats, die Etymologia und die Diasynthetica, zur Kenntnis genommen hätte. Obwohl direkte Abhängigkeiten meines Erachtens kaum vorliegen, lassen sich jedoch dennoch, nicht zuletzt im Blick auf andere Texte bzw. auf die größeren Zusammenhänge der Peirce’schen Philosophie, einige Gemeinsamkeiten angeben, wenngleich diese insgesamt weniger inhaltlicher Art sind, sondern eher die Fragerichtung und die systematischen Interessenslagen betreffen. Verwandtschaftssystematisch möchte ich diese Gemeinsamkeiten – auch auf die Gefahr hin, in die Falle der von Geoffrey Bursill-Hall getadelten „scissors-and-paste comparison“󰀂󰀅 zu tappen – in zwei verschiedenen Gruppen unterbringen: zum einen in der Gruppe der, anthropologisch gesprochen, ‚Affinalverwandtschaften‘ (der entfernteren bzw. Heirats-Verwandtschaften), zum anderen in der Gruppe der Konsanguinalverwandtschaften (der näheren bzw. Blutsverwandtschaften). 󰀂. Peirce und Thomas von Erfurt: Affinalverwandtschaften 󰀂.󰀁 Die distinctio formalis Das bereits erwähnte Vorlesungsmanuskript des Winters 󰀁󰀈󰀆󰀉/󰀇󰀀, das die ersten sechs Kapitel der Modi significandi aufruft, lässt erkennen, dass Peirce verhältnismäßig starkes Gewicht darauf legt, zugunsten der Idee einer distinctio formalis zu argumentieren, die sich zwar auch bei Thomas von Erfurt finden lässt, die aber zuvörderst Duns Scotus zugeschrieben werden muss; und tatsächlich zeigen die Skizzen zu Peirces Vorlesungsmanuskript, dass Peirce sich diesbezüglich auf den Sentenzenkommentar des Scotus, die sog. Ordinatio, bezogen hat.󰀂󰀆 Was Peirce nach eigener 󰀂󰀅. Bursill-Hall, ,Introduction‘, in Thomas of Erfurt, Grammatica speculativa, ed. Geoffrey Bursill-Hall (London, 󰀁󰀉󰀇󰀂), 󰀁󰀂󰀀 (mit Blick auf das Verhältnis zwischen Thomas und moderner Linguistik): ‚The danger of selecting certain features which present what may be a fortuitous similarity is that a scissors-and-paste comparison could result [...]‘. 󰀂󰀆. MS 󰀅󰀈󰀅 enthält dazu folgenden Abschnitt (nicht als Teil des fortlaufenden Textes der dritten Vorlesung, aber als Vorbereitung der Passagen W 󰀂, 󰀃󰀂󰀁, 󰀃󰀂󰀈-󰀉): ‚Scotus externally considered in style & doctrine. Now the fundamental characters of his philosophy as I understand them. Scotus has a method & is the first scholastic writer who has one – Formalitates – Formal distinctions What a formal distinction is in general terms This not treated systematically by Scotus. But the best passage relating to it is I dist 󰀂 pars 󰀂 (q 󰀇) The question here. The difficulty The essence not plural, the persons are. Therefore necessary to say that the essence – or that which is expressed in the definition – is distinct from the necessary property. But they are really the same thing. This leads to the consideration of the different kinds of distinctions

󰀁󰀅󰀆

G ESCHE L INDE

Aussage an der distinctio formalis interessiert, ist deren Fähigkeit, dem Wahrheitsanspruch von Propositionen Rechnung zu tragen: Wenn ein und dasselbe allgemeine Prädikat – beispielsweise ‚schwarz‘ – auf verschiedene Einzeldinge (bzw. logische Subjekte) angewendet werden kann – etwa auf ‚Nachbars Katze‘ und auf ‚meine Kaffeemaschine‘ – und die daraus resultierenden unterschiedlichen Propositionen gleichermaßen wahrheitsfähig sein sollen, dann muss gelten, dass den Einzeldingen nicht nur eine jeweils besondere, individuierte, sondern eine potentiell allgemeine Form inhäriert, wobei dieses Allgemeine sich im Einzelding bis zum Grad der Singularität ‚zusammenzieht‘, wie Peirce in enger Anlehnung an Scotus paraphrasiert, nämlich sich Näherbestimmmungen unterzieht.󰀂󰀇 Distinctio rationis between things separated only by an act of understanding – by an act observe [sic] not by a habit as Man is man All other distinction is distinctio ex natura rei. Of which contradictions are not true apart from the act of the mind He then gives some arguments to show that essence and property differ ex natura rei He then goes on to say that Distinctio in intellectu is double 󰀁 From different modes of conceiving the same formal object 󰀂 Difference in the objects formally considered ⎧ homo hominis Grammatical Example of 󰀁st ⎨ ⎩ homo humanitas Logical ⎧ homo asinus Example of 󰀂nd ⎨ ⎩ color [unleserlich]sibility Not separation in Thing [unleserlich] really distinctio rerum 󰀁 Suppositorum 󰀂 Naturarum Formal identity & distinction clearly defined. Formal distinction is between not two reals but two realitates. Ista duae realitates sunt una res Risibility, Flexibility, animality These not fanciful beings – however wrong it may be to maintain the unity in many.‘ Unabhängig davon hat Peirce sich zu anderen Gelegenheiten auf folgende Werke des Duns Scotus bzw. Textstellen bezogen: Quodlibeta, q. 󰀁󰀃, art. 󰀄 (W 󰀂, 󰀇󰀃, Anm. 󰀉 [‚Logical Comprehension and Extension‘, 󰀁󰀈󰀆󰀇]); Quaestiones super Praedicamenta Aristotelis, q. 󰀈 (W 󰀂, 󰀁󰀁󰀅 [‚Dictionary of Logic‘, 󰀁󰀈󰀆󰀇]; W 󰀂, 󰀁󰀅󰀇 [‚What Is Meant by Determined‘, 󰀁󰀈󰀆󰀈]); Quaestiones Subtillisimae super libros Metaphysicorum Aristotelis, lib. VII, q. 󰀁󰀈 (W 󰀂, 󰀂󰀄󰀀 [‚Consequences of Four Incapacities‘, 󰀁󰀈󰀆󰀈]; q. 󰀉, xiii. xv (CP 󰀃.󰀆󰀁󰀂 [in ‚Baldwin’s Dictionary of Philosophy and Psychology‘, Bd. 󰀁: Art. ‚Individual‘, 󰀁󰀉󰀀󰀁/󰀁󰀁); Super Universalia Porphyrii, q. 󰀃 (W 󰀂, 󰀄󰀃󰀀 [‚A System of Logic‘, 󰀁󰀈󰀇󰀀]); Commentaria in octo libros Physicorum cum adnotationibus Francisci à Pitigianis Aretini, lib. II, expos. 󰀂󰀀, textus 󰀁󰀈 (in: ‚Baldwin’s Dictionary‘, Bd. 󰀂: Art. ‚Precision‘, 󰀁󰀉󰀀󰀂/󰀁󰀁, zitiert in CP 󰀁.󰀅󰀄󰀉, P󰀁). 󰀂󰀇. W 󰀂, 󰀂󰀇󰀇 (󰀁󰀈󰀆󰀉): ‚Scotus admitted that in the singular thing there is nothing actually universal; all generality results from a relation of reason. Nevertheless, when a general predicate is attached by the mind to a thing, the proposition so formed may be true, and since the same predicate may also be truly asserted of other things, it is true that there is something in the thing which, though actually contracted to the grade of singularity, is in its own nature not repugnant to being

P EIRCE

ALS

M ODIST ?

󰀁󰀅󰀇

predicated of many. There is, then, a distinction between a predicate predicated of many and the singular forms in the several things by virtue of which the same general predicate is true. Yet since this general predicate is true, it really is in the several things, although it is there in the grade of singularity and identified with these singular forms‘. – Vgl. W 󰀂, 󰀄󰀇󰀀 (‚Fraser’s Berkeley‘, 󰀁󰀈󰀇󰀁): ‚[...] general conceptions enter into all judgments, and therefore into true opinions. Consequently a thing in the general is as real as in the concrete. It is perfectly true that all white things have whiteness in them, for that is only saying, in another form of words, that all white things are white; but since it is true that real things possess whiteness, whiteness is real. It is a real which only exists by virtue of an act of thought knowing it, but that thought is not an arbitrary or accidental one dependent on any idiosyncrasies, but one which will hold in the final opinion‘. 󰀄󰀇󰀃: ‚If, therefore, it is asked whether the universal is in things, the answer is that the nature which in the mind is universal, and is not in itself singular, exists in things. It is the very same nature which in the mind is universal and in re is singular; for if it were not, in knowing anything of a universal we should be knowing nothing of things, but only of our own thoughts, and our opinion would not be converted from true to false by a change in things‘. Der letzte Satz bezieht sich offenkundig auf Duns Scotus, Quaestiones super libros Metaphysicorum Aristotelis, lib. VII q. 󰀁󰀈, n. 󰀁󰀀 (Ausgabe Vivès, Bd. 󰀇, 󰀄󰀆󰀉-󰀇󰀀), zitiert bei L. Honnefelder, Scientia transcendens (󰀁󰀉󰀉󰀀), 󰀃󰀈󰀆, Anm. 󰀁󰀀. Honnefelder paraphrasiert, Scientia transcendens, 󰀃󰀈󰀆: ‚Wenn das Allgemeine etwas nur im Verstand und nicht „in re“ wäre, dann würden wir, so wendet Scotus an einer Stelle ein, wenn wir nur etwas vom Allgemeinen wissen, nichts von den Dingen wissen, sondern nur etwas von unseren Begriffen; unsere Meinung würde bei Änderung der Dinge selbst gar nicht falsch werden können‘. – Vgl. auch Maurice J. Grajewski, The Formal Distinction of Duns Scotus. A Study in Metaphysics, The Catholic University of America: Philosophical Series XC (Washington D.C., 󰀁󰀉󰀄󰀄), 󰀁󰀄󰀂: ‚Like most of his contemporaries, Scotus contends that the actual universal exists only in the intellect, while the potential universal, which is identified with the specific nature of things, exists only in things‘. 󰀁󰀄󰀃: ‚In the extramental world only the individual is actually existent‘. 󰀁󰀄󰀄: ‚[...] the common nature does not exist in the individual as a common nature but only inasmuch as it is conceived as common by the intellect. If it did, says the Subtle Doctor, then we would be forced to admit the existence of Platonic ideas or the really existent universals. On the other hand, the common nature is more than a simple logical being for otherwise it would be a pure figment of the mind and „we would know nothing about reality, but only about our concepts, and out opinion would not change from the true to the false with the change in the existence of a thing“. This universal or natura communis is incapable of existence except in individuals. The universal is indifferent to the actual existence or non-existence of things. However, the universal in itself is non-existent unless in something which represents it, namely, an individual‘. 󰀁󰀄󰀅: ‚[...] Scotus distinguishes in each individual two entities or realities which are formally distinct, namely, the universal and the particular. The first is a common element, the essence, the natura commnunis which is common to all individuals within the same species; the second is the haecceitas which, according to Scotus, constitutes the individual as such (the entitas singularis)‘. 󰀁󰀄󰀇: ‚[...] Scotus claims that every nature of itself us indifferent to singularity and to universality. It becomes singular by contraction; it becomes universal because of the operation of the cognitive mind‘. 󰀁󰀅󰀃: ‚The natura communis is not separated nor separable, evem by divine power, from the singular or the individual. [...] This positive reality or haecceity is formally distinct from the natura communis or specific nature because the two cannot be included in the same concept even though they are inseparable, and therefore, also, their definitions must be different. [...] Scotus‘ principle of individuation is closely allied with his doctrine of the formal distinction; in fact it is unintelligible if the formal distinction is discarded‘. Zum Begriff der contractio bei Scotus Honnefelder, Scientia transcendens, 󰀁󰀂󰀈: ‚[...] die Artnatur [...] ist [...] die noch unbestimmte Möglichkeit, die ihre abschließende Bestimmung erst durch den letztlich bestimmenden und vervollkommenden Akt der individuellen Differenz erfährt. Die washeitliche Determination des endlichen Seienden ist nicht ein Prozeß zunehmender Verarmung, weil er er ein zuvor Unbegrenztes unbegrenzt, sondern ein Prozeß wachsender Vervollkommung, weil er das zuvor Unbestimmt bestimmt‘. 󰀁󰀂󰀉: ‚In der Unendlichkeit der Unbestimmtheit der Artnatur

󰀁󰀅󰀈

G ESCHE L INDE

Die distinctio formalis unterscheidet demnach, so Peirce, an den vorliegenden Einzeldingen zwischen dem Allgemeinen und dem Singulären derart, dass dem Allgemeinen zwar kein unabhängiger Bestand außerhalb des jeweiligen Einzeldings unterstellt wird, der das Allgemeine zur eigenständigen Sache erhöbe,󰀂󰀈 dass ihm aber sehr wohl potentielle Realität zugeschrieben wird. Damit bildet die distinctio formalis nicht nur (dies gegen Ockham) eine Brücke zwischen der distinctio realis und der distinctio rationis,󰀂󰀉 sondern auch zwischen der distinctio realis und der distinctio und der daraus resultierenden Notwendigkeit einer individuellen Kontraktion (als Aktuation zur letzten unmittelbaren Bestimmtheit) manifestiert sich die Endlichkeit als übertreffbare Nichttotalität des von Gott verschiedenen Seienden. Gegenüber der Artnatur als dem noch Unbestimmten und so seiner Möglichkeit nach unendlich Mitteilbaren ist das endliche Individuum als das Vollbestimmte das Vollkommenere‘. 󰀂󰀈. Vgl. W 󰀂, 󰀃󰀂󰀈 (󰀁󰀈󰀆󰀉/󰀇󰀀): ‚You remember that Scotus holds that humanity or the general essence of man in the various men is not really distinct from the individual man but is formally distinct [...].‘ 󰀂󰀉. CP 󰀅.󰀃󰀁󰀂 = W 󰀂, 󰀂󰀄󰀀 (‚Some Consequences of Four Incapacities‘, 󰀁󰀈󰀆󰀈): ‚The great argument for nominalism is that there is no man unless there is some particular man. That, however, does not affect the realism of Scotus; for although there is no man of whom all further determination can be denied, yet there is a man, abstraction being made of all further determination. There is a real difference between man irrespective of what the other determinations may be, and man with this or that particular series of determinations, although undoubtedly this difference is only relative to the mind and not in re. Such is the position of Scotus‘. – Vgl. W 󰀂, 󰀃󰀂󰀁 (󰀁󰀈󰀆󰀉/󰀇󰀀): ‚Thus it appears that there is a distinction greater than a distinction merely in mentalibus and yet less than a distinction between different things or a distinctio realis. In other words there is such a distinction as the Scotistic distinctio formalis‘. – Vgl. auch W 󰀂, 󰀄󰀇󰀂-󰀃 (‚Fraser’s Berkeley‘, 󰀁󰀈󰀇󰀁): ‚[...] there is the celebrated dispute among Aristotelians as to whether the universal is really in things or only derives its existence from the mind. Universality is a relation of a predicate to the subjects of which it is predicated. That can exist only in the mind, wherein alone the coupling of subject and predicate takes place. But the word universal is also used to denote what are named by such terms as a man or a horse; these are called universals, because a man is not necessarily this man, nor a horse this horse. In such a sense it is plain universals are real; there really is a man and there really is a horse. The whole difficulty is with the actually indeterminate universal, that which not only is not necessarily this, but which, being one single object of thought, is predicable of many things. In regard to this it may be asked, first, is it necessary to its existence that it should be in the mind; and, second, does it exist in re? There are two ways in which a thing may be in the mind, – habitualiter and actualiter. A notion is in the mind actualiter when it is actually conceived; it is in the mind habitualiter when it can directly produce a conception. It is by virtue of mental association (we moderns should say), that things are in the mind habitualiter. In the Aristotelian philosophy, the intellect is regarded as being to the soul what the eye is to the body. The mind perceives likenesses and other relations in the objects of sense, and thus just as sense affords sensible images of things, so the intellect affords intelligible images of them. It is as such a species intelligibilis that Scotus supposes that a conception exists which is in the mind habitualiter, not actualiter. This species is in the mind, in the sense of being the immediate object of knowledge, but its existence in the mind is independent of consciousness. Now that the actual cognition of the universal is necessary to its existence, Scotus denies. The subject of science is universal; and if the existence of [the] universal were dependent upon what we happened to be thinking, science would not relate to anything real. On the other hand, he admits that the universal must be in the mind habitualiter, so that if a thing be considered

P EIRCE

ALS

M ODIST ?

󰀁󰀅󰀉

materialis, die beide im Fall von schwarzen Kaffeemaschinen oder schwarzen Nachbarskatzen keine Anwendung finden können, weil das Allgemeine (die Schwärze) keinen eigenen auffindbaren Sachbestand bildet, es also realiter nicht von der Schwärze dieser besonderen Kaffeemaschine unterschieden werden kann, und weil es nicht ohne das Singuläre auftritt, also materialiter nicht von der Kaffeemaschine hier und jetzt, in ihrer haecceitas, separiert werden kann. Der Umstand, dass Peirce die distinctio formalis aus einem wahrheitstheoretischen Interesse heraus propagiert󰀃󰀀 – aufgrund der „needs of signifying“,󰀃󰀁 wie er sagt – und darum von Propositionen ausgeht, mag as it is independent of its being cognized, there is no universality in it. For there is in re extra no one intelligible object attributed to different things. He holds, therefore, that such natures (i.e. sorts of things) as a man and a horse, which are real, and are not of themselves necessarily this man or this horse, though they cannot exist in re without being some particular man or horse, are in the species intelligibilis always represented positively indeterminate, it being the nature of the mind so to represent things. Accordingly any such nature is to be regarded as something which is of itself neither universal nor singular, but is universal in the mind, singular in things out of the mind. If there were nothing in the different men or horses which was not of itself singular, there would be no real unity except the numerical unity of the singulars; which would involve such absurd consequences as that the only real difference would be a numerical difference, and that there would be no real likenesses among things. If, therefore, it is asked whether the universal is in things, the answer is, that the nature which in the mind is universal, and is not in itself singular, exists in things. It is the very same nature which in the mind is universal and in re is singular; for if it were not, in knowing anything of a universal we should be knowing nothing of things, but only of our own thoughts, and our opinion would not be converted from true to false by a change in things. This nature is actually indeterminate only so far as it is in the mind. But to say that an object is in the mind is only a metaphorical way of saying that it stands to the intellect in the relation of known to knower. The truth is, therefore, that that real nature which exists in re, apart from all action of the intellect, though in itself, apart from its relations, it be singular, yet is actually universal as it exists in relation to the mind. But this universal only differs from the singular in the manner of its being conceived (formaliter), but not in the manner of its existence (realiter)‘. 󰀃󰀀. Vgl. W 󰀂, 󰀄󰀉󰀀 (󰀁󰀈󰀇󰀁): ‚The realists certainly held (as I have said) that universals really exist in external things. The only feature of the controversy which has appeared to me to need more emphasis than has hitherto been put upon it is that each party had its own peculiar ideas of what it is that is real, the realists assuming that reality belongs to what is present to us in true knowledge of any sort, the nominalists assuming that the absolutely external causes of perception are the only realities‘. – W 󰀂, 󰀄󰀇󰀀 (󰀁󰀈󰀇󰀁): ‚[...] general conceptions enter into all judgments, and therefore into true opinions. Consequently a thing in the general is as real as in the concrete. It is perfectly true that all white things have whiteness in them, for that is only saying, in another form of words, that all white things are white; but since it is true that real things possess whiteness, whiteness is real. It is a real which only exists by virtue of an act of thought knowing it, but that thought is not an arbitrary or accidental one dependent on any idiosyncrasies, but one which will hold in the final opinion‘. 󰀃󰀁. W 󰀂, 󰀃󰀂󰀁 (󰀁󰀈󰀆󰀉/󰀇󰀀): ‚There is then a peculiar importance in those distinctions which arise from the needs of signifying, over and above such importance as they may derive from their being mental distinctions. Yet these distinctions are not such as there are between different things. You cannot divide things into those that are signified by nouns and those that are signified by verbs – yet the distinction between noun and verb arises from the needs of signifying. So does most certainly

󰀁󰀆󰀀

G ESCHE L INDE

erklären, weshalb er sich gegen Ockhams terministische Logik positioniert: Der Nominalist Ockham, so sein Vorwurf, behandele das Allgemeine – in Gestalt von Qualitäten und Relationen (dies die beiden ersten der später insgesamt drei Peirce’schen Kategorien) – als bloße Terme, die der Verstand den Dingen attribuiere, und entkleide es damit jeglichen Anspruchs auf Realität.󰀃󰀂 Der Nachdruck, den Peirce hier der Idee einer Potentialität, oder vielleicht besser gesagt: einer Virtualität oder Habitualität, des Allgemeinen bzw. des Realen verleiht,󰀃󰀃 ist deshalb nicht uninteressant, weil er selbst später das Reale gelegentlich als dasjenige bezeichnen wird, das Zukünftiges determiniere bzw. sich in Gestalt von „would-bes“,󰀃󰀄 that between a noun and a pronoun but you cannot divide things into those pointed out by nouns and those pointed out by pronouns. So does that between singular and plural but you cannot separate men into singular men and plural men‘. 󰀃󰀂. W 󰀂, 󰀂󰀇󰀇-󰀈 (󰀁󰀈󰀆󰀉): ‚[...] his [sc. Occam’s] whole notion of a reality was that of a thing which is in itself whatever it really is. This he was able to see must be something devoid of all quality and all relations. All qualities and relations, according to him, are terms, subjects and predicates of written, spoken, or thought propositions; and the qualities and relations of things can consist in nothing except that the mind naturally applies to them such and such terms‘. 󰀃󰀃󰀄-󰀅: ‚[...] as to all relation he [Ockam] most emphatically and clearly denies that is exists as something different from the things related. And under relation in this connection he expressly says that he means to include relations of agreement as well as relations of opposition. [...] Therefore while he admits the real existence of qualities he expressly denies that these are the respects in which things agree and differ. For they agree and differ he says in themselves and in nothing else‘. – Die von Ockham angesetzte distinctio realis unterscheidet Peirce zufolge zwischen Form und Materie nicht als zwischen dem Allgemeinen und dem Besonderen, sondern als zwischen einem (realen) Besonderen und einem (realen) Besonderen. Vgl. auch W 󰀂, 󰀃󰀃󰀃 (󰀁󰀈󰀆󰀉/󰀇󰀀): ‚But though Ockham held that only singular things existed, it is not to be supposed that he denied that form and matter were two really distinct and real things. He held that all forms or characters were really individual but he held that they were real things really different from the matter‘. 󰀃󰀃󰀄: ‚Thus you perceive that Ockam while he denies that there is any distinction except between things really and numerically different, yet does allow that there is a real difference between things which are really inseparable‘. 󰀃󰀃. W 󰀂, 󰀂󰀇󰀇 (󰀁󰀈󰀆󰀉): ‚Thus there is a really, but only potentially, general form in the singular thing which yet in that thing in itself does not differ from the singular thing. This is the famous doctrine of formal distinctions, which is the central idea of the whole Scotistic philosophy‘. 󰀃󰀄. CP 󰀈.󰀁󰀉󰀁 (‚Review of Herbert Nichols’s A Treatise on Cosmology, Vol. 󰀁, Introduction [The University Press, Cambridge, Mass., 󰀁󰀉󰀀󰀄]‘: Entwurf, ca. 󰀁󰀉󰀀󰀄): ‚[...] the external world, (that is, the world that is comparatively external) doees not consist of existent objects merely, nor merely of these and their reactions; but on the contrary, its most important reals have the mode of being of what the nominalist calls „mere“ words, that is, general types and would-bes. The nominalist is right in saying that they are substantially of the nature of words; but his ‚mere‘ reveals a complete misunderstanding of what our everyday world consists of‘. – Vgl. MS L 󰀄󰀆󰀃 (󰀁󰀆.󰀇.󰀁󰀉󰀀󰀅), 󰀁󰀂󰀇-󰀈: ‚For necessity, to mean anything, must refer to the future. What is passed and gone is unchangeable, but it is not necessary. It has no binding force upon us. When a person says „So things must be“ we understand him to be speaking of the future. If one says of a historical character „He found such and such a measure to be necessary“ the reference is to what he in the past discovered [he] must in his subsequent conduct consider. Let us define the necessary. It is that which under any conceivable circumstances you please would be so and so‘. – MS 󰀆󰀈󰀀 (󰀁󰀉󰀁󰀃), 󰀃󰀅-󰀉: ‚We call that real concerning

P EIRCE

ALS

M ODIST ?

󰀁󰀆󰀁

von Folgen, manifestiere, und er dementsprechend auch seine Definition des Pragmatismus so präzisieren wird, dass die Bedeutung einer Vorstellung nicht in den zufälligen praktischen Konsequenzen bestehen soll, die dem Vorstellungsgegenstand faktisch zugeschrieben werden, sondern in der Summe der praktischen Konsequenzen, die aus der Wahrheit der Vorstellung notwendigerweise folgen würden.󰀃󰀅 Tatsächlich hat which whatever is true will [...] forever have been true, no matter what may at any time in any way be thought about it, using the word thought in the widest sense. Thus, the opinions of Malebranche were real opinions, since he opined as he did, whatever we may think he opined. The substance of a dream is not real, because whatever is true of it is so in that so the dreamer dreamed; and dreaming is only a particular kind of thinking. But the fact of the dream, if it actually took place, is a real fact, because it will always remain true that so and so was dreamed, whether the dreamer remembers it or not. Taking the word „real“ in this sense, which has been its proper sense ever since Duns Scotus coined the word late in the thirteenth century, it must be [...] admitted that not only actual facts and existing things, but also innumerable can-bes and would-bes are real. There is one class of would-bes whose reality it would seem that no reflecting man could well doubt, considering how onerous we all sometimes find them, though incomparably oftener how indispensible others of them daily and almost every moment show themselves to be. [...] all shall alike here be included under the designation habits‘. – MS 󰀆󰀈󰀃 (󰀁󰀉󰀁󰀃), 󰀆󰀅-󰀆: ‚Now of different Reals there are three different modes of Being; namely, that of „Would=bes“, that of „Can=bes“, and that of Actuals. By a Would=be I mean a State of Things whose Reality consists in the fact that whenever, (if ever, i.e. under whatever circumstances,) a certain State=of=things should be Real, some other State=of=things would be Real. By a „State=of=things“ I mean a Real of the sort that an assertion could precisely represent to the mind. By a Can=be I mean a State=of=Things consisting in the Unreality of any Would=be to prevent the Reality of a certain more or less general State=of=Things under some specified circumstances. It thus consists in the fact that a supposable Would=be is a Figment. The assertion of a Would=be would in substance amount precisely to a Conditional assertion, i.e. to the assertion that if a definite supposed state=of=things were real another stated State=of=Things would be real‘ (MS bricht ab). – Vgl. auch CP 󰀁.󰀂󰀇, P󰀁 (‚Essays on Meaning‘, 󰀁󰀉󰀀󰀉): ‚It must not be imagined that any notable realist of the thirteenth or fourteenth century took the ground that any „universal“ was what we in English should call a „thing“, as it seems that, in an earlier age, some realists and some nominalists, too, had done; though perhaps it is not quite certain that they did so, their writings being lost. Their very definition of a ‚universal‘ admits that it is of the same generic nature as a word, namely, is: „Quod natum optum est praedicari de pluribus“. Neither was it their doctrine that any „universal“ itself is real. They might, indeed, some of them, think so; but their realism did not consist in that opinion, but in holding that what the word signifies, in contradistinction to what it can be truly said of, is real. Anybody may happen to opine that „the“ is a real English word; but that will not constitute him a realist. But if he thinks that, whether the word „hard“ itself be real or not, the property, the character, the predicate, hardness, is not invented by men, as the word is, but is really and truly in the hard things and is one in them all, as a description of habit, disposition, or behavior, then he is a realist‘. – John F. Boler, Charles Peirce and Scholastic Realism. A Study of Peirce’s Relation to John Duns Scotus (Seattle, 󰀁󰀉󰀆󰀃), 󰀉󰀉: ‚The notion of the would-be in Peirce’s pragmatism involves two points. First, the would-be is a relation that is independent of past, present, and future events: it ranges over possible cases and is therefore general. Second, and more important, the would-be in some way controls the events‘. 󰀃󰀅. CP 󰀅.󰀄󰀀󰀂 (‚How to Make our Ideas Clear‘, 󰀁󰀈󰀇󰀈) = W 󰀃, 󰀂󰀆󰀆: ‚Consider what effects, that might conceivably have practical bearings, we conceive the object of our conception to have. Then, our conception of these effects is the whole of our conception of the object‘. – CP 󰀅.󰀃 (‚Baldwin’s Dictionary of Philosophy and Psychology‘, Bd. 󰀂: Art. ‚Pragmatic and Pragmatism‘, 󰀁󰀉󰀀󰀂): ‚The

󰀁󰀆󰀂

G ESCHE L INDE

Peirce sich später immer wieder nicht nur selbst als Realisten bezeichnet, sondern dafür explizit in Duns Scotus in Anspruch genommen.󰀃󰀆 doctrine appears to assume that the end of man is action – a stoical axiom which, to the present writer at the age of sixty, does not recommend itself so forcibly as it did at thirty. If it be admitted, on the contrary, that action wants an end, and that that end must be something of a general description, then the spirit of the maxim itself, which is that we must look to the upshot of our concepts in order rightly to apprehend them, would direct us towards something different from practical facts, namely, to general ideas, as the true interpreters of thought. Nevertheless, [...] the writer [...] would venture to suggest that it [the maxim] should always be put into practice with conscientious thoroughness, but that, when that has been done, and not before, a still higher grade of clearness of thought can be attained by remembering that the only ultimate good which the practical facts to which it directs attention can subserve is to further the development of concrete reasonableness; so that the meaning of the concept does not lie in any individual reactions at all, but in the manner in which those reactions contribute to that development. Indeed, in the article of 󰀁󰀈󰀇󰀈 [...] the writer practised better than he preached; for he applied the stoical maxim most unstoically, in such a sense as to insist upon the reality of the objects of general ideas in their generality‘. CP 󰀅.󰀉 (‚Pragmatism [󰀁]‘, ca. 󰀁󰀉󰀀󰀅): ‚Now this sort of consideration, namely, that certain lines of conduct will entail certain kinds of inevitable experiences is what is called a „practical consideration“. Hence is justified the maxim, belief in which constitutes pragmatism; namely, In order to ascertain the meaning of an intellectual conception one should consider what practical consequences might conceivably result by necessity from the truth of that conception; and the sum of these consequences will constitute the entire meaning of the conception‘. – CP 󰀅.󰀄󰀅󰀃 (‚Issues of Pragmaticism‘, 󰀁󰀉󰀀󰀅): ‚Another doctrine which is involved in Pragmaticism as an essential consequence of it, but which the writer defended [...] before he had formulated, even in his own mind, the principle of pragmaticism, is the scholastic doctrine of realism. This is usually defined as the opinion that there are real objects that are general, among the number being the modes of determination of existent singulars, if, indeed, these be not the only such objects. But the belief in this can hardly escape being accompanied by the acknowledgment that there are, besides, real vagues, and especially real possibilities. For possibility being the denial of a necessity, which is a kind of generality, is vague like any other contradiction of a general. Indeed, it is the reality of some possibilities that pragmaticism is most concerned to insist upon. The article of January 󰀁󰀈󰀇󰀈 endeavored to gloze over this point as unsuited to the exoteric public addressed; or perhaps the writer wavered in his own mind. He said that if a diamond were to be formed in a bed of cotton-wool, and were to be consumed there without ever having been pressed upon by any hard edge or point, it would be merely a question of nomenclature whether that diamond should be said to have been hard or not. No doubt this is true, except for the abominable falsehood in the word MERELY, implying that symbols are unreal. Nomenclature involves classification; and classification is true or false, and the generals to which it refers are either reals in the one case, or figments in the other. For if the reader will turn to the original maxim of pragmaticism at the beginning of this article, he will see that the question is, not what did happen, but whether it would have been well to engage in any line of conduct whose successful issue depended upon whether that diamond would resist an attempt to scratch it, or whether all other logical means of determining how it ought to be classed would lead to the conclusion which, to quote the very words of that article, would be „the belief which alone could be the result of investigation carried sufficiently far“.‘ – Vgl. aber auch CP 󰀈.󰀂󰀁󰀂 (‚Multitude and Number‘, ca. 󰀁󰀉󰀀󰀅): ‚The fact that he [sc. Man] has been able in some degree to predict how Nature will act, to formulate general „laws“ to which future events conform, seems to furnish inductive proof that man really penetrates in some measure the ideas that govern creation. Now man cannot believe that creation has not some ideal purpose. If so, it is not mere action, but the development of an idea which is the purpose of thought; and so a doubt is cast upon the ultra pragmatic notion that action is the sole end and purpose of thought‘. 󰀃󰀆. CP 󰀅.󰀃󰀁󰀂 (‚Some Consequences of Four Incapacities‘, 󰀁󰀈󰀆󰀈) = W 󰀂, 󰀂󰀄󰀀: ‚The great argument for nominalism is that there is no man unless there is some particular man. That, however,

P EIRCE

ALS

M ODIST ?

󰀁󰀆󰀃

In MS 󰀅󰀈󰀅 allerdings führt Peirce gegen Ockhams Nominalismus nicht etwa einen Text von Duns Scotus ins Feld, sondern Thomas von Erfurts Modi significandi. Auch hier lässt die distinctio formalis sich finden, und zwar im Kapitel IV,󰀃󰀇 das Peirce im Zuge seiner Vortragsreihe offenbar verlesen hat. Thomas scheint die distinctio formalis als eine begriffliche Unterscheidungsleistung zu verstehen, die sich anstatt auf die Sachen (res) als solche oder die Materien auf ‚rationes‘, Funktionsprinzipien, wie man vielleicht übersetzen könnte,󰀃󰀈 bezieht. Derer nennt Thomas drei: die ratio essendi, does not affect the realism of Scotus; for although there is no man of whom all further determination can be denied, yet there is a man, abstraction being made of all further determination. There is a real difference between man irrespective of what the other determinations may be, and man with this or that particular series of determinations, although undoubtedly this difference is only relative to the mind and not in re. Such is the position of Scotus‘. – Vgl. dazu L. Honnefelder, Scientia transcendens (󰀁󰀉󰀉󰀀), 󰀃󰀈: ‚In der näheren Ausgestaltung dieses Universalienrealismus beruft sich Peirce in einer für einen Denker des 󰀁󰀉. Jahrhunderts außerhalb der neuscholastischen Tradition ungewöhnlichen Weise auf Johannes Duns Scotus und dessen Realismus‘. 󰀃󰀈󰀃-󰀄: ‚Daß Peirce im Rahmen seiner Zuwendung zum mittelalterlichen Universalienrealismus gerade die scotistische Lehre als Ansatzpunkt seiner eigenen Lösung wählt, ist keineswegs als historische Zufälligkeit zu erklären. Wie die neuere Scotus-Forschung zeigt, hat Peirce hier ein Lehrstück beansprucht, das in signifikanter Weise aus jenem Grundansatz von Metaphysik resultiert, durch den sich Scotus von der gesamten älteren Tradition abhebt‘. 󰀃󰀇. Übersetzung Grotz: IV.󰀁, S. 󰀅 (Thomas von Erfurt, Abhandlung über die bedeutsamen Verhaltensweisen der Sprache [Tractatus de Modis significandi], übersetzt und eingeleitet von Stephan Grotz, Bochumer Studien zur Philosophie 󰀂󰀇 [Amsterdam und Philadelphia PA, 󰀁󰀉󰀈󰀈]); Ausgabe Bursill-Hall: IV.󰀈, S. 󰀁󰀄󰀂-󰀃. 󰀃󰀈. Ähnlich übersetzt den problematischen Begriff ‚ratio‘ auch Darius Gabler, Die semantischen und syntaktischen Funktionen im Tractatus ‚De modis significandi sive grammatica speculativa‘ des Thomas von Erfurt, Europäische Hochschulschriften 󰀁/󰀉󰀄󰀄 (Bern u.a., 󰀁󰀉󰀈󰀇), 󰀅󰀅: ‚Von den vier Bedeutungen des Ausdrucks „ratio“, die im 󰀁󰀃. Jahrhundert unterschieden wurden, scheint in diesem Kontext „Funktion“ die genaueste zu sein‘. – Einen weiteren Übersetzungsvorschlag bietet (lässt jedoch die ratio essendi unerwähnt) Bursill-Hall, ‚Introduction‘, in Thomas of Erfurt, Grammatica speculativa, ed. Bursill-Hall (󰀁󰀉󰀇󰀂), 󰀁-󰀁󰀂󰀆, 󰀃󰀃: ‚One of the most difficult of all Modistic terms is that of ratio which appears to occur in three basic types of collocation – intelligendi, significandi, and consignificandi; elsewhere it occurs in a non-technical sense and is used to express the means of doing or achieving something. In collocation with intelligendi, significandi, and consignificandi, ratio suggests the capability of doing something and as such would appear to be the second member of a second binary contrast, again taken from contemporary metaphysics, ie: act-potentiality. If we compare the use of ratio with modus (which is the other member of the pair), we would find that ratio represents the potentiality in contrast to modus which represents the act [...]‘. Ebenso Costantino Marmo, ‚A Pragmatic Approach to Language‘, in Sten Ebesen (Hg.), Sprachtheorien in Spätantike und Mittelalter, Geschichte der Sprachtheorie 󰀃 (Tübingen, 󰀁󰀉󰀉󰀅), 󰀁󰀆󰀉-󰀈󰀃, 󰀁󰀆󰀈, der die ‚ratio significandi‘ als ‚[t]he capability of conveying meaning‘ auffasst. – Wieder anders Jan Pinborg, Logik und Semantik im Mittelalter. Ein Überblick, mit einem Nachwort von Helmut Kohlenberger, Problemata 󰀁󰀀 (Stuttgart und Bad Cannstatt, 󰀁󰀉󰀇󰀂), 󰀁󰀁󰀃: ‚([...] es [handelt] sich nämlich um intensionelle und keine extensionellen Größen.) Sie werden als vom Intellekt gesetzte Relationen aufgefaßt‘. – Einen Vorschlag der Kombination aus Bursill-Hall und Pinborg, der aber nicht zur

󰀁󰀆󰀄

G ESCHE L INDE

die ratio intelligendi und die ratio consignificandi,󰀃󰀉 grob gesagt also Wirklichkeit oder Existenz, Erkennen und Sprechen. Daraus folgt, dass dort, wo es sich um ein und dieselbe ratio bzw. um ein und denselben Funktionszusammenhang handelt, wie etwa beim (aktiven) sprachlichen Bezeichnen und beim (passiven) sprachlichen Bezeichnetwerden (also dem, was Thomas den ‚aktivischen‘ und den ‚passivischen‘ Bezeichnungsmodus󰀄󰀀 nennt) oder beim (aktiven) Erkennen und beim (passiven) Erkanntwerden (dem ‚aktivischen‘ und dem ‚passivischen‘ Verstehensmodus󰀄󰀁), laut Thomas nicht formaliter unterschieden werden kann, und zwar offenbar deshalb nicht, weil die jeweils eine Beschreibungsperspektive (z.B. die aktivische) die jeweils andere (z.B. die passivische) notwendig impliziert,󰀄󰀂 Erklärung des Ausdrucks ‚ratio essendi‘ taugt, unterbreitet Angela Beuerle, Sprachdenken im Mittelalter. Ein Vergleich mit der Moderne, Studia Linguistica Germanica 󰀉󰀉 (Berlin und New York, 󰀂󰀀󰀁󰀀), 󰀁󰀈󰀂: ‚Die ratio significandi und consignificandi sind so vielleicht am besten als ein kognitives Vermögen zu verstehen, ein Verhältnis zwischen den Dingen der Welt und der Sprache herzustellen.‘ 󰀃󰀉. Vgl. Ausgabe Bursill-Hall IV.󰀈, S. 󰀁󰀄󰀂. 󰀄󰀀. Ausgabe Bursill-Hall IV.󰀈, S. 󰀁󰀄󰀄: ‚[...] modus significandi activus et passivus differunt materialiter, et sunt idem formaliter [...]‘. (‚[...] der aktivische Bezeichnungsmodus und der passivische weichen materialiter voneinander ab, und formaliter sind sie dasselbe [...]‘. Übersetzung Grotz, IV.󰀅, S. 󰀇: ‚Ebenso unterscheiden sich ein aktivisch bedeutsames und ein passivisch bedeutetes Verhalten in materialer Hinsicht voneinander, formal bleiben sie identisch‘). 󰀁󰀄󰀆: ‚[...] sed eadem est ratio, per quam vox est significans active, et per quam proprietas rei significatur passive; ergo materialiter sunt differentes, sed sunt idem formaliter‘ (‚[...] aber ein und dasselbe ist das Prinzip, durch das der Laut etwas aktiv Bezeichnendes ist und durch das die Eigenschaft der Sache passiv bezeichnet wird; also sind sie materialiter verschieden, formaliter aber dasselbe‘). – Ausgabe Bursill-Hall, V.󰀉, S. 󰀁󰀄󰀆: ‚[...] modus significandi passivus materialiter est in re, ut in subiecto; quia materialiter est proprietas rei; rei autem proprietas est in eo, cuius est, ut in subiecto. Formaliter autem est in eo subiecto, in quo est modus significandi activus, quia formaliter a modi significandi activo non discrepat‘ (‚[...] der passivische Bezeichnungsmodus ist materialiter in der Sache, gleichwie er im Subjekt ist; denn materialiter ist er die Eigenschaft der Sache; die Eigenschaft der Sache aber ist in demjenigen, der sie zugehört, gleichwie sie im Subjekt ist. Formaliter ist der passivische Bezeichnungsmodus in dem Subjekt, in dem der aktivische Bezeichnungsmodus ist, denn formaliter weicht er nicht vom aktivischen Bezeichnungsmodus ab‘. Übersetzung Grotz, V.󰀆, S. 󰀇: ‚In materialer Hinsicht hat ein passivisch bedeutetes Verhalten seinen systematischen Ort in einem Ding. Denn in materialer Hinsicht kommt ein passivisch bedeutsames Verhalten einer dinglichen Verhaltensweise gleich. Ihren systematischen Ort hat aber diese dingliche Verhaltensweise in demjenigen [Ding], welchem sie zugehört. In formaler Hinsicht hingegen hat ein passivisch bedeutetes Verhalten seinen systematischen Ort da, wo ihn auch ein aktivisch bedeutsames Verhalten hat‘). 󰀄󰀁. Ausgabe Bursill-Hall, IV.󰀈, S. 󰀁󰀄󰀄: ‚[...] modus intelligendi activus, et modus intelligendi passivus differunt materialiter, et conveniunt formaliter‘ (‚[...] der aktivische Verstehensmodus und der passivische Verstehensmodus weichen materialieter voneinander ab, und formaliter stimmen sie überein.‘ Übersetzung Grotz, IV.󰀄, S. 󰀆: ‚Ebenso unterscheiden sich ein aktivisch erkennendes und ein passivisch erkanntes Verhalten material voneinander, formal aber stimmen sie überein‘). 󰀄󰀂. Vgl. Ausgabe Bursill-Hall III.󰀇, S. 󰀁󰀄󰀀: ‚[...] duplex est modus significandi, scilicet activus et passivus, ita duplex est modus intelligendi, scilicet activus et passivus‘ (‚[...] der Bezeichnungsmodus

P EIRCE

ALS

M ODIST ?

󰀁󰀆󰀅

ohne dass dabei der Funktionszusammenhang insgesamt (nämlich das Bezeichnen oder das Erkennen) verlassen werden würde. Stattdessen kann in derartigen Fällen materialiter unterschieden werden, insofern ein und derselbe Funktionszusammenhang unterschiedliche materiale Residuen in Anspruch nimmt (so ist der aktivische Bezeichnungsmodus an den Laut [vox] gebunden und der passivische an das Ding [res] bzw. der aktivische Verstehensmodus an den Intellekt [intellectus] und der passivische wiederum an das Ding [res]). Hingegen greift die distinctio formalis dort, wo auf unterschiedliche Funktionszusammenhänge Bezug genommen werden soll: So können die seinsmäßigen Eigenschaften der Dinge (bzw. die Eigenschaften der Dinge „absolute“󰀄󰀃), die durch den Verstand passivisch erfassten Eigenschaften der Dinge und die lautlich bezeichneten Eigenschaften der Dinge zwar nicht materialiter und realiter unterschieden werden; sie müssen aber laut Thomas formaliter unterschieden werden,󰀄󰀄 eben weil sie sich ihren Prinzipien, ihren rationes, nach unterscheiden.󰀄󰀅 Im Blick auf Peirce verdient das von Thomas proklamierte Erfordernis einer distinctio formalis gemäß den rationes insofern Aufmerksamkeit, als diejenigen Größen, die durch die distinctio formalis unterschieden werden, sich laut Kapitel V der Modi significandi in einem Determinationsist ein zwiefacher, nämlich ein aktiver und ein passiver, so wie der Verstehensmodus ein doppelter ist, nämlich ein aktiver und ein passiver‘. Übersetzung Grotz III.󰀁󰀃, S. 󰀅: ‚Ebenso wie ein bedeutsames Verhalten ist auch ein erkenntnismäßiges Verhalten zweigeteilt, nämlich in ein aktivisches und in ein passivisches Verhalten‘). 󰀄󰀃. Ausgabe Bursill-Hall IV.󰀈, S. 󰀁󰀄󰀂. 󰀄󰀄. Ausgabe Bursill-Hall IV.󰀈, S. 󰀁󰀄󰀂: ‚[...] modi essendi, et modi intelligendi passivi, et modi significandi passivi, sunt idem materialiter et realiter, sed differunt formaliter [...]. [...] Et sunt eadem materialiter et realiter [...]. [...] Sed differunt formaliter [...]‘ (‚[...] die Seinsmodi, die passsivischen Verstehensmodi und die passivischen Bezeichnungsmodi sind materialiter und realiter dasselbe, aber formaliter weichen sie voneinander ab [...]. Materialiter und realiter sind sie dieselben [...]. [...] Aber formaliter weichen sie voneinander ab [...].‘ Übersetzung Grotz, IV.󰀁, S. 󰀅: ‚Seinsmäßige, passivisch erkannte und passivisch bedeutete Verhaltensweisen sind material wie der Wirklichkeit nach identisch, doch formal sind sie voneinander geschieden. [...] Diese drei Verhaltensweisen sind material wie der Wirklichkeit nach identisch. [...] Sie unterscheiden sich aber der Form nach [...]‘). 󰀄󰀅. Ausgabe Bursill-Hall IV.󰀈, S. 󰀁󰀄󰀄: ‚[...] sed alia est proprietas rei ad extra animam, et alia intellectus, et alia vocis; ita alia est ratio essendi, alia intelligendi, alia consignificandi [...]‘ (‚[...] aber das eine ist die Eigenschaft der Sache unabhängig von der Seele, etwas anderes die Eigenschaft des Intellekts und wieder etwas anderes die Eigenschaft des stimmlichen Lauts, so dass das Prinzip des Seins das eine ist, etwas anderes das Prinzip des Erkennens und wieder etwas anderes das Prinzip des Mitbedeutens [...].‘ Übersetzung Grotz, IV.󰀃, S. 󰀆: ‚Die Verhaltensweise eines Dings außerhalb der Seele [des Erkennenden], des Intellekts sowie des lautlichen Ausdrucks ist jeweils eine andere, und so meint der [formale] Gesichtspunkt „Sein“ „Erkenntnis“ und „Mitbedeutung“ hier jeweils [tatsächlich] ein anderes‘).

󰀁󰀆󰀆

G ESCHE L INDE

bzw. Kausalverhältnis zueinander befinden sollen. Denn Thomas weist den bezeichnenden Laut als mittelbar abhängig bzw. verursacht von der Sache󰀄󰀆 und sogar ‚unmittelbar‘ abhängig bzw. verursacht von der Sache als einer erkannten󰀄󰀇 aus, so dass umgekehrt nur das bezeichnet werden kann, was zuvor erkannt wurde, und nur das erkannt werden kann, was existiert. Ein verwandtes Interesse scheint Peirce zu verfolgen, wenn er schon im November 󰀁󰀈󰀆󰀆, nämlich in der neunten seiner Lowell Lectures sowie einem Manuskript aus derselben Zeit,󰀄󰀈 und schließlich in seinem Vortrag On a New List of Categories vom Mai 󰀁󰀈󰀆󰀇 drei Typen der „mental separation“󰀄󰀉 einführt, von denen er insbesondere eine sodann dazu verwendet, um seine Kategorientafel zu erstellen: mit dem Ergebnis, dass die drei so gefundenen ‚akzidentellen‘󰀅󰀀 Kategorien sich erstens wie Bedingendes 󰀄󰀆. Ausgabe Bursill-Hall V.󰀁󰀀, S. 󰀁󰀄󰀆: ‚Modus autem significandi activus, cum sit proprietas voci significativae, materialiter est in voce significativa, ut in subiecto; in proprietate autem rei sicut causatum in causa efficienti radicali et remota; et in intellectu sicut causatum in causa efficienti proxima [...]‘ (‚Der aktivische Bezeichnungsmodus ist, da er die Eigenschaft des bezeichnenden Lauts bildet, materialiter im bezeichnenden Laut, gleichwie er im Subjekt ist; in bezug auf die Eigenschaft der Sache ist er so wie ein Verursachtes im Verhältnis zu einer entfernten ursprünglichen Wirkursache; und in bezug auf den Intellekt ist er so wie ein Verursachtes im Verhältnis zu einer nahen Wirkursache [...].‘ Übersetzung Grotz, V.󰀆, S. 󰀇-󰀈: ‚Zu einer dinglichen Verhaltensweise verhält sich ein aktivisch bedeutsames Verhalten wie ein kausales Resultat zu seiner ursprünglichen Wirkursache, die diesem Resultat nicht unmittelbar vorangeht. Zum Intellekt verhält sich ein aktivisch bedeutsames Verhalten wie ein kausales Resultat zu seiner unmittelbar vorangehenden Wirkursache‘). – Ausgabe Bursill-Hall III.󰀇, S. 󰀁󰀄󰀀, 󰀁󰀄󰀂: ‚[...] modi significandi activi non sumuntur a modis essendi, nisi ut hi modi essendi ab intellectu apprehenduntur [...].‘ (‚[...] die aktivischen Bezeichnungsmodi werden nur dann aus den Seinsmodi gewonnen, wenn diese Seinsmodi vom Intellekt her erfasst werden‘. Übersetzung Grotz III.󰀁󰀄, S. 󰀅: ‚Denn die aktivisch bedeutsamen Verhaltensweisen leiten sich nur insofern von seinsmäßigen Verhaltensweisen her, als diese seinsmäßigen Verhaltensweisen vom Intellekt erfaßt werden‘). 󰀄󰀇. Ausgabe Bursill-Hall III.󰀇, S. 󰀁󰀄󰀀: ‚[...] modi significandi activi immediate a modis intelligendi passivis sumuntur‘ (‚[...] die aktivischen Bezeichnungsmodi werden unmittelbar aus aus den passivischen Verstehensmodi gewonnen‘. Übersetzung Grotz III.󰀁󰀃, S. 󰀄: ‚Die aktivisch bedeutsamen Verhaltensweisen leiten sich unmittelbar von passivischen erkannten Verhaltensweisen ab‘). III.󰀇, S. 󰀁󰀄󰀂: ‚[...] et ideo immediate modi significandi activi a modis intelligendi passivis sumuntur‘ (‚[...] und deshalb werden die aktivischen Bezeichnungsmodi unmittelbar aus den passivischen Verstehensmodi gewonnen‘. Übersetzung Grotz, III.󰀁󰀃, S. 󰀅: ‚Und deshalb leiten sich die aktivisch bedeutsamen Verhaltensweisen unmittelbar von passivisch erkannten Verhaltensweisen her‘). 󰀄󰀈. Abgedruckt in: W 󰀁, 󰀅󰀁󰀅-󰀂󰀈 (‚[On a Method of Searching for the Categories]‘, Nov./ Dez. 󰀁󰀈󰀆󰀆); vgl. bes. 󰀅󰀁󰀈-󰀉. 󰀄󰀉. W 󰀁, 󰀄󰀇󰀃 (‚Lowell Lectures‘: ‚Lecture IX‘); W 󰀂, 󰀅󰀀 (‚On a New List of Categories‘, 󰀁󰀈󰀆󰀇). 󰀅󰀀. Vgl. W 󰀁, 󰀅󰀂󰀀 ([‚Searching for the Categories‘], Nov./Dez. 󰀁󰀈󰀆󰀆):   BEING    Quality ‚CATEGORIES ACCIDENTS Relation    Representation.‘   SUBSTANCE

P EIRCE

ALS

M ODIST ?

󰀁󰀆󰀇

und Bedingtes zueinander verhalten und zweitens zumindest im Fall des zuletzt Bedingten, das seine Bedingungen in sich schließt, realiter in eins fallen. Keiner der drei Separierungstypen ist in der Lage, eine Art (‚rot‘) von einer Gattung (‚Farbe‘) zu separieren und damit, so muss man wohl folgern, einen Implikator von einem analytisch notwendigen Implikat: Wird das Prädikat ‚rot‘ ausgesagt, dann wird damit zugleich auch ‚Farbe‘ ausgesagt. Alle drei Typen sind andererseits, den von Peirce gegebenen Beispielen nach zu urteilen, in der Lage, zwei Gegenstände voneinander zu separieren, zwischen denen überhaupt kein Implikationsverhältnis besteht: So kann stets das Prädikat ‚rot‘ ausgesagt werden, ohne auf ‚blau‘ Bezug zu nehmen; und ebenso kann ‚Farbe‘ ausgesagt werden, ohne auf ‚Klang‘ Bezug zu nehmen. In eben dieser Leistung erschöpft sich die dissociation,󰀅󰀁 die von Peirce als die Unterscheidungsleistung mit dem stärksten Separierungsgrad beschrieben wird:󰀅󰀂 offenbar deshalb, weil sie die geringste Zahl der Fälle abdeckt. Das Gegenstandsspektrum zwischen dem analytisch Notwendigen einerseits und dem durch keinerlei Implikationsverhältnisse, sondern nur noch durch „the law of association of images“󰀅󰀃 Bestimmten andererseits wird durch die anderen beiden Separierungstypen abgedeckt, die sich zwar offenbar auf Implikationsverhältnisse beziehen, jedoch nicht auf analytisch, sondern nur auf synthetisch notwendige. So wird die Leistung der dissociation ebenso auch von der abstraction oder prescision󰀅󰀄 erbracht, die aber darüber hinaus ein Implikat von einem Implikator sondert:󰀅󰀅 ‚Raum‘ kann ausgesagt werden, ohne auf ‚Farbe‘ Bezug zu nehmen (insofern Raum auch als nichtfarbig vorgestellt werden kann, ‚Farbe‘ also zwar ‚Raum‘ impliziert, nicht aber ‚Raum‘ ‚Farbe‘). Der abstraction gesteht Peirce auf diese Weise 󰀅󰀁. W 󰀁, 󰀅󰀁: ‚I can dissociate red from blue, but not space from color, color from space, nor red from color‘. – W 󰀁, 󰀄󰀇󰀃 (‚Lowell Lectures‘: ‚Lowell Lecture IX‘, 󰀁󰀈󰀆󰀆): ‚We dissociate one object from another when we think of it without thinking of that other at the same time. We can for example dissociate a colour from a sound; but we cannot dissociate space from colour‘. 󰀅󰀂. W 󰀁, 󰀅: ‚Abstraction or prescision [...] supposes a greater separation than discrimination, but a less separation than dissociation‘. 󰀅󰀃. W 󰀁, 󰀅󰀀. – Vgl. W 󰀁, 󰀅󰀀: ‚Dissociation [...] is the consciousness of one thing, without the necessary simultaneous consciousness of the other‘. 󰀅󰀄. W 󰀁, 󰀄󰀇󰀃 (‚Lowell Lectures‘: ‚Lowell Lecture IX‘, 󰀁󰀈󰀆󰀆): ‚We prescind one object from another, when we suppose it to be without the other. For example, we can prescind space from colour because we can suppose a space to be uncoloured‘. – Vgl. auch W 󰀂, 󰀁󰀁󰀆-󰀇 (‚Dictionary of Logic‘, 󰀁󰀈󰀆󰀇). 󰀅󰀅. W 󰀁, 󰀅󰀁: ‚Prescision is not a reciprocal process. It is frequently the case, that, while A cannot be prescinded from B, B can be prescinded from A‘.

󰀁󰀆󰀈

G ESCHE L INDE

eine mittlere Separierungskraft zu. Discrimination󰀅󰀆 schließlich deckt die höchste Zahl der Fälle ab und ist damit die Separierungsoperation mit dem geringsten Trennungsgrad. Sie leistet über dissociation und abstraction hinaus – die sie also beide impliziert – die Separierung eines Implikators von einem Implikat: ‚Farbe‘ kann ausgesagt werden, ohne auf ‚Raum‘ Bezug zu nehmen, obwohl ‚Farbe‘ ‚Raum‘ synthetisch impliziert, ‚Raum‘ also das Implikat des Implikators ‚Farbe‘ ist. Die abstraction nun, die aus einem Implikator dessen Implikat extrahiert, also das Implikat ohne den Implikator thematisiert, bildet für Peirce den Schlüssel, um herauszufinden, in welchen aufeinander aufbauenden Stufen zwischen der ‚Einheit des Seins‘ einerseits (repräsentiert durch die Kopula in einer Proposition) und der ‚Mannigfaltigkeit der Substanz‘ andererseits (repräsentiert durch das logische Subjekt) als den zwei „Pole[n] eines Begriffsfeldes“󰀅󰀇 vermittelt werden kann, schlichter gesagt: welche Prädikattypen veranschlagt werden müssen und wie sich diese zueinander verhalten. Prädikate, so seine These, können zunächst allgemeine Qualitäten aussagen (z.B.: ‚die Nachbarskatze ist schwarz‘); sie können als Korrelate fungieren (z.B.: ‚die Nachbarskatze hat Junge‘, ‚die Nachbarskatze ist schwärzer als meine Kaffeemaschine‘); und sie können Repräsentationen einführen, die auf die Identität des zu Repräsentierenden und des Repräsentierten zielen (‚die Nachbarskatze ist die Katze auf diesem Foto‘). Der Weg, den Peirce einschlägt, um zu diesem Ergebnis zu gelangen, besteht darin, dass er zunächst von der Minimalbedingung für eine Proposition ausgeht, die darin liegt, dass Subjekt und Prädikat in irgendeiner Hinsicht oder Eigenschaft, von Peirce ‚ground‘ genannt, übereinkommen müssen: Wenn die Nachbarskatze als schwarz ausgewiesen wird, müssen Nachbarskatze und Schwärze etwas gemeinsam haben. Das Implikat dieser Art von Konstruktionsvorgang besteht in einem Vergleich, Vergleiche jedoch benötigen ein Relat und ein Korrelat. Darum funktioniert der zweite Typ von Prädikat so, dass auf ein eigenständiges ‚correlate‘󰀅󰀈 Bezug genommen wird: Die Nachbarskatze 󰀅󰀆. W 󰀁, 󰀄󰀇󰀃 (‚Lowell Lectures‘: ‚Lowell Lecture IX‘, 󰀁󰀈󰀆󰀆): ‚We discriminate one thing from another when we can recognize that they are not the same – thus we can discrimninate colour from space though we cannot prescind colour from space‘. 󰀅󰀇. Thomas Hünefeldt, Peirces Dekonstruktion der Transzendentalphilosophie in eine phänomenologische Semiotik, Epistemata, Reihe Philosophie 󰀃󰀁󰀃 (Würzburg, 󰀂󰀀󰀀󰀂), 󰀇󰀂. 󰀅󰀈. Vgl. W 󰀁, 󰀅󰀂󰀂: ‚Reference to a correlate [...] is the next conception in order after reference to a ground. This conception is so easy to seize that no elucidation is needed. It cannot be prescinded from reference to a ground, although this latter can be prescinded from it‘.

P EIRCE

ALS

M ODIST ?

󰀁󰀆󰀉

wird in ein Verhältnis zur Kaffeemaschine gesetzt. Das Implikat einer solchen Verhältnisbestimmung wiederum, so Peirce, besteht darin, dass sie ihrerseits letztlich mit Hilfe einer vermittelnden Repräsentation erfolgt: etwa so, als wenn die Buchstaben ‚b‘ und ‚p‘ miteinander verglichen werden, indem sie durch Umklappen auf der Horizontalen und Drehung um 󰀁󰀈󰀀 Grad aufeinander abgebildet werden und dabei „a new image“ entsteht, „which mediates between the images of the two letters“, oder als wenn in einem Lexikon ‚man‘ als Übersetzung von ‚homme‘ erscheint.󰀅󰀉 Darum nennt Peirce den dritten Prädikattyp ‚reference to an interpretant‘. Dass Peirce die gesamte Operation der Kategorienerzeugung als abstraction durchführt, heißt, dass es sich bei den Kategorien jedenfalls nicht um analytische bzw. deduzierbare Größen handeln soll; dies entspricht der sehr viel späteren wissenschaftstheoretischen Einordnung der Kategorienlehre (dann in Gestalt der Phänomenologie) als Subdisziplin der Philosophie anstatt der Mathematik. Entscheidend für die hier vertretene These einer ‚Affinalverwandschaft‘ mit Thomas ist, dass die mit Hilfe der abstraction derart erreichten „universal elementary conceptions“󰀆󰀀 aufeinander aufbauen oder sich konditional staffeln,󰀆󰀁 ähnlich wie das durch die distinctio formalis Unterschiedene bei Thomas sich in einem Determinationsverhältnis zueinander befindet: Die Bezugnahme auf ‚ground‘ kann nicht von ‚Sein‘ abstrahiert werden, wohl aber umgekehrt (‚Sein‘ ist also Implikat des Implikators Bezugnahme auf ‚ground‘);󰀆󰀂 die Bezugnahme auf ‚correlate‘ kann nicht von der Bezugnahme auf ‚ground‘ abstrahiert werden, wohl aber umgekehrt (Bezugnahme auf ‚ground‘ ist also Implikat des Implikators Bezugnahme 󰀅󰀉. W 󰀁, 󰀅󰀃. – Vgl. W 󰀁, 󰀅󰀂󰀂-󰀃 (‚Searching for the Categories‘, 󰀁󰀈󰀆󰀆): ‚Suppose, we think of a murderer as being in relation to a murdered person; in this case we conceive the act of the murder, and in this conception it is represented that corresponding to every murderer (as well as to every murder) there is a murdered person; and thus we resort again to a mediating representation which represents the relate as standing for a correlate with which the mediating representation is itself in relation. Suppose, we look out the word homme in a French dictionary; we shall find opposite to it the word man, which, so placed, represents homme as representing the same twolegged creature which man itself represents‘. 󰀆󰀀. W 󰀂, 󰀅󰀁 (‚On a New List of Categories‘, 󰀁󰀈󰀆󰀇); vgl. W 󰀁, 󰀄󰀇󰀃 (‚Lowell Lectures‘: ‚Lecture IX‘): ‚three universal conceptions‘. 󰀆󰀁. Vgl. Carl R. Hausman, Charles S. Peirce’s Evolutionary Philosophy (Cambridge MA a.o., 󰀁󰀉󰀉󰀃), 󰀁󰀀󰀂: ‚Each category, then, is a necesssary condition or presupposition for a richer or more complex conception or category‘. 󰀆󰀂. Vgl. W 󰀂, 󰀅󰀃.

󰀁󰀇󰀀

G ESCHE L INDE

auf ‚correlate‘); und die Bezugnahme auf ‚interpretant‘ kann nicht von der Bezugnahme auf ‚correlate‘ abstrahiert werden, wohl aber umgekehrt (Bezugnahme auf ‚correlate‘ ist also Implikat des Implikators Bezugnahme auf ‚interpretant‘);󰀆󰀃 ‚substance‘ schließlich (das ist Peirces äußerst folgenreiche Spitzenthese, die er nicht als solche ausweist) kann nicht von der Bezugnahme auf ‚interpretant‘ abstrahiert werden, wohl aber umgekehrt (Bezugnahme auf ‚interpretant‘ ist also Implikat des Implikators ‚substance‘). Entscheidend für die These der Affinalverwandtschaft ist weiterhin, dass sich die Kategorien insofern zwar nur formaliter voneinander isolieren lassen, als sie alle an ein und demselben, dem Prädikat bzw. später dem Phänomen, vorliegen, dass sie aber dennoch, indem sie sich an jedem Prädikat bzw. Phänomen manifestieren, Realien darstellen: „The universal categories [...] belong to every phenomenon, one being perhaps more prominent in one aspect of that phenomenon than another but all of them belonging to every phenomenon“.󰀆󰀄 Auf diese Weise praktiziert Peirce eine Operation der Separierung, die sich in ähnlicher Weise bei Thomas herauslesen lässt und die sich offenbar insofern aus skotistischem Geiste speist, als bei Scotus „the notion of a formality [...] embrace[s] all objective realities that cannot exist separately“,󰀆󰀅 so dass gilt: „In the Scotistic metaphysic [...] separation and separability are the necessary signs of the real distinction; if separability is lacking then the distinction is formal but not real“.󰀆󰀆 󰀆󰀃. Vgl. W 󰀂, 󰀅󰀄. 󰀆󰀄. CP 󰀅.󰀄󰀃 (‚Lectures on Pragmatism‘, 󰀁󰀉󰀀󰀃). Dazu auch W 󰀂, 󰀁󰀆󰀂 (‚Questions on Reality‘, 󰀁󰀈󰀆󰀈): ‚Is matter necessary to reality? No‘. – Vgl. K. Oehler, Charles Sander Peirce (󰀁󰀉󰀉󰀃), 󰀅󰀉: ‚Die Repräsentanten der Kategorien, d. h. das in deren Formen Erfahrene und Erfahrbare, sind keine nominalistischen Figmente, sondern sind sich durchhaltende Grundzüge der Sachen selbst, um die es jeweils geht, Grundzüge (features), die allem, was erfahren wird oder denkbarerweise erfahrbar ist, gemeinsam sind (CP 󰀅.󰀃󰀇). Die Kategorien [...] beschreiben [...] die allgemeinste Struktur der Realität. [...] Sie konstituieren sie [sc. diese Gegenstandsbereiche] nicht, sondern machen sie zugänglich. Es geht Peirce um Erschließung der Welt, nicht um ihre Konstituierung‘. 󰀆󰀅. M.J. Grajewski, The Formal Distinction of Duns Scotus (󰀁󰀉󰀄󰀄), 󰀇󰀇. 󰀆󰀆. Ebd. Nach Grajewski bezieht die distinctio formalis bei Scotus sich auf formale Nichtidentität (vgl. ebd. 󰀆󰀅) und bildet ‚a subdivision‘ der distinctio realis, die stets eine distinctio ex natura rei ist, im Unterschied zu der distinctio per opus intellectus (vgl. ebd.); demzufolge muss das formal Distinkte, um zugleich auch real distinkt zu sein, Separabilität aufweisen. Vgl. 󰀁󰀀󰀀: ‚The termini of the real distinction are actually separated or separable; the formal distinction exists between entities that are inseparable even by divine powers.‘ (Ähnlich 󰀇󰀄, 󰀇󰀆). Auf diese Weise sind beispielsweise ‚sensitive and intellectual soul in man‘ Gegenstand der distinctio formalis, nicht jedoch der distinctio realis, denn ‚Scotus claims that it is a contradiction to say that the sensitive soul can persist in existence without the intellectual soul, despite the fact that the sensitive soul is prior in nature to the

P EIRCE

ALS

M ODIST ?

󰀁󰀇󰀁

Übernimmt Peirce die Idee einer solchen distinctio formalis (hier in Gestalt der abstraction als einer mental separation) also directamente von Thomas bzw. von Duns Scotus oder von beiden? Das lässt sich schon allein deshalb nicht eindeutig entscheiden, weil nicht sicher feststeht, wann er diesen Autoren zum ersten Mal begegnete. Ausweislich des Registers der Writings erwähnt Peirce die distinctio formalis zum ersten Mal im März 󰀁󰀈󰀆󰀉 (in einer Rezension der von dem Moralphilosophen Noah Porter verfassten Monographie The Human Intellect; with an Introduction upon Psychology and the Soul 󰀆󰀇); und er wird (den Collected Papers nach zu urteilen) noch bis in das Jahr 󰀁󰀉󰀀󰀂 hinein auf sie Bezug nehmen,󰀆󰀈 wenngleich in lediglich oberflächlicher Weise. Die abstraction󰀆󰀉 (zu der er sich aber möglicherweise ebenso durch Aristoteles hat anregen lassen) begegnet bei ihm bereits zwischen 󰀁󰀈󰀆󰀁󰀇󰀀 und 󰀁󰀈󰀆󰀄,󰀇󰀁 allerdings unspezifisch; erst im Spätherbst 󰀁󰀈󰀆󰀆 gesellt Peirce ihr, nach einem Zwischenschritt im Frühjahr desselben Jahres, zwei andere Operationen bei󰀇󰀂 und grenzt alle drei deutlich voneinander ab. Spätestens 󰀁󰀈󰀆󰀆, möglicherweise früher,󰀇󰀃 beginnt Peirce, sich mit der damals noch recht neuen intellectual‘ (󰀇󰀄). Damit unterscheidet Scotus sich von Aquinas, denn (󰀇󰀇): ‚[...] in the Thomistic sense [...] separability is not required for a real distinction, e.g., between the soul and its powers which are really distinct and yet cannot be separated, or once separated, exist‘. Das eigentliche Gegenüber der distinctio realis bildet bei Scotus die distinctio logica oder mentalis als ‚product of our mind regarding the same reality under different aspects or from a different point of view‘ (󰀄󰀂). ‚To obtain a logical distinction it suffices that the mode of conceiving be diverse either grammatically or logically. Thus we say that „man“ and „humanity“ are distinct logical aspects of the same formal object, the one being abstract, the other concrete. On the other hand, we have the concept „man“ [homo] and the concept of „pertaining to man“ [hominis] wherein the diversity is purely grammatical since the formal object in the first instance is placed in the nominative case, while in the latter it is expressed by the possessive or genetive case‘ (󰀄󰀃). 󰀆󰀇. Abgedruckt in: W 󰀂, 󰀂󰀇󰀃-󰀈󰀁. 󰀆󰀈. Vgl. CP 󰀂.󰀃󰀂󰀄 (‚Syllabus‘, 󰀁󰀉󰀀󰀂); CP 󰀂.󰀄󰀅󰀄 (‚Grand Logic‘, 󰀁󰀈󰀉󰀃). 󰀆󰀉. Zur Abstraktion bei Duns Scotus, eingeschlossen das Verhältnis zwischen cognitio abstractiva und cognitio intuitiva, das auch Peirce beschäftigt, siehe Fernando Inciarte, ‚Natura ad unum – ratio ad opposita. Zur Transformation des Aristotelismus bei Duns Scotus‘, in Jan P. Beckmann u.a. (Hgg.), Philosophie im Mittelalter. Entwicklungslinien und Paradigmen (Hamburg, 󰀁󰀉󰀈󰀇), 󰀂󰀅󰀉-󰀇󰀃, bes. S. 󰀂󰀆󰀀-󰀁. 󰀇󰀀. Vgl. W 󰀁, 󰀄󰀇 (‚The Modus of the IT‘, 󰀁󰀈󰀆󰀁); 󰀆󰀇, 󰀇󰀀, 󰀈󰀃-󰀄 (‚Treatise on Metaphysics‘, 󰀁󰀈󰀆󰀁/󰀆󰀂); 󰀈󰀅 (‚Analysis of Creation‘, 󰀁󰀈󰀆󰀁). 󰀇󰀁. Vgl. W 󰀁, 󰀁󰀄󰀆. 󰀁󰀅󰀁 (‚Analysis of the Ego‘, 󰀁󰀈󰀆󰀄); auch W 󰀁, 󰀃󰀀󰀇, 󰀃󰀁󰀃 (‚Unpsychological View of Logic‘, 󰀁󰀈󰀆󰀅) u. 󰀃󰀂󰀈 (‚Logic of the Sciences‘, 󰀁󰀈󰀆󰀅). 󰀇󰀂. Vgl. W 󰀁, 󰀃󰀅󰀃 (‚Logic Chapter I‘, 󰀁󰀈󰀆󰀆): ‚Abstraction or precision is of two kinds; by obscuration and by position‘. 󰀇󰀃. Für die abstraction vgl. Carl Prantl, Geschichte der Logik im Abendlande, Bd. 󰀂 (Hildesheim u.a., 󰀁󰀉󰀉󰀇) (Nachdr. d. Ausg. Leipzig, 󰀁󰀈󰀆󰀁), 󰀂󰀀󰀉, v.a. aber 󰀂󰀄󰀈, wo es zu John of Salisbury

󰀁󰀇󰀂

G ESCHE L INDE

Geschichte der Logik im Abendlande von Carl Prantl󰀇󰀄 zu beschäftigen, um vor allem seine Kenntnisse scholastischer Logik zu vertiefen. Hinweise auf Beschäftigung mit Originaltexten finden sich ab 󰀁󰀈󰀆󰀇, im Zusammenhang seiner Vortragsreihe vor der American Academy of Arts and Sciences, deren gewähltes Mitglied er im Januar 󰀁󰀈󰀆󰀇 geworden war:󰀇󰀅 Hinweise indirekter Art in On a New List of Categories, vorgetragen am 󰀁󰀄. Mai,󰀇󰀆 Hinweise direkter Art in Upon Logical Comprehension and Extension, vorgetragen am 󰀁󰀃. November.󰀇󰀇 Tatsächlich lässt sich bei Max Fisch lesen, dass Peirce im März und April 󰀁󰀈󰀆󰀇 „early editions of Duns Scotus“,󰀇󰀈 zweifelsohne einschließlich des Traktats De modis significandi, erworben habe. John Boler wiederum berichtet, dass einer der (von Peirce an die Johns-Hopkins-Universität verkauften) Scotus-Bände auf der Umschlaginnenseite den Namen ‚Benjamin Peirce‘ trage, so dass Charles möglichweise durch seinen Vater, und dann vermutlich schon deutlich vor 󰀁󰀈󰀆󰀆/󰀆󰀇, mit Duns und bzw. oder Thomas in Berührung gekommen wäre.󰀇󰀉 Klaus Oehler schließlich setzt 󰀁󰀈󰀆󰀄 als das Datum an, heißt, dieser habe ‚mit Zurückweisung des Einwandes, dass das abstrahirende Denken ein nichtberechtigtes [...] sei, dem Denken die Fähigkeit vindicirt, die Dinge anders zu betrachten, als sie im Concreten sind [...], und hiedurch die Abstraction als die Grundbedingung aller geistigen Technik bezeichnet‘. Vgl. damit Peirce in W 󰀁, 󰀁󰀅󰀁 (‚Analysis of the Ego‘, 󰀁󰀈󰀆󰀄): ‚[...] in abstractions‘ being the subject of the thought‘. Auch W 󰀂, 󰀂󰀃󰀁 (‚Consequences of Four Incapacities‘, 󰀁󰀈󰀆󰀈): ‚Sensation and the power of abstraction or attention may be regarded as, in one sense, the sole constituents of all thought.‘ Auf John von Salisbury nimmt Peirce zum ersten Mal in W 󰀂, 󰀇󰀁, Anm. 󰀃 (‚Logical Comprehension and Extension‘, 󰀁󰀈󰀆󰀇), Bezug, unter Angabe eines Zitats und einer Quelle, die offenbar nicht von Prantl stammen. 󰀇󰀄. Vgl. W 󰀁, 󰀃󰀈󰀀 (‚Lowell Lectures‘: ‚Lecture I‘, 󰀁󰀈󰀆󰀆). 󰀇󰀅. Vgl. Edward C. Moore, ‚Preface‘, in Writings of Charles S. Peirce, vol. 󰀂: 󰀁󰀈󰀆󰀇-󰀁󰀈󰀇󰀁, hg. v. Edward C. Moore u.a. (Bloomington, 󰀁󰀉󰀈󰀄), xi-xvii, xii; M.H. Fisch, ‚The Decisive Year‘ (󰀁󰀉󰀈󰀄), xxv. 󰀇󰀆. Vorgetragen nämlich anlässlich des 󰀅󰀈󰀂. Monatstreffens der American Academy of Arts and Sciences; veröffentlicht in Proceedings of the American Academy of Arts and Sciences 󰀇 (󰀁󰀈󰀆󰀈), 󰀂󰀈󰀇-󰀉󰀈. – Es war dies die dritte Vorlesung des Jahres 󰀁󰀈󰀆󰀇 in einer Reihe von vieren bzw. fünfen, mit denen Peirce sich nach den Lowell Lectures 󰀁󰀈󰀆󰀆 über ‚The Logic of Science; or: Induction and Hypothesis‘ und den Harvard Lectures 󰀁󰀈󰀆󰀅 ‚On the Logic of Science‘ der wissenschaftlichen Öffentlichkeit als Logiker und Philosoph vorstellte. Unmittelbar zuvor, auf den 󰀅󰀈󰀀. und 󰀅󰀈󰀁. Monatstreffen der Akademie am 󰀁󰀂. März 󰀁󰀈󰀆󰀇 und am 󰀉. April 󰀁󰀈󰀆󰀇, hatte er zu den Themen ‚On an Improvement in Boole’s Calculus of Logic‘ und ‚On the Natural Classification of Arguments‘ gesprochen; danach, auf dem 󰀅󰀈󰀇. Monatstreffen am 󰀁󰀃. November, sollte ‚Upon Logical Comprehension and Extension‘ folgen; im September hatte er bereits das Vorhaben ‚Upon the Logic of Mathematics‘ vorgestellt. 󰀇󰀇. W 󰀂, 󰀇󰀂-󰀃 (‚Logical Comprehension and Extension‘, 󰀁󰀈󰀆󰀇). 󰀇󰀈. M.H. Fisch, ‚The Decisive Year‘ (󰀁󰀉󰀈󰀄), xxiv. 󰀇󰀉. J.F. Boler, Charles Peirce and Scholastic Realism (󰀁󰀉󰀆󰀃), 󰀃󰀇-󰀈, Anm. 󰀃: ‚It is known that Peirce was acquainted with at least a considerable portion of the works of Scotus, which was included in the volumes he sold to the Johns Hopkins University; the fact that the volumes are underscored

P EIRCE

ALS

M ODIST ?

󰀁󰀇󰀃

ab dem Peirce sich „dem Studium der Logik und der Geschichte der Logik zu widmen begann“.󰀈󰀀 Die wahrscheinlichste Hypothese wird lauten müssen, dass Peirce eigenständig, und zwar infolge seiner andauernden Auseinandersetzung mit der Kategorienlehre Kants seit 󰀁󰀈󰀅󰀅󰀈󰀁 und dann verstärkt seit 󰀁󰀈󰀆󰀁,󰀈󰀂 zu einer eigenständigen Unterscheidung verschieden and that errata were noted in the indexes suggests they were closely read by Peirce. [...] I have inspected these volumes, but unfortunately Peirce’s marginal notes are scarce and uninformative. It is interesting, however, that one of the incunabula has the name of Peirce’s father, Benjamin Peirce, written on the inside cover. This suggests that Charles may have been introduced to Scotus through his father’s library‘. 󰀈󰀀. K. Oehler, Charles Sander Peirce (󰀁󰀉󰀉󰀃), 󰀄󰀉. Ebd.: ‚Nach den Angaben seiner autobiograpischen Skizze hat sich Peirce zwei Jahre hindurch intensiv mit dem Kategorienproblem beschäftigt, um am Ende dieser zwei Jahre „mit demonstrativer Gewißheit“ zu erkennen, „daß an Kants formaler Logik etwas falsch war“ (CP 󰀄.󰀂) [...] nämlich [...] daß in Kants sogenannter metaphysischer Deduktion der reinen Verstandesbegriffe, das heißt der Kategorien, zwar die Entsprechungen zwischen den Funktionen und den Kategorien stimmen, aber eine Rechtfertigung der Urteilstafel und eine Begründung von deren Vollständigkeit fehlen. Kant habe sich statt dessen mit dem Hinweis begnügt, daß sich die von ihm in der Tafel der Urteile vorgenommene Einteilung, wenn auch nicht in allem, so doch im wesentlichen an die „gewohnte Technik der Logiker“ (KdrV B 󰀉󰀆) halte. Bei aller Verehrung für Kant zog Peirce es vor, dessen beiläufige Aussage über die Geschichte der Logik doch lieber selbst zu prüfen, statt nur hinzunehmen‘. – Vgl. J.F. Boler, ‚Peirce and Medieval Thought‘ (󰀂󰀀󰀀󰀄), 󰀆󰀂: ‚[...] sometime around the mid-󰀁󰀈󰀆󰀀s, perhaps dissatisfied with the logic texts of the time, he undertook a concentrated study of the history of logic‘. 󰀈󰀁. W 󰀁, 󰀂 (‚My Life‘, 󰀁󰀈󰀅󰀉): ‚󰀁󰀈󰀅󰀅 Graduated at Dixwell’s and entered College. Read Schiller’s Aesthetic Letters and begun the study of Kant‘. – Vgl. CP 󰀃.󰀄󰀀󰀅 (‚The Critic of Arguments‘, 󰀁󰀈󰀉󰀂): ‚When, in my teens, I was first reading the masterpieces of Kant, Hobbes, and other great thinkers, my father, who was a mathematician, and who, if not an analyst of thought, at least never failed to draw the correct conclusion from given premisses, unless by a mere slip, would induce me to repeat to him the demonstrations of the philosophers, and in a very few words would usually rip them up and show them empty‘. – Alessandro Topa nennt als ‚die frühesten uns erhaltenen Manuskripte, die eine argumentative Auseinandersetzung mit der Topik Kants zum Gegenstand haben‘, Manuskripte vom 󰀂󰀁. Mai 󰀁󰀈󰀅󰀉 (Die Genese der Peirce‚schen Semiotik, Teil 󰀁: Das Kategorienproblem [󰀁󰀈󰀅󰀇󰀁󰀈󰀆󰀅], Epistemata 󰀄󰀂󰀈 [Würzburg, 󰀂󰀀󰀀󰀇], 󰀁󰀈󰀁). 󰀈󰀂. W 󰀁, 󰀂 (‚My Life‘, 󰀁󰀈󰀅󰀉): ‚󰀁󰀈󰀆󰀁 No longer wondered what I would do in life but defined my object‘. Die erste Frucht der Beschäftigung mit Kant findet sich in W 󰀁, 󰀅󰀇, 󰀇󰀂, 󰀇󰀅-󰀆, 󰀇󰀈 (‚[A Treatise on Metaphysics]‘, 󰀁󰀈󰀆󰀁/󰀆󰀂); ausführlicher fallen der Brief an Francis E. Abbot vom 󰀅. Februar 󰀁󰀈󰀆󰀅 (W 󰀁, 󰀁󰀅󰀆-󰀆󰀀) und die siebte der ‚Harvard Lectures‘ aus demselben Jahr aus, die ganz Kant gewidmet ist (W 󰀁, 󰀂󰀄󰀀-󰀇󰀁). – Vgl. auch CP 󰀄.󰀁ff. (‚Detached Ideas on Vitally Important Topics‘, 󰀁󰀈󰀉󰀈): ‚In the early sixties I was a passionate devotee of Kant, at least as regarded the Transcendental Analytic in the Critic of the Pure Reason. I believed more implicitly in the two tables of the Functions of Judgment and the Categories than if they had been brought down from Sinai. Hegel, so far as I knew him through a book by Vera repelled me. Now Kant points out certain relations between the categories. I detected others; but these others, if they had any orderly relation to a system of conceptions, at all, belonged to a larger system than that of Kant’s list. Here there was a problem to which I devoted three hours a day for two years, rising from it, at length, with the demonstrative certitude that there was something wrong about Kant’s formal logic. Accordingly, I read every book I could lay hands upon on logic, and of course Kant’s essay on the falsche Spitzfindigkeit der vier syllogistischen Figuren; and here I detected a fallacy similar to that of the

󰀁󰀇󰀄

G ESCHE L INDE

strukturierter mentaler Distinktionen bzw. ‚separations‘ gekommen war, als er der distinctio formalis begegnete, dass er dann jedoch in ihr eine Operation erkannte, die seiner eigenen philosophischen Vorgehensweise im Blick auf die Kategorien entsprach, und er sich auf diese Weise in seiner Affirmation des Realismus bestärken ließ.󰀈󰀃 󰀂.󰀂. Sprache, Denken, Wirklichkeit Schon zu Beginn der Modi significandi wird deutlich, dass Thomas bestrebt ist, Sprache und sprachunabhängige oder -vorgängige Wirklichkeit nicht auseinanderfallen zu lassen, sondern sie als durch den Intellekt miteinander verschränkt auszuweisen, indem, so seine These, der Intellekt lautliche Äußerungen zur Bezeichnung jener Wirklichkeit verwende, von der er zuvor affiziert worden sei. Darum spricht Thomas zunächst, phlogistic chemists. For Kant argues that the fact that all syllogisms can be reduced to Barbara shows that they involve no logical principle that Barbara does not involve. [...] Kant omits to inquire whether the very reasoning by which he reduces the indirect moods to Barbara may not itself introduce an additional logical principle. Pursuing this suggestion, I found that that was in truth the case, and I succeeded [...] in demonstrating that the second and third figures each involved a special additional logical principle, both of which enter into the fourth figure. [...] Thus to find that the passage from one way of viewing a fact to another way of viewing the same fact should be a logical principle was naturally food for reflection. [...] Why should there be three principles of reasoning, and what have they to do with one another? This question, which was connected with other parts of my schedule of philosophical inquiry that need not be detailed, now came to the front. Even without Kant’s categories, the recurrence of triads in logic was quite marked, and must be the croppings out of some fundamental conceptions. I now undertook to ascertain what the conceptions were. This search resulted in what I call my categories. I then named them Quality, Relation, and Representation. But I was not then aware that undecomposable relations may necessarily require more subjects than two; for this reason Reaction is a better term. Moreover, I did not then know enough about language to see that to attempt to make the word representation serve for an idea so much more general than any it habitually carried, was injudicious. The word mediation would be better. Quality, reaction, and mediation will do. But for scientific terms, Firstness, Secondness, and Thirdness, are to be preferred as being entirely new words without any false associations whatever. How the conceptions are named makes, however, little difference‘. 󰀈󰀃. Analog fällt das Urteils John Bolers im Blick auf das Verhältnis von Peirce und Duns Scotus aus, J.F. Boler, ‚Peirce and Medieval Thought‘ (󰀂󰀀󰀀󰀄), 󰀇󰀃-󰀄: ‚What needs emphasis is that the contribution of Scholastic realism is only one element in the development of Peirce’s ultimate position. For example, that reality, properly understood, is somehow thought-relative is not something new for Peirce even in 󰀁󰀈󰀇󰀁. It is early on associated with the idea of a community of inquiry; and it is not unfair to say that Peirce is still struggling at the end of his life with a scheme for grounding the objectivity of these thought-relative data. Then, the Scholastic constituents, of course, are radically transformed as modes of being that constitute rather than depend upon individual substances‘.

P EIRCE

ALS

M ODIST ?

󰀁󰀇󰀅

in Kapitel I.󰀃,󰀈󰀄 einerseits von einem ‚aktivischen Bezeichnungsmodus‘ der Lautfolge (vox) und andererseits von einem ‚passivischen Bezeichnungsmodus‘ der bezeichneten Sache (res): Der Laut bezeichnet, die Sache wird bezeichnet – der Ausdruck ‚Bezeichnungsmodus‘ kann also äquivok verwendet werden󰀈󰀅 –; und der vermittelnde Intellekt muss als ein rezeptives Vermögen, „virtus passiva“,󰀈󰀆 von derjenigen Sache in Bewegung versetzt werden („movetur“󰀈󰀇), die er sodann mit dem Laut aktiv zu bezeichnen trachtet. Eine der Spitzenthesen der Modi significandi lautet dementsprechend: „ergo cuilibet modo significandi activo correspondet aliqua proprietas rei, seu modus essendi rei“,󰀈󰀈 „also entspricht einem jeden beliebigen aktivischen Bezeichnungsmodus eine Eigenschaft oder ein Seinsmodus der Sache“.󰀈󰀉 Der naheliegende Einwand gegen dieses Modell lautet, dass Thomas für ein und denselben Gesamtvorgang, das lautliche Bezeichnen einer zuvor durch den Intellekt erfassten Sache, zwei Erklärungsmuster kombinieren muss, die sachlich auf verschiedenen Ebenen liegen bzw. für die auf den ersten (und vielleicht auch den zweiten) Blick eine unterschiedliche Struktur anzunehmen wäre: das Muster eines quasi-naturhaften Verusachungsprozesses im Blick auf den Zusammenhang zwischen Sache und empfangendem Intellekt, indem die Sache den Intellekt informiert, und das Muster des Referierens bzw. Repräsentierens im Blick auf den Zusammenhang von 󰀈󰀄. Zählung nach der Übersetzung Grotz; Ausgabe Bursill-Hall: I.󰀂. 󰀈󰀅. Ausgabe Bursill-Hall I.󰀂, S. 󰀁󰀃󰀄: ‚Circa primum est sciendum, quod modus significandi duo importat aequivoce. Dicitur enim de modo significandi activo et passivo‘. – Vgl. dazu auch Grotz, Einleitung, xxxi, der in Anm. 󰀆󰀉 auf eben diese Textstelle hinweist: ‚[...] für Thomas [steht] diese Opposition von aktivischem und passivischem Bedeutungsmodus vorweg unter dem Vorzeichen einer Äquivokation [...]‘. 󰀈󰀆. Ausgabe Bursill-Hall II.󰀄, S. 󰀁󰀃󰀈. 󰀈󰀇. Ebd. 󰀈󰀈. Ebd. 󰀈󰀉. Übersetzung Grotz II.󰀆, S. 󰀃: ‚Folglich entspricht jedem aktivisch bedeutsamen Verhalten jeweils ein bestimmtes dingliches und damit ein seinsmäßiges Verhalten (Seinsmodus)‘. – Vgl. Grotz, II.󰀆 / Bursill-Hall II.󰀄, S. 󰀁󰀃󰀈: ‚quia cum intellectus vocem ad significandum sub aliquo modo significandi activo imponit, ad ipsam rei proprietatem aspicit, a qua modum significandi activum originaliter trahit [...]‘ (‚Denn wenn der Intellekt den Laut zum Zweck des Bezeichnens in einem aktivischen Bedeutungsmodus setzt, betrachtet er jene Eigenschaft der Sache, von der er den aktivischen Bedeutungsmodus ursprünglich bezieht [...]‘. Übersetzung Grotz, II.󰀆., S. 󰀃: ‚Wenn der Intellekt den lautlichen Ausdruck zum Zweck des Bedeutens unter einem bestimmten aktivischen Verhalten ausprägt, dann richtet sich die Aufmerksamkeit des Intellekts gerade auf diejenige dingliche Verhaltensweise, aus welcher der Intellekt ein aktivisch bedeutsames Verhalten ursprünglich gewinnt‘).

󰀁󰀇󰀆

G ESCHE L INDE

dem durch den Intellekt verwendeten Laut und der Sache. Tatsächlich jedoch entgeht Thomas diesem Einwand dadurch, dass er beide Teilvorgänge als Determinierungsakte beschreibt: Die Sache determiniert den Intellekt, und aufgrund bzw. infolge dieser Determinierung determiniert der Intellekt sodann seinerseits den bezeichnenden Laut.󰀉󰀀 Der Preis für diese Lösung besteht allerdings darin, dass Thomas den Zusammenhang zwischen dem bezeichnenden Laut, der vox significativa, und der Sache, der res, unplausibel eng fassen muss, nämlich letztlich im Sinne eines kausalen Abhängigkeitsverhältnisses.󰀉󰀁 Das ist der Grund, aus dem er vor dem Problem zu stehen kommt, wie das feminine Substantiv ‚deitas‘, als vox significativa, sich auf eine nicht-feminine res, Gott, beziehen kann, obwohl diese Sache selbst nicht die durch das grammatische Femininum üblicherweise angezeigte Eigenschaft des Erleidens, „proprietas patientis“,󰀉󰀂 aufweist. Der so entstandenen Schwierigkeit󰀉󰀃 versucht Thomas sich zu entledigen, 󰀉󰀀. Ausgabe Bursill-Hall II.󰀄, S. 󰀁󰀃󰀈: ‚quia intellectus cum sit virtus passiva, de se indeterminata, ad actum determinatum non vadit, nisi aliunde determinetur‘ (‚Denn der Intellekt gelangt, weil er ein passives und von sich aus unbestimmtes Vermögen ist, nur dann zu einem determinierten Akt, wenn er von anderswoher bestimmt wird.‘ Übersetzung Grotz II.󰀆, S. 󰀃: ‚Da nämlich der Intellekt ein rezeptives Vermögen darstellt, das von sich aus unbestimmt ist, gelangt er nur zu einem Akt der Bestimmung, wenn er von etwas anderem her bestimmt wird‘). – Vgl. Reinhold F. Glei, ‚Die Grammatica speculativa des Thomas von Erfurt (um 󰀁󰀃󰀀󰀀)‘, in Wolfram Ax (Hg.), Von Eleganz und Barbarei. Lateinische Grammatik und Stilistik in Renaissance und Barock (Wiesbaden, 󰀂󰀀󰀀󰀁), 󰀁󰀁-󰀂󰀇, 󰀁󰀇: ‚Die Determination des Intellekts durch den Gegenstand erfolgt auf Grund bestimmter modi essendi, „Seinsweisen“ des Gegenstands, die im Intellekt bestimmte modi intelligendi, „Verstehensweisen“, hervorrufen – anders gesagt: Die Eigenschaften des Gegenstands (proprietates rei) determinieren die Eigenschaften des Verstandes (proprietates intellectus). Diese Relation [...] [weist] dem Verstand offenbar eine passive Rolle zu[...] [...]‘. 󰀉󰀁. Siehe oben Anm. 󰀄󰀆 u. 󰀄󰀇. ̶ A. Beuerle, Sprachdenken im Mittelalter (󰀂󰀀󰀁󰀀), 󰀁󰀆󰀉-󰀇󰀀 (in bezug auf die Modisten im allgemeinen): ‚Denn wirkende Ursache der modi significandi [...] sind die modi intelligendi der verstandenen Sache – und entsprechend sind es die modi essendi für die modi intelligendi. So entsteht eine Ursachenkette vom Sein zum Denken und vom Denken zur Sprache, bei der die Seinsweisen zur mittelbaren Ursache der Bezeichnungsrelation werden [...]‘. – Stephan Meier-Oeser, Die Spur des Zeichens. Das Zeichen und seine Funktion in der Philosophie des Mittelalters und der frühen Neuzeit (Berlin und New York, 󰀁󰀉󰀉󰀇), 󰀇󰀅: ‚Dieser Intellekt muß jedoch, wie etwa Thomas von Erfurt meint, als passives und von sich selbst her unbestimmtes Vermögen, seinerseits hierzu erst durch die Dingeigenschaften determiniert und motiviert werden. Insofern korrespondiert jedem modus significandi eine Eigenschaft oder Seinsweise des bezeichneten Dings. Die grammatische Struktur jeder Aussage ist damit bis in ihre einzelnen Komponenten hinein gleichsam Abbild eines extramentalen sachlichen Zusammenhanges‘. 󰀉󰀂. Ausgabe Bursill-Hall II.󰀅, S. 󰀁󰀃󰀈. 󰀉󰀃. Das Problem der Genera taucht an späterer Stelle erneut auf. Vgl. dazu R.F. Glei, ‚Die Grammatica speculativa des Thomas von Erfurt (um 󰀁󰀃󰀀󰀀)‘ (󰀂󰀀󰀀󰀁), 󰀂󰀂-󰀃: ‚Wie schon am Beispiel deitas erläutert, soll das genus femininum die proprietas patientis, das genus masculinum hingegen die proprietas agentis bezeichnen. Mag dies – unter mittelalterlichen Prämissen – für Wörter wie vir und

P EIRCE

ALS

M ODIST ?

󰀁󰀇󰀇

indem er die Anwendung der vox significata ‚deitas‘ auf die res Gott als Resultat eines Imaginations- sowie Attributionsvorgangs beschreibt: Die von der Materie separierten Substanzen – zu denen laut Thomas von Aquin neben Gott auch die Seele sowie die Engel zählen – können nur von den sensibilia, den sinnenhaft wahrnehmbaren Dingen, her verstanden werden, so dass die Eigenschaften der letzteren auch für die ersteren imaginiert󰀉󰀄 werden: Gott wird als erleidend imaginiert, indem er als Gebete erhörend vorgestellt wird. Die solchermaßen imaginierten bezeichneten Eigenschaften werden sodann jenen Nomina, die immaterielle Substanzen bezeichnen, attribuiert, ihnen also semantisch zugewiesen, wobei als hinreichendes Kriterium dafür ein ‚non repugnat‘󰀉󰀅 gilt, nämlich mangelnder Selbstwiderspruch. Überzeugen kann dieser Vorschlag allerdings insofern nicht so recht, als auf diese Weise Thomas‘ Absicht, die dichte Korrespondenz oder „Isomorphie“󰀉󰀆 von Sprache bzw. Grammatik und Wirklichkeit zu behaupten,󰀉󰀇 jedenfalls für die immateriellen Substanzen unterlaufen wird. Da das Verhältnis von Sprechen (sowie Sprachverstehen), Denken und Realität für Peirce seit frühesten Jahren ein Lebensthema darstellt, verwundert es nicht, dass er den Einleitungskapiteln der Modi significandi ebenso wie der Summa Logicae des William of Ockham besondere Aufmerksamkeit schenkt. Dennoch unterscheiden sich sein Ansatz, insbesondere in methodischer Hinsicht, von dem des Thomas. Erstens verzichtet Peirce auf die Annahme einer direkten Verursachung des Denkens durch das Seiende und dementsprechend einer genauen Analogie zwischen beiden. Stattdessen dreht er die Ordnung zwischen mulier verständlich sein, kommt die Grammatica speculativa bei leblosen Gegenständen wie lapis (masc.) und petra (fem.) in Erklärungsnot: Thomas nennt diese beiden nahezu bedeutungsgleichen Beispielwörter, erklärt den Widerspruch des unterschiedlichen Genus aber nicht‘. 󰀉󰀄. Vgl. Ausgabe Bursill-Hall II.󰀅, S. 󰀁󰀃󰀈. 󰀉󰀅. Vgl. ebd. 󰀉󰀆. S. Meier-Oeser, Die Spur des Zeichens (󰀁󰀉󰀉󰀇), 󰀇󰀄. 󰀉󰀇. Vgl. A. Beuerle, Sprachdenken im Mittelalter (󰀂󰀀󰀁󰀀), 󰀁󰀆󰀆: ‚[...] die Sprache muss, um in ihren Aussagen sinnvollen Zugriff auf die präexistente Welt zu haben, dieser Ordnung der Dinge folgen, kann dies, da sie keine materielle Verbindung zum konkreten Sein der Dinge hat, jedoch nur über die abstrahierende Instanz des Verstehens, so dass ihr Nachvollzug der Welt ein mittelbarer ist. Diese Abhängigkeit der Sprache von der äußeren Welt – eine axiomatische Annahme mittelalterlicher Sprachbetrachtung – bedeutet für die Sprache eine strukturelle Mimesie und gibt vor, dass die Sprache denselben Beschreibungs- und Ordnungsprinzipien folgt, [sic] wie das Sein der Dinge selbst. [...] Diese strukturelle Isomorphie von äußerer Welt und Sprache, vermittelt über den Intellekt, gilt für die modistischen Grammatiker so als Grundbedingung sprachlicher Wirksamkeit [...]‘.

󰀁󰀇󰀈

G ESCHE L INDE

diesen beiden Größen gewissermaßen um: Das Reale ist dasjenige, was Erkenntnisse nicht produziert, sondern durch diese repräsentiert wird, näherhin: was durch wahre Sätze repräsentiert wird.󰀉󰀈 Diese zunächst unspektakuläre These präzisiert er, indem er das Reale als dasjenige bestimmt, was (im Unterschied zum Fiktiven) zwar unabhängig von partikularen Überzeugungen, nicht jedoch unabhängig von einem potentiellen finalen Konsens der Forschergemeinde (im weitesten Sinne) ist,󰀉󰀉 der aus einer konsequenten Überprüfung an der Erfahrung gewonnen wird. Das Reale ist dementsprechend das Repräsentierbare, so dass umgekehrt ein schlechterdings nicht Repräsentierbares auch kein Reales sein kann. Diese These vertritt Peirce schon 󰀁󰀈󰀆󰀈, mit dem Argument, dass, wenn Begriffe aus Abstraktionen von Erfahrungsurteilen gewonnen werden, 󰀉󰀈. Vgl. z.B. CP 󰀈.󰀁󰀅󰀃 (‚[Karl Pearson, The Grammar of Science]‘, ca. 󰀁󰀉󰀀󰀀): ‚[...] every scientific research goes upon the assumption, the hope, that in reference to its particular question, there is some true answer. That which that truth represents is a reality‘. 󰀉󰀉. Vgl. W 󰀂, 󰀄󰀆󰀉 (‚Fraser’s Berkeley‘, 󰀁󰀈󰀇󰀁): ‚[...] to assert that there are external things which can be known only as exerting a power on our sense, is nothing different from asserting that there is a general drift in the history of human thought which will lead it to on general agreement, one catholic consent. [...] It is obvious how this way of thinking harmonizes with a belief in an infallible Church, and how much more natural it would be in the Middle Ages than in Protestant or positivist times‘. CP 󰀈.󰀁󰀅󰀃 (‚[Karl Pearson, The Grammar of Science]‘, ca. 󰀁󰀉󰀀󰀀): ‚This reality being cognizable and comprehensible, is of the nature of thought. Wherein, then, does reality consist? In the fact that, though it has no being out of thought, yet it is as it is, whether you or I or any group of men think it to be so or not. The question of whether Hamlet was insane is the question whether Shakespeare conceived him to be insane. Consequently, Hamlet is a figment and not a reality. But as to the inkstand being on my table, though I should succeed in persuading myself and all who have seen it that it is a mere optical illusion, yet there will be a limit to this, and by the photographic camera, the balance, new witnesses, etc., it will, at last, I guess, force its recognition upon the world. If so, it has the characteristic which we call reality. There is a blind force about the inkstand by which it crowds its way into our universe in spite of all we can do‘. – Dieser Entwurf des Erkenntnisprozesses als eines gemeinschaftlichen bringt den Protestanten Peirce dazu, einer recht verstandenen Katholizität einiges abzugewinnen, W 󰀂, 󰀃󰀅󰀆-󰀇 (‚Practical Logic‘, 󰀁󰀈󰀆󰀉/󰀇󰀀): ‚The belief in the right to a private opinion which is the essence of protestantism, is carried to a ridiculuous excess in our community‘. W 󰀂, 󰀄󰀇󰀀 (‚Fraser’s Berkeley‘, 󰀁󰀈󰀇󰀁): ‚[...] the catholic consent which constitutes the truth is by no means to be limited to men in this earthly life or to the human race, but extends to the whole community of minds to which we belong, including some probably whose senses are very different from ours, so that in that consent no predication of a sensible quality can enter, except as an admission that so certain sorts of senses are affected‘. – Vgl. K. Oehler, Charles Sander Peirce (󰀁󰀉󰀉󰀃), 󰀇󰀀: ‚Die Konstitution des Realen ist immer schon geleistet, und zwar durch die intersubjektive Interaktion der die Vermittlung herstellenden Gemeinschaft der Menschen, die Zeichen produziert [...]. [...] Real ist in diesem Sinne, was regelhaft ist, und das heißt, was im Prinzip durch jedes mögliche Mitglied dieser unendlichen Gemeinschaft verifiziert werden kann. Das ist real, was in the long run erkennbar ist. Realität ist somit bestimmt durch die Bedingungen der Möglichkeit eines unendlichen, realen Prozesses der Erkenntnis‘.

P EIRCE

ALS

M ODIST ?

󰀁󰀇󰀉

der Begriff eines schlechterdings Unerkennbaren eine Selbstwidersprüchlichkeit darstelle.󰀁󰀀󰀀 Die daraus abgeleitete Folgerung lautet: „[...] cognizability (in its widest sense) and being are not merely metaphysically the same, but are synonymous terms“.󰀁󰀀󰀁 Im Ergebnis stimmt er darin insofern mit Thomas überein, als dieser ja den Seinsmodus, den passivischen Erkenntnismodus und den passivischen Bezeichnungsmodus für materialiter und realiter identisch gehalten hatte.󰀁󰀀󰀂 Doch Peirce nimmt, in aufklärerischer Tradition, seinen Ausgangspunkt nicht von einer schon vorausgesetzten Ontologie, sondern von der wissenschaftstheoretischen bzw. wissenschaftslogischen Frage nach der Möglichkeit wissenschaftlicher Forschung bzw. nach den Bedingungen von Erkenntnis. Zweitens vollziehen sich für Peirce nicht nur das Sprechen bzw. aktivische Bezeichnen sowie das passivische Bezeichnetwerden im Medium der Zeichen, sondern auch das Denken bzw. Erkennen, einschließlich des Wahrnehmens: „[...] thought is in signs [...]“.󰀁󰀀󰀃 Sein diesbezügliches Argument lautet, dass Denken sich als Abfolge von Gedanken ereignet, die aufeinander bezogen sind, so dass ein logisch späterer Gedanke einen früheren Gedanken interpretiert bzw. der frühere Gedanke als ein Zeichen für den späteren Gedanken als den Interpretanten des Zeichens fungiert. Auch Wahrnehmungsprozesse tragen diesen Charakter, indem 󰀁󰀀󰀀. W 󰀂, 󰀂󰀀󰀈 (‚Questions Concerning Certain Faculties Claimed for Man‘, 󰀁󰀈󰀆󰀈): ‚[...] all our conceptions are obtained by abstractions and combinations of cognitions first occurring in judgments of experience. Accordingly, there can be no conception of the absolute incognizable, since nothing of that sort occurs in experience. [...] what I think is of the nature of a cognition, and so of anything else which can be experienced. Consequently, the highest concept which can be reached by abstractions from judgments of experience – and therefore the highest concept which can be reached at all – is the concept of something of the nature of a cognition. Not, then, or what is other than, if a concept, is a concept of a cognizable. Hence, not-cognizable, if a concept, is a concept of the form „A, not-A“, and is, at least, self-contradictory. [...] Over against any cognition, there is an unknown but knowable reality; but over against all possible cognition, there is only the self-contradictory‘. Vgl. W 󰀂, 󰀂󰀀󰀀 (‚Questions Concerning Certain Faculties Claimed for Man‘, 󰀁󰀈󰀆󰀈): ‚Any cognition is a consciousness of the object as represented [...]‘. Auch W 󰀁, 󰀃󰀁󰀁-󰀂 (‚Unpsychological View of Logic‘, 󰀁󰀈󰀆󰀅): ‚What else is a thing but that which a perception or sign stands for? To say that quality is denoted is to say that it is a thing‘. – K. Oehler, Charles Sander Peirce (󰀁󰀉󰀉󰀃), 󰀆󰀈: ‚Denn eine Realität, für die es keine Zeichenrepräsentation gibt, ist keine Realität für den Menschen‘. 󰀁󰀀󰀁. W 󰀂, 󰀂󰀀󰀈 (‚Questions Concerning Certain Faculties Claimed for Man‘, 󰀁󰀈󰀆󰀈). 󰀁󰀀󰀂. Vgl. Ausgabe Bursill-Hall IV.󰀈, Übersetzung Grotz IV.󰀁; siehe oben Anm. 󰀄󰀄. 󰀁󰀀󰀃. W 󰀂, 󰀁󰀆󰀃 (‚[Questions on Reality (A)]‘, 󰀁󰀈󰀆󰀈). Vgl. 󰀁󰀆󰀂 (‚Questions on Reality‘, 󰀁󰀈󰀆󰀈): ‚Whether we can think otherwise than in signs? No‘. 󰀂󰀀󰀈 (‚Questions Concerning Certain Faculties Claimed for Man‘, 󰀁󰀈󰀆󰀈): ‚[...] every thought must be interpreted in another, or [...] all thought is in signs‘.

󰀁󰀈󰀀

G ESCHE L INDE

Sinneseindrücke zu Wahrnehmungsurteilen verarbeitet werden.󰀁󰀀󰀄 Anstatt also wie Thomas die modi intelligendi und die modi significandi unterschiedlichen rationes folgen zu lassen, fasst Peirce (logisch kontrolliertes) Denken bzw. Erkennen einerseits und Sprachverstehen sowie Sprechen andererseits unter ein und demselben Paradigma zusammen. Infolgedessen betrachtet Peirce Wörter, gleichgültig ob geschriebene oder gesprochene, und Begriffe󰀁󰀀󰀅 gleichermaßen als Zeichen: Wörter dienen der Bedeutungstransportation und können in Begriffe als deren Interpretanten übersetzt werden, die sodann ihrerseits als Zeichen fungieren, indem sie aufeinander bezogen und so zu Urteilen und Argumenten synthetisiert werden. Diese Entscheidung hat nicht nur zur Konsequenz, dass er sich nicht mit langwierigen Unterscheidungen zwischen terminus scriptus, terminus prolatus und terminus conceptus sowie deren Verhältnis zueinander aufzuhalten braucht󰀁󰀀󰀆 – dementsprechend kommentiert er das entsprechende Kapitel in Ockhams Summa logicae als „unimportant“󰀁󰀀󰀇 –, sondern auch, dass er gelingendes Sprechen nicht in erster Linie von der syntaktischen Wohlgeformtheit bzw. der congruitas des Gesprochenen abhängig machen muss, sondern davon, ob das Gesprochene die Relationen zum Ausdruck bringt bzw. verstehbar erscheinen lässt, die das Verhältnis der Wortzeichen zueinander organisieren. Die Bedeutung von Sätzen ergibt sich demnach weniger aus einem grammatisch korrekten Gebrauch der Wortarten,󰀁󰀀󰀈 sondern vielmehr daraus, wie die Beziehung 󰀁󰀀󰀄. Vgl. CP 󰀅.󰀁󰀈󰀁 (‚Lectures on Pragmatism‘, 󰀁󰀉󰀀󰀃): ‚Nihil est in intellectu quod non prius fuerit in sensu. I take this in a sense somewhat different from that which Aristotle [De anima III, c. 󰀈, 󰀄󰀃󰀂a󰀂-󰀃] intended. By intellectus, I understand the meaning of any representation in any kind of cognition, virtual, symbolic, or whatever it may be. Berkeley and nominalists of his stripe deny that we have any idea at all of a triangle in general, which is neither equilateral, isosceles, nor scalene. But he cannot deny that there are propositions about triangles in general, which propositions are either true or false; and as long as that is the case, whether we have an idea of a triangle in some psychological sense or not, I do not, as a logician, care. We have an intellectus, a meaning, of which the triangle in general is an element. As for the other term, in sensu, that I take in the sense of in a perceptual judgment, the starting point or first premiss of all critical and controlled thinking.‘ 󰀁󰀀󰀅. Vgl. W 󰀁, 󰀃󰀀󰀄 (‚Teleological Logic‘, 󰀁󰀈󰀆󰀅): ‚Concepts are a species of symbols.‘ – Vgl. W 󰀂, 󰀅󰀆f. (‚On a New List of Categories‘, 󰀁󰀈󰀆󰀇): ‚all symbols and not merely concepts‘. 󰀁󰀀󰀆. Vgl. W 󰀂, 󰀅󰀆 (‚On a New List of Categories‘, 󰀁󰀈󰀆󰀇): ‚But the rules of logic hold good of any symbols, of those which are written or spoken as well as of those which are thought‘. 󰀁󰀀󰀇. W 󰀂, 󰀃󰀂󰀇 (‚[Lectures on British Logicians]‘: ‚Ockam: Lecture III‘, 󰀁󰀈󰀆󰀉/󰀇󰀀). 󰀁󰀀󰀈. Vgl. Jan Pinborg, ‚Speculative Grammar‘, in Norman Kretzmann a.o. (Hgg.), The Cambridge History of Later Medieval Philosophy. From the Rediscovery of Aristotle to the Disintegration of Scholasticism 󰀁󰀁󰀀󰀀-󰀁󰀆󰀀󰀀 (Cambridge u.a., 󰀁󰀉󰀈󰀂), 󰀂󰀅󰀄-󰀆󰀉, 󰀂󰀆󰀀: ‚[...] the Modistae succeed in deducing

P EIRCE

ALS

M ODIST ?

󰀁󰀈󰀁

des Zeichens zum Objekt, z.B. des logischen Prädikats zum logischen Subjekt (bzw. im Argument die Beziehung der Konklusion zu den Prämissen), ausfällt bzw. verstanden wird und wie das Zeichen intrinsisch strukturiert ist. Darum interessiert Peirce sich für die von Thomas angeführten grammatischen Konstruktionsprinzipien wie etwa Intransitivität und Transitivität󰀁󰀀󰀉 allenfalls unter strukturellem Gesichtspunkt, nämlich inwiefern es sich beispielsweise um ein- oder zwei- oder dreistellige Prädikate handelt. Im Resultat ist bei Peirce Sprechen nicht wie bei Thomas finalursächlich auf auf ein mentales Kompositum bezogen, das der Intellekt als dessen Wirkursache zum Ausdruck bringen will,󰀁󰀁󰀀 sondern auf Kommunikation: es vermittelt per Zeichen Bedeutungen von einem Sprecher an einen Hörer oder Interpreten und ist insofern primär ein soziales Geschehen. the whole system of possible Latin constructions. It is fundamentally a system based on wordforms and their potential constructions, not an analysis of constituent structures of sentences, and accordingly it is not very efficient in analysing propositional relations‘. 󰀂󰀆󰀀-󰀁, Anm. 󰀂󰀁: ‚According to Boethius of Dacia [...], propositions as such have no modi significandi and accordingly cannot be construed in the strict sense. This conclusion is modified by Radulphus Brito [...] and Siger of Courtrai [...]. But in their view, too, propositions are connected only in virtue of the semantical relations holding between their terms. This view makes problems for the theory of consequences, and especially for the development of a propositional logic‘. 󰀁󰀀󰀉. Zur Transitivität und Intransitivität als Problemen scholastischer Grammatiktheorie siehe Corneille H. Kneepkens, ‚Transitivity, Intransitivity and Related Concepts in 󰀁󰀂th Century Grammar. An explorative study‘, in Geoffrey Leslie Bursill-Hall a.o. (Hgg.), De ortu grammaticae. Studies in medieval grammar and linguistic theory in memory of Jan Pinborg, Amsterdam Studies in the Theory and History of Linguistic Science 󰀄󰀃 (Amsterdam und Philadelphia, 󰀁󰀉󰀉󰀀), 󰀁󰀆󰀁-󰀈󰀉. 󰀁󰀁󰀀. Ausgabe Bursill-Hall XLV.󰀈󰀉, S. 󰀂󰀇󰀆: ‚Sed principium efficiens extrinsecum est intellectus, qui constructibilia per modos significandi disposita et praeparata actu unit in constructione et sermone‘ (‚Aber das äußere Wirkprinzip ist der Intellekt, der das Verknüpfbare in einem durch die Bezeichnungsweisen geordneten und vorbereiteten Akt zu einer Verknüpfung und zum Sprechen vereinigt‘. Übersetzung Grotz XLV.󰀆, S. 󰀈󰀉: ‚Doch das äußerliche wirkursächliche Prinzip [für eine syntaktische Konstruktion] ist der Intellekt. Er vereinigt durch einen [mentalen] Akt die verknüpfbaren Glieder, welche aufgrund ihrer bedeutsamen Verhaltensweisen dafür angelegt und bereit sind, dann zu einer syntaktischen Konstruktion und [weiterhin] zu einem Satzverband‘). Ebd.: ‚Principium finale est expressio mentis conceptus compositi. [...] sed constructio partium orationis fit gratia expressionis mentis conceptus compositi; ergo expressio mentis conceptus compositi est finis constructionis‘ (‚Das Finalprinzip ist der Ausdruck eins zusammengesetzten Begriffs des Geistes. [...] aber die Verknüpfung der Redeteile geschieht um des Ausdrucks eines zusammengesetzten Begriffs des Geistes willen; also ist der Ausdruck des zusammengesetzten Begriffs des Geistes der Zweck der Verknüpfung‘. Übersetzung Grotz XLV.󰀇, S. 󰀈󰀉: ‚Das finalursächliche Prinzip (für eine syntaktische Konstruktion) ist der (sprachliche) Ausdruck eines zusammengesetzten mentalen Konzeptes. [...] Eine syntaktische Vereinigung erfolgt aber, um einem zusammengesetzten mentalen Konzept Ausdruck zu verleihen‘). – Vgl. Ausgabe Bursill-Hall V.󰀁󰀀, S. 󰀁󰀄󰀆: ‚[Modus autem significandi activus [...] materialiter est in constructione ut causa in suo effectu proprio‘ (‚Der aktivische Bezeichnungsmodus verhält sich materialiter so gegenüber der [grammatischen] Konstruktion wie eine Wirkursache zu ihrer eigentlichen Wirkung‘. Übersetzung Grotz, V.󰀆, S. 󰀈: ‚Zu einer syntaktischen Konstruktion verhält es [ein aktivisch bedeutsames Verhalten] sich wie eine Wirkursache zu dem für sie spezifischen Resultat‘).

󰀁󰀈󰀂

G ESCHE L INDE

󰀂.󰀃. Der Zeichenbegriff Aus dem Vorangegangenen ergibt sich bereits die zentrale Funktion des Zeichenbegriffs für die gesamte Peirce’sche Logik und Erkenntnistheorie. Damit teilt Peirce einen Grundkonsens der Scholastik, der ihm schon früh durch Richard Whatelys Elements of Logic vermittelt worden war.󰀁󰀁󰀁 Dieser Hinweis ist deshalb nicht unerheblich, weil Peirce sich damit bewusst in einen logikgeschichtlichen bzw. erkenntnistheoretischen Kontext stellt, der sich in der deutschsprachigen Philosophie zwar noch bei Aufklärern wie Gottfried Wilhelm Leibniz, Christian Wolff, Johann Christoph Gottsched, Alexander Gottlieb Baumgarten, Christian August Crusius und Johann Heinrich Lambert󰀁󰀁󰀂 bemerkbar macht, dann jedoch, mit oder jedenfalls nach Kant, zugunsten einer Konzentration auf den Symbolbegriff abbricht und fortan keine rechte Fortsetzung mehr findet. Möglicherweise ist dies einer von mehreren Gründen dafür, dass Peirce im deutschsprachigen Raum insgesamt nur zögerlich und mühsam rezipiert worden ist. Zugleich allerdings lässt Peirce schon in seinen frühesten Texten das Interesse erkennen, den Zeichenbegriff nicht nur in einen weiteren Kontext als seine scholastischen Vorgänger zu stellen, indem er ihn phänomenologisch bzw. kategorientheoretisch verankert, sondern ihn überdies stärker auszudifferenzieren. Ersteres hat zur Folge (wie unter Nr. 󰀃 noch zu sehen sein wird), dass Peirce drei irreduzible Strukturelemente identifizieren kann, die für eine jede Repräsentationsbeziehung konstitutiv sein sollen: Etwas, ein sogenanntes Zeichen, wird so auf etwas anderes, ein Objekt, bezogen, dass das Resultat, der Interpretant, sich zumindest näherungsweise auf dasselbe Objekt bezieht wie zuvor das Zeichen bzw. dass der Interpretant Objekt, Zeichen und deren Relation zueinander in je unterschiedlichen Explikationsgraden repräsentiert. Ab 󰀁󰀉󰀀󰀄 wird Peirce den Interpretanten in verschiedene Sorten aufspalten und auf diese Weise die Möglichkeit gewinnen, nicht nur Denk-, sondern 󰀁󰀁󰀁. MS 󰀈󰀄󰀃, zitiert nach J. Brent, Charles Sanders Peirce (󰀁󰀉󰀉󰀈), 󰀄󰀈: ‚I remember picking up Whately’s [Elements of] Logic, in my elder brother’s room, and asking him what logic was. I next see myself stretched on his carpet, devouring the book; and this must have been repeated oin following days, since subsequent tests proved that I had then fairly mastered that excellent and charming treatise. From that day to this, logic has been my passion‘. 󰀁󰀁󰀂. Zu diesen Autoren siehe überblicksartig S. Meier-Oeser, Die Spur des Zeichens (󰀁󰀉󰀉󰀇), 󰀄󰀁󰀅-󰀂󰀅.

P EIRCE

ALS

M ODIST ?

󰀁󰀈󰀃

Bewusstseinsvorgänge überhaupt, einschließlich Emotionen, Entscheidungen und Handlungen, als Prozesse der Interpretation von Zeichen zu analysieren und damit letztlich Repräsentation als Strukturprinzip des Geistes bzw. des Bewusstseins oder sogar des Lebens auszuweisen. Sodann veranlasst das Ziel einer stärkeren Ausdifferenzierung des Zeichenbegriffs, das sich schon in den frühesten Texten bemerkbar macht, Peirce noch vor seiner mutmaßlichen Begegnung mit den Modi significandi des Thomas dazu, zwischen ‚copies‘ bzw. ‚likenesses‘ (den späteren ‚icons‘), ‚indices‘ und ‚symbols‘ als drei Zeichensorten zu unterscheiden, die durch eine jeweils unterschiedliche Relation zwischen Zeichen und Objekt bestimmt sind: Copies werden auf ihre Objekte aufgrund einer wahrgenommenen Ähnlichkeit bezogen, indices aufgrund eines (erinnerten) gemeinsamen Auftretens, symbols aufgrund einer interpretativen Regel. Der innovative Impuls, der darin liegt, wird deutlich, wenn man berücksichtigt, dass die zeichentheoretische Tradition, auf die Peirce zurückblickt, üblicherweise zwischen signa und imagines und zwischen signa naturalia und signa data zu unterscheiden pflegte und sich infolgedessen nicht in der Lage sah, sprachliche und nichtsprachliche Repräsentationen auf gemeinsame Strukturmerkmale hin zu untersuchen. Dem entspricht, dass Thomas den Zeichenbegriff bzw. den Begriff des Bezeichnens und des Bezeichnetwerdens unter die Maßgabe des Problems der Sprache setzt, während umgekehrt Peirce Sprache im Paradigma der Zeichentheorie verhandelt. Der vielleicht deutlichste Unterschied jedoch besteht darin, dass dem von Peirce aufgestellten Modell der Repräsentationsbeziehung anders als dem Entwurf des Thomas so etwas wie Prozessualität innewohnt. Das zeigt sich besonders deutlich an argument- und an urteilsförmigen Interpretanten, die sich beide gleichermaßen der Bewegung von einem Antezedens hin zu einem Konsequens verdanken: der Bewegung von Prämissen hin zu einer Konklusion, von einem logischen Subjekt hin zu einem Prädikat. Auf diese Weise bilden Interpretationsvorgänge kontinuierliche und dynamische Prozesse, die ständige Veränderung in Gestalt von Bedeutungsverschiebungen mit sich bringen, wie marginal und unmerklich auch immer, und die nur durch die letzte Zeichenklasse, die deducents, sistiert werden, indem diese eine vollständige Äquivalenz von Prämissen und Konklusion begründen. So nimmt es nicht wunder, dass Peirce zeitweise mit einer Übertragung des Repräsentationsmodells in

󰀁󰀈󰀄

G ESCHE L INDE

evolutionstheoretische Zusammenhänge experimentiert hat. In jedem Fall ist dieser Zug seiner Zeichentheorie ein äußerst moderner, den man bei Thomas vergeblich suchen wird und der sich auch nicht mit dessen Überlegungen zur Finalursächlichkeit des Bezeichens verrechnen lässt. 󰀃. Konsanguinalverwandtschaft: Universalgrammatik als Fundierung von Wissenschaft Das besondere Verdienst, das Peirce Thomas von Erfurt (unter dem Namen ‚Duns Scotus‘) zuschreibt, besteht darin, den frühesten Versuch einer „Philosophy of Grammar“󰀁󰀁󰀃 unternommen zu haben. Ob diese Beurteilung angesichts der Tatsache, dass Thomas auf eine Reihe modistischer Vorgänger wie Boethius de Dacia, Roger Bacon oder Robert Kilwardby zurückblicken kann, gerechtfertigt ist oder nicht, sei hier dahingestellt. Was Peirce jedoch unter einer Philosophie der Grammatik verstanden haben mag, lässt sich an seinem Vortrag On A New List of Categories ablesen, den er vor der American Academy of Arts and Sciences am 󰀁󰀄. Mai 󰀁󰀈󰀆󰀇 und insofern vermutlich nach seiner Begegnung mit den Modi significandi Thomas von Erfurts hielt. Der rückblickenden Auskunft seines Verfassers nach stellt der Text On a New List den ausdrücklichen Versuch dar, eine grammatica speculativa zu entwickeln;󰀁󰀁󰀄 er erhebt also letztlich den Anspruch, dasselbe Grundproblem wie die Modi significandi, nämlich eine Allgemeinstruktur der Sprache – und damit zugleich des Denkens –, zu verhandeln; und tatsächlich hat Peirce ihn stets für einen seiner wichtigsten seiner Publikationen nicht nur dieser frühen Jahre, sondern überhaupt gehalten.󰀁󰀁󰀅 󰀁󰀁󰀃. W 󰀂, 󰀃󰀂󰀁. 󰀁󰀁󰀄. CP 󰀂.󰀃󰀃󰀂 (‚That Categorical and Hypothetical Propositions are one in essence, with some connected matters‘, ca. 󰀁󰀈󰀉󰀅): ‚Let us now consider in what the essential nature of assertion consists. I can here only restate, though in an improved form, a doctrine of grammatica speculativa which I first published in 󰀁󰀈󰀆󰀇. Since that date, as my philosophical studies have progressed, I have been led half a dozen times and more to call the doctrine into serious question and to submit it to a rigid and thorough reëxamination. Each reëxamination, while leading to some modification more or less important, has reinstated the impeached doctrine in my estimation. I believe that I can now make a statement of it which shall leave little to be desired. At the same time, I will take occasion to acknowledge and explain the errors of my previous statements‘. 󰀁󰀁󰀅. CP 󰀈.󰀂󰀁󰀃 (Brief an Mario Calderoni, ca. 󰀁󰀉󰀀󰀅): ‚It was in the desperate endeavor to make a beginning of penetrating into that riddle that on May 󰀁󰀄, 󰀁󰀈󰀆󰀇, after three years of almost insanely concentrated thought, hardly interrupted even by sleep, I produced my one contribution to philosophy in the „New List of Categories“ in the Proceedings of the American Academy of Arts and

P EIRCE

ALS

M ODIST ?

󰀁󰀈󰀅

On a New List leistet zweierlei: die Begründung einer Kategorienliste, die Peirce allerdings kurze Zeit später noch einmal entscheidend modifizieren bzw. zusammenstreichen wird, und, davon abgeleitet, den Entwurf einer Bedeutungs- oder Zeichentheorie, die den Anspruch erhebt, die grundlegenden Begriffe der Logik als „at least one universal science“󰀁󰀁󰀆 aufzustellen: „at least“ deshalb, weil Peirce faktisch der Universalen Logik auch noch die beiden anderen Disziplinen des alten Triviums an die Seite stellt: Grammatik, näherhin verstanden als „Universal Grammar“󰀁󰀁󰀇 oder „General Grammar“,󰀁󰀁󰀈 und Rhetorik, verstanden als „Universal Rhetoric“ oder „General Rhetoric“.󰀁󰀁󰀉 Alle drei Wissenschaften haben es (diese Idee verfolgt Peirce schon seit 󰀁󰀈󰀆󰀅) mit Symbolen zu tun (wenngleich sein Symbolbegriff sich zwischen 󰀁󰀈󰀆󰀅󰀁󰀂󰀀 und 󰀁󰀈󰀆󰀇 wandelt): mit Zeichen nämlich, die sich von copies󰀁󰀂󰀁 oder likenesses󰀁󰀂󰀂 (den späteren icons) und von indices dadurch unterscheiden, dass sie auf ihre Objekte nicht aufgrund einer gemeinsamen Qualität oder eines gemeinsamen Auftretens bezogen werden, sondern, wie Peirce in On a New List sagt, aufgrund eines zugeschriebenen Charakters󰀁󰀂󰀃 oder, wie er später formulieren wird, aufgrund einer Regel. Sciences, Vol. VII, pp. 󰀂󰀈󰀇-󰀂󰀉󰀈. [...] this is, if possible, even less original than my maxim of pragmatism; and [...] I take pride in the entire absence of originality in all that I have ever sought to bring to the attention of logicians and metaphysicians. [...] We may classify objects according to their matter; as wooden things, iron things, silver things, ivory things, etc. But classification according to structure is generally more important. And it is the same with ideas. Much as I would like to see Hegel’s list of categories reformed, I hold that a classification of the elements of thought and consciousness according to their formal structure is more important.‘ ‒ Vgl. auch CP 󰀂.󰀃󰀄󰀀 (‚That Categorical and Hypothetical Propositions are one in essence, with some connected matters‘, ca. 󰀁󰀈󰀉󰀅): ‚In 󰀁󰀈󰀆󰀇 I defined a symbol as any general representamen; and so far I was right. But I immediately proceeded after the traditional manner, to divide symbols into terms, propositions and argumentations, with the meaning that „terms“ have no assertoric element, and there I was wrong, although the division itself is not so much wrong as it is unimportant. Subsequently, noticing that I had classed natural symptoms both among indices and among symbols, I restricted symbols to conventional signs, which was another error. The truth is that my paper of 󰀁󰀈󰀆󰀇 was perhaps the least unsatisfactory, from a logical point of view, that I ever succeeded in producing; and for a long time most of the modifications I attempted of it only led me further wrong‘. 󰀁󰀁󰀆. W 󰀂, S. 󰀅󰀆 (‚On a New List of Categories‘, 󰀁󰀈󰀆󰀇). 󰀁󰀁󰀇. W 󰀁, 󰀁󰀇󰀅 (‚Harvard Lectures‘; ‚Lecture I‘, 󰀁󰀈󰀆󰀅). 󰀁󰀁󰀈. W 󰀁, 󰀃󰀀󰀄 (‚Teleological Logic‘, 󰀁󰀈󰀆󰀅). 󰀁󰀁󰀉. Ebd. 󰀁󰀂󰀀. Ebd. 󰀁󰀂󰀁. Ebd. 󰀃󰀂󰀈 (‚Logic of the Sciences‘, 󰀁󰀈󰀆󰀅). 󰀁󰀂󰀂. W 󰀂, S. 󰀅󰀆 (‚On a New List of Categories‘, 󰀁󰀈󰀆󰀇). 󰀁󰀂󰀃. Ebd.: ‚imputed character‘. Vgl. 󰀅󰀇.

󰀁󰀈󰀆

G ESCHE L INDE

Grammatik untersucht die formalen Bedingungen dafür, dass etwas überhaupt als Symbol fungieren bzw. verstehbar sein kann; Logik untersucht die formalen Bedingungen dafür, dass Symbole auf semiotische Objekte bezogen und damit wahrheitsfähig werden; Rhetorik untersucht die formalen Bedingungen dafür, dass Symbole einen Interpretanten ausbilden und damit Überzeugungskraft entwickeln.󰀁󰀂󰀄 Alle drei 󰀁󰀂󰀄. Vgl. W 󰀂, 󰀅󰀇 (‚On a New List of Categories‘, 󰀁󰀈󰀆󰀇): ‚We come, therefore, to this, that logic treats of the reference of symbols in general to their objects. In this view it is one of a trivium of conceivable sciences. The first would treat of the formal conditions of symbols having meaning, that is of the reference of symbols in general to their grounds or imputed characters, and this might be called formal grammar; the second, logic, would treat of the formal conditions of the truth of symbols; and the third would treat of the formal conditions of the force of symbols, or their power of appealing to a mind, that is, of their reference in general to interpretants, and this might be called formal rhetoric.‘ – CP 󰀂.󰀂󰀂󰀉 (Fragment, ca. 󰀁󰀈󰀉󰀇): ‚In consequence of every representamen being thus connected with three things, the ground, the object, and the interpretant, the science of semiotic has three branches. The first is called by Duns Scotus grammatica speculativa. We may term it pure grammar. It has for its task to ascertain what must be true of the representamen used by every scientific intelligence in order that they may embody any meaning. The second is logic proper. It is the science of what is quasi-necessarily true of the representamina of any scientific intelligence in order that they may hold good of any object, that is, may be true. Or say, logic proper is the formal science of the conditions of the truth of representations. The third, in imitation of Kant’s fashion of preserving old associations of words in finding nomenclature for new conceptions, I call pure rhetoric. Its task is to ascertain the laws by which in every scientific intelligence one sign gives birth to another, and especially one thought brings forth another‘. – CP 󰀄.󰀁󰀁󰀄 (‚Grand Logic‘, 󰀁󰀈󰀉󰀃): ‚The student has not failed to remark how much I have insisted upon balance and symmetry in logic. It is a great point in the art of reasoning; although I do not know that one could say that logic requires it. As long ago as 󰀁󰀈󰀆󰀇 I spoke of a trivium of formal sciences of symbols in general. „The first“, I said, „would treat of the formal conditions of symbols having meaning, and this might be called formal grammar; the second, logic, would treat of the formal conditions of the truth of symbols; and the third would treat of the formal conditions of the force of symbols, or their power of appealing to a mind, and this might be called formal rhetoric“. It would be a mistake, in my opinion, to hold the last to be a matter of psychology‘. – CP 󰀂.󰀉󰀃 (‚Minute Logic‘, 󰀁󰀉󰀀󰀂): ‚Logic is the science of the general necessary laws of Signs and especially of Symbols. As such, it has three departments. Obsistent logic, logic in the narrow sense, or Critical Logic, is the theory of the general conditions of the reference of Symbols and other Signs to their professed Objects, that is, it is the theory of the conditions of truth. Originalian logic, or Speculative Grammar, is the doctrine of the general conditions of symbols and other signs having the significant character. It is this department of general logic with which we are, at this moment, occupying ourselves. Transuasional logic, which I term Speculative Rhetoric, is substantially what goes by the name of methodology, or better, of methodeutic. It is the doctrine of the general conditions of the reference of Symbols and other Signs to the Interpretants which they aim to determine‘. 󰀂.󰀉󰀇: ‚But the discussion of the strength of the argument belongs to Critical Logic, and not to Speculative Grammar‘. Vgl. auch 󰀄.󰀄󰀇󰀅 (‚Minute Logic‘, 󰀁󰀉󰀀󰀂)‘. – CP 󰀁.󰀁󰀉󰀁 (‚A Syllabus of Certain Topics of Logic‘, 󰀁󰀉󰀀󰀃): ‚All thought being performed by means of signs, logic may be regarded as the science of the general laws of signs. It has three branches: 󰀁, Speculative Grammar, or the general theory of the nature and meanings of signs, whether they be icons, indices, or symbols; 󰀂, Critic, which classifies arguments and determines the validity and degree of force of each kind; 󰀃, Methodeutic, which studies the methods that ought to be pursued in the investigation, in the exposition, and in the application of truth. Each division depends on that which precedes it‘. – CP 󰀄.󰀉 (‚Phaneroscopy‘, 󰀁󰀉󰀀󰀆): ‚[...]

P EIRCE

ALS

M ODIST ?

󰀁󰀈󰀇

Generalwissenschaften sollen es nach Peirce jeweils mit Termen, Propositionen und Argumenten zu tun haben, als den drei unterschiedlichen Formen des Symbols. Demzufolge hätte eine Grammatik des Arguments vermutlich zwischen dem zu plausibilisierenden ursprünglichen Urteil, dessen Begründung bzw. den herangezogenen Prämissen und dem abschließenden Urteil zu unterscheiden; eine Grammatik der Proposition bzw. des Urteils würde zwischen dem logischen Subjekt und dem logischen Prädikat differenzieren;󰀁󰀂󰀅 und eine Grammatik des Terms hätte ebenfalls dessen binnenstrukturelle Merkmale zum Gegenstand. Auf diese Weise steht die Grammatik bzw. das Trivium insgesamt, so die Idee 󰀁󰀈󰀆󰀇 und auch schon 󰀁󰀈󰀆󰀅,󰀁󰀂󰀆 am Fußpunkt sämtlicher anderen Wissenschaften. Erst im Kontext seiner reifen Wissenschaftsklassifikation ab 󰀁󰀉󰀀󰀁 wird Peirce dem Trivium noch die Ethik, die Ästhetik, die Phänomenologie und schließlich die Mathematik vorordnen; und seine it seems to me that in the present state of our knowledge of signs, the whole doctrine of the classification of signs and of what is essential to a given kind of sign, must be studied by one group of investigators. Therefore, I extend logic to embrace all the necessary principles of semeiotic, and I recognize a logic of icons, and a logic of indices, as well as a logic of symbols; and in this last I recognize three divisions: Stecheotic (or stoicheiology), which I formerly called Speculative Grammar; Critic, which I formerly called Logic; and Methodeutic, which I formerly called Speculative Rhetoric‘. 󰀁󰀂󰀅. CP 󰀃.󰀄󰀃󰀀 (‚The Regenerated Logic‘, 󰀁󰀈󰀉󰀆): ‚„Exact“ logic, in its widest sense, will (as I apprehend) consist of three parts. For it will be necessary, first of all, to study those properties of beliefs which belong to them as beliefs, irrespective of their stability. This will amount to what Duns Scotus called speculative grammar. For it must analyse an assertion into its essential elements, independently of the structure of the language in which it may happen to be expressed. It will also divide assertions into categories according to their essential differences. The second part will consider to what conditions an assertion must conform in order that it may correspond to the ‚reality,‘ that is, in order that the belief it expresses may be stable. This is what is more particularly understood by the word logic. It must consider, first, necessary, and second, probable reasoning. Thirdly, the general doctrine must embrace the study of those general conditions under which a problem presents itself for solution and those under which one question leads on to another. As this completes a triad of studies, or trivium, we might, not inappropriately, term the last study Speculative rhetoric. This division was proposed in 󰀁󰀈󰀆󰀇 by me, but I have often designated this third part as objective logic‘. Vgl. CP 󰀃.󰀄󰀃󰀁. CP 󰀃.󰀄󰀃󰀂: ‚speculative grammar, or analysis of the nature of assertion‘. CP 󰀃.󰀄󰀃󰀈: ‚[...] the fact of speculative grammar that the predicate of a proposition, being essentially of an ideal nature, can be called into the only kind of existence of which it is capable, at will‘. 󰀁󰀂󰀆. Darstellung der Wissenschaften nach W 󰀁, 󰀃󰀀󰀄 (‚Teleological Logic‘, 󰀁󰀈󰀆󰀅): Science 󰀁. Formal Science 󰀂. Positive Science 󰀃. Semiotic 󰀃.󰀁. Science of Copies 󰀃.󰀂. Science of Signs 󰀃.󰀃. Symbolistic  󰀃.󰀃.󰀁. Grammar 󰀃.󰀃.󰀂. Logic 󰀃.󰀃.󰀃. Rhetoric

󰀁󰀈󰀈

G ESCHE L INDE

Idee des Triviums wird er so verändern, dass dieses sich nicht nur auf Symbole, sondern auf Zeichen schlechthin bezieht.󰀁󰀂󰀇 Um welche Strukturbedingungen des Symbols (bzw. des Zeichens) handelt es sich, die eine Universalgrammatik nach Peirce zu untersuchen hat? Durch Selbstanwendung der Kategorien unterteilt On a New List Repräsentationen (welche die dritte der drei ‚akzidentellen‘ Kategorien ausmachen) danach, ob die Beziehung des Zeichens zu seinem Objekt auf einer Qualität (erste der drei ‚akzidentellen‘ Kategorien) beruhen soll (so im Fall der likenesses: ‚das hier ist das Bild einer Katze‘; ‚der Buchstabe „b“ sieht dem Buchstaben „p“ ähnlich‘) oder auf der Relation zu einem Korrelat (zweite ‚akzidentelle‘ Kategorie – so im Fall der indices: ‚das Miauen vor dem Fenster ist das Miauen der Nachbarskatze‘) oder auf der Relation zu einem Interpretanten (dritte ‚akzidentelle‘ Kategorie – so im Fall der symbols: ‚„Katze“ heißt auf Englisch „cat“‘). Die erste Unterklasse der symbols schließlich, so Peirce weiter, bilden Terme, die für sich alleine stehen, darum nichts aussagen bzw. nicht wahrheitsfähig sind und, indem sie ein Konglomerat von Merkmalen in sich versammeln, eigenmächtig den ‚ground‘ determinieren, wie Peirce sagt, durch den sie das bezeichnen, was sie bezeichnen. Die zweite Unterklasse der symbols sind Propositionen, die ihre ‚Objekte‘ (oder ‚Korrelate‘) determinieren, indem sie diese durch Kombinationen (Relationen) zweier oder 󰀁󰀂󰀇. CP 󰀈.󰀃󰀄󰀂-󰀃 (Brief an Victoria Lady Welby, 󰀁󰀉󰀀󰀈): ‚In my paper of 󰀁󰀈󰀆󰀇 May 󰀁󰀄 (Proc. Am. Acad. of Arts & Sci., Vol. VII, p. 󰀂󰀉󰀅) I said, „We come to this, that logic treats of the reference of symbols in general to their objects. In this view it is one of a trivium of conceivable sciences. The first would treat of the formal conditions of symbols having meaning, that is of the reference of symbols in general to their grounds, or imputed characters; and this might be called Formal Grammar [the grammatica speculativa of Duns]. The second, logic, would treat of the formal conditions of the truth of symbols. The third would treat of the formal conditions of the force of symbols, or their power of appealing to a mind, that is, of their reference in general to interpretants, and this might be called formal rhetoric“. [...] But [...] for the present the cenoscopic studies (i.e., those studies which do not depend upon new special observations) of all signs remain one undivided science [...]. It seems to me that one of the first useful steps toward a science of semeiotic [...], or the cenoscopic science of signs, must be the accurate definition, or logical analysis, of the concepts of the science. I define a Sign as anything which on the one hand is so determined by an Object and on the other hand so determines an idea in a person’s mind, that this latter determination, which I term the Interpretant of the sign, is thereby mediately determined by that Object. A sign, therefore, has a triadic relation to its Object and to its Interpretant. But it is necessary to distinguish the Immediate Object, or the Object as the Sign represents it, from the Dynamical Object, or really efficient but not immediately present Object. It is likewise requisite to distinguish the Immediate Interpretant, i.e. the Interpretant represented or signified in the Sign, from the Dynamic Interpretant, or effect actually produced on the mind by the Sign; and both of these from the Normal Interpretant, or effect that would be produced on the mind by the Sign after sufficient development of thought. On these considerations I base a recognition of ten respects in which Signs may be divided‘.

P EIRCE

ALS

M ODIST ?

󰀁󰀈󰀉

mehrerer Terme bezeichnen, die als logisches Subjekt und logisches Prädikat fungieren. Argumente schließlich, welche die dritte Unterklasse bilden, determinieren ihre Interpretanten, indem sie Prämissen als Begründungen für Konklusionen einführen.󰀁󰀂󰀈 Die drei Kategorien ‚Qualität‘, ‚Relation‘ und ‚Repräsentation‘ haben vermittelnden Charakter;󰀁󰀂󰀉 sie sind zwischen der am wenigsten allgemeinen Kategorie der ‚Substanz‘ angesiedelt, die für das Gegenwärtige bzw. für die erwähnten Sinneseindrücke in ihrer Mannigfaltigkeit steht, und der allgemeinsten und damit inhaltsleersten Kategorie ‚Sein‘. Später wird Peirce die Kategorien ‚Substanz‘ und ‚Sein‘ ersatzlos streichen󰀁󰀃󰀀 bzw. ‚Substanz‘, sofern Substanz das Gegenwärtige sein soll, durch ‚Phänomen‘ ersetzen, ‚Sein‘ bzw. ‚Existenz‘ für Propositionen reservieren sowie ‚Qualität‘, ‚Relation‘ und ‚Repräsentation‘ als die drei an einem jedem Phänomen zu beobachtenden Strukturmerkmale ausweisen. Das systematische Interesse, das Thomas von Erfurt und Peirce, wie letzterem offenbar nicht entgangen ist, teilen, besteht darin, erstens die Funktionen sprachlicher (bzw. bei Peirce zugleich gedanklicher󰀁󰀃󰀁) Einheiten zu untersuchen, und zwar als allgemeine Funktionen des Bezeichnens, wie sie allen natürlichen Sprachen zugrunde liegen, und zweitens diese Untersuchung im weiteren Horizont metaphysischer Fragestellungen zu betreiben, die sich bei Thomas im Begriff der modi essendi und bei Peirce unter dem Problem der Kategorien󰀁󰀃󰀂 versammeln. Die Differenz zwischen 󰀁󰀂󰀈. W 󰀂, 󰀅󰀇 (‚On a New List of Categories‘, 󰀁󰀈󰀆󰀇): ‚There would be a general division of symbols, common to all these sciences; namely, into, 󰀁°: Symbols which directly determine only their grounds or imputed qualities, and are thus but sums of marks or terms; 󰀂°: Symbols which also independently determine their objects by means of other term or terms, and thus, expressing their own objective validity, become capable of truth or falsehood, that is, are propositions; and, 󰀃°: Symbols which also independently determine their interpretants, and thus the minds to which they appeal, by premissing a proposition or propositions which such a mind is to admit. These are arguments‘. 󰀁󰀂󰀉. W 󰀂, 󰀅󰀅 (‚On a New List of Categories‘, 󰀁󰀈󰀆󰀇): ‚The three intermediate conceptions may be termed accidents‘. 󰀁󰀃󰀀. Vgl. Max H. Fisch, ‚Introduction‘, in: W 󰀁, xv-xxxv, xxvi: ‚Peirce soon reduced the five to three by sloughing off Being and Substance‘. Zur Begründung dieser Reduktion siehe Thomas Hünefeldt, Peirces Dekonstruktion der Transzendentalphilosophie in eine phänomenologische Semiotik, Epistemata 󰀃󰀁󰀃 (Würzburg, 󰀂󰀀󰀀󰀂), 󰀈󰀆. 󰀁󰀃󰀁. Vgl. CP 󰀄.󰀁󰀂󰀇 (‚Logic of Quantity‘, 󰀁󰀈󰀉󰀃): ‚grammar of thought – formal grammar‘. 󰀁󰀃󰀂. Vgl. W 󰀂, 󰀃󰀀󰀂 (‚Harvard Lectures‘: ‚Lecture XI‘, 󰀁󰀈󰀆󰀅): ‚But to the pupil of Kant as to the pupil of Aristotle the Analytic of Logic is the foundation of Metaphysics. We find ourselves in all our discourse taking certain points for granted which we cannot have observed. The question therefore is what may we take for granted independent of all experience. The answer to this is metaphysics‘.

󰀁󰀉󰀀

G ESCHE L INDE

beiden besteht darin, dass Thomas seine Analyse der allgemeinen Funktionen des Bezeichnens zunächst auf semantischer Grundlage durchführt, indem er zwischen insgesamt acht Wortklassen mit jeweils unterschiedlichen Bezugsgrößen unterscheidet, und sich sodann der Syntagmatik zuwendet, indem er die Frage stellt, wie Wortklassen verknüpft werden können. Peirce hingegen unterscheidet Bezeichnungsfunktionen nicht nach Arten des Objekts und insofern nicht semantisch oder gar ontologisch, sondern nach Arten der Relation zwischen Zeichen und Objekt bzw. zwischen Zeichen, Objekt und Interpretanten und damit semiotisch. Das Bewusstsein dieser Differenz mag dafür verantwortlich sein, dass Peirce sich des Namens ‚Grammatica speculativa‘, der bereits im 󰀁󰀃. Jahrhundert von Robert Kilwardby, Boethius Dacia und Rudolphus Brito aufgebracht wird󰀁󰀃󰀃 und bei ihm selbst überhaupt erstmals ca. 󰀁󰀈󰀉󰀅 fällt,󰀁󰀃󰀄 teilweise mit einer gewissen Unschärfe bemächtigt. On a New List tritt nach eigener Aussage als Logik,󰀁󰀃󰀅 nicht als Grammatik auf; doch mag man sich an Peirces spätere Bemerkung erinnern, dass er Logik nicht als eine im spezifischen Sinne auf Wahrheitsbedingungen bezogene Disziplin verstanden wissen möchte, sondern als eine allgemeine Wissenschaft von den Zeichen auffasst;󰀁󰀃󰀆 und natürlich gilt, dass die historische 󰀁󰀃󰀃. Vgl. Heinrich Roos, ‚Art. Grammatik: I.‘, in Historisches Wörterbuch der Philosophie, hg. v. Joachim Ritter, Bd. 󰀃 (Basel und Stuttgart, 󰀁󰀉󰀇󰀄), 󰀈󰀄󰀆-󰀉, 󰀈󰀄󰀇. 󰀁󰀃󰀄. Nämlich in CP 󰀂.󰀃󰀃󰀂 (‚That Categorical and Hypothetical Propositions are one in essence, with some connected matters‘, ca. 󰀁󰀈󰀉󰀅), siehe oben Anm. 󰀁󰀁󰀄. 󰀁󰀃󰀅. W 󰀂, 󰀅󰀆 (‚On a New List of Categories‘, 󰀁󰀈󰀆󰀇): ‚I shall now show how the three conceptions of reference to a ground, reference to an object, and reference to an interpretant are the fundamental ones of at least one universal science, that of logic‘. Vgl. 󰀅󰀉. – Zur Logik als Fundierung der ‚modern science‘ siehe W 󰀁, 󰀁󰀆󰀂 (‚Harvard Lectures‘: ‚Lecture I‘, 󰀁󰀈󰀆󰀅). W 󰀁, 󰀁󰀆󰀂 (‚Harvard Lectures‘: ‚Lecture I‘, 󰀁󰀈󰀆󰀅): ‚[...] there are not now many thoughtful men of science who will think that the investigation of the logical character of scientific reasoning is a needless or unimportant inquiry‘. – Vgl. auch ‚Logic of Science‘, W 󰀁, 󰀁󰀆󰀃 (‚Harvard Lectures‘: ‚Lecture I‘, 󰀁󰀈󰀆󰀅); vgl. W 󰀁, 󰀁󰀇󰀅 (‚Harvard Lectures‘: ‚Lecture II‘). 󰀁󰀃󰀆. CP 󰀁.󰀄󰀄󰀄 (‚The Logic of Mathematics; An Attempt to Develop My Categories From Within‘, ca. 󰀁󰀈󰀉󰀆): ‚But besides being logical in the sense of demanding a logical analysis, our inquiry also relates to two as a conception of logic. The term „logic“ is unscientifically by me employed in two distinct senses. In its narrower sense, it is the science of the necessary conditions of the attainment of truth. In its broader sense, it is the science of the necessary laws of thought, or, still better (thought always taking place by means of signs), it is general semeiotic, treating not merely of truth, but also of the general conditions of signs being signs (which Duns Scotus called grammatica speculativa), also of the laws of the evolution of thought, which since it coincides with the study of the necessary conditions of the transmission of meaning by signs from mind to mind, and from one state of mind to another, ought, for the sake of taking advantage of an old association of terms, be called rhetorica speculativa, but which I content myself with inaccurately calling objective logic, because that conveys the correct idea that it is like Hegel’s logic‘.

P EIRCE

ALS

M ODIST ?

󰀁󰀉󰀁

Spekulative Grammatik im Sinne der Modisten logisch informiert war. An anderer Stelle begründet Peirce die Inanspruchnahme des Namens damit, dass Spekulative Grammatik eine Propädeutik der Logik im eigentlichen Sinne biete und insofern die Funktion einer Kategorienlehre erfülle: also das leiste, was On a New List versucht.󰀁󰀃󰀇 In jedem Falle aber bleibt festzuhalten, dass Peirce sein Programm einer Fundierung der Wissenschaften durch eine logisch disziplinierte Grundlagenwissenschaft oder deren mehrere wohl kaum zuerst von Thomas bezieht, sondern dass er sich nach eigener Aussage schon in seinen Harvard Lectures von 󰀁󰀈󰀆󰀅 ganz allgemein am „ancient Trivium“󰀁󰀃󰀈 der Scholastiker orientiert. Auf der Suche nach Autoren, die ähnliche Probleme wie er selbst bearbeiteten, hat Peirce wie so häufig auch hier recht freien Gebrauch von einer Idee gemacht, die ihm nur allzu gut in das eigene Konzept passte. 󰀁󰀃󰀇. CP 󰀂.󰀈󰀃-󰀄 (‚Minute Logic‘, 󰀁󰀉󰀀󰀂): ‚[...] it become needful to take up that propedeutic to logic proper, that unpsychological Erkenntnisslehre at which I have hinted. I name it Speculative Grammar, after the title of a work by Duns Scotus having the same aim. In announcing what I am going to say in this part of the book, I have to choose between utter unintelligibility and a lengthy anticipation of what is about to be proved, but can here only be asserted. I unhesitatingly take the latter course, since the ideas are put into such strange forms that a double exposition will aid the reader. I begin by endeavoring to strike the dominant note of the book with such force and clearness as I can command; for it is not only the key-note, but the key, to all logic. I essay an analysis of what appears in the world. It is not metaphysics that we are dealing with: only logic. Therefore, we do not ask what really is, but only what appears to everyone of us in every minute of our lives. I analyze experience, which is the cognitive resultant of our past lives, and find in it three elements. I call them Categories‘. – CP 󰀂.󰀂󰀀󰀆 (‚Baldwin’s Dictionary of Philosophy and Psychology‘, Bd. 󰀂: Art. ‚Logic‘, 󰀁󰀉󰀀󰀂/󰀁󰀁): ‚It is generally admitted that there is a doctrine which properly antecedes what we have called critic. It considers, for example, in what sense and how there can be any true proposition and false proposition, and what are the general conditions to which thought or signs of any kind must conform in order to assert anything. Kant, who first raised these questions to prominence, called this doctrine transcendentale Elementarlehre, and made it a large part of his Critic of the Pure Reason. But the Grammatica Speculativa of Scotus is an earlier and interesting attempt. The common German word is Erkenntnisstheorie, sometimes translated Epistemology‘. Vgl. 󰀂.󰀂󰀀󰀇: ‚It is further generally recognized that another doctrine follows after critic, and which belongs to, or is closely connected with, logic. Precisely what this should contain is not agreed; but it must contain the general conditions requisite for the attainment of truth. Since it may be held to contain more, one hesitates to call it heuristic. It is often called Method; but as this word is also used in the concrete, methodic or methodeutic would be better‘. – CP 󰀃.󰀄󰀃󰀂 (‚Regenerated Logic‘, 󰀁󰀈󰀉󰀆): ‚By the theory of cognition is usually meant an explanation of the possibility of knowledge drawn from principles of psychology. Now, the only sound psychology being a special science, which ought itself to be based upon a wellgrounded logic, it is indeed a vicious circle to make logic rest upon a theory of cognition so understood. But there is a much more general doctrine to which the name theory of cognition might be applied. Namely, it is that speculative grammar, or analysis of the nature of assertion, which rests upon observations, indeed, but upon observations of the rudest kind, open to the eye of every attentive person who is familiar with the use of language, and which, we may be sure, no rational being, able to converse at all with his fellows, and so to express a doubt of anything, will ever have any doubt‘. 󰀁󰀃󰀈. W 󰀁, 󰀁󰀆󰀂 (‚Harvard Lectures‘: ‚Lecture I‘, 󰀁󰀈󰀆󰀅).

󰀁󰀉󰀂

G ESCHE L INDE

󰀄. Ausblick: Das Problem der Wortklassen Im eingangs erwähnten MS 󰀅󰀈󰀅 artikuliert Peirce Ockham gegenüber󰀁󰀃󰀉 einen Verdacht, den er ebensogut Thomas gegenüber hätte geltend machen können und den er später insgesamt sowohl der scholastischen als auch der modernen Logik gegenüber󰀁󰀄󰀀 geltend machen wird. Es ist derselbe Verdacht, den Forscher wie Jan Pinborg󰀁󰀄󰀁 oder Stephan Grotz󰀁󰀄󰀂 mit Blick auf Thomas geäußert haben: der Verdacht, dass die 󰀁󰀃󰀉. W 󰀂, 󰀃󰀂󰀀-󰀁 (‚[Lectures on British Logicians]‘: ‚Ockam. Lecture 󰀃‘, 󰀁󰀈󰀆󰀉/󰀇󰀀): ‚It may be that the mental grammatical accidents are precisely those which belong to the Latin language or it may be that they are more various than and altogether different from those of any known language. And therefore it may be that the list of mental grammatical accidents which Ockham by his method obtains bears but a slight resemblance to the true list‘. 󰀁󰀄󰀀. Vgl. CP 󰀂.󰀂󰀁󰀁 (‚Baldwin’s Dictionary of Philosophy and Psychology‘, Bd. 󰀂: Art. ‚Logic‘, 󰀁󰀉󰀀󰀁-󰀀󰀂/󰀁󰀁): ‚Appeals to the usages of language are extremely common. They are made even by those who use algebraical notation in logic „in order to free the mind from the trammels of speech“ (Schröder, Logik, i. p. iii). It is difficult to see what can be hoped for from such a proceeding, unless it be to establish a psychological proposition valid for all minds. But to do this, it would be necessary to look beyond the small and very peculiar class of Aryan languages, to which the linguistic knowledge of most of those writers is confined. The Semitic languages, with which some of them are acquainted, are too similar to the Aryan greatly to enlarge their horizon. Moreover, even if other languages are examined, the value of any logical inferences from them is much diminished by the custom of our grammarians of violently fitting them to the Procrustean bed of Aryan grammar‘. – CP 󰀂.󰀆󰀉 (‚Minute Logic‘, 󰀁󰀉󰀀󰀂): ‚[...] it must not be forgotten that it is the usual practice of these Europeans who write grammars of non-Aryan languages, violently to adapt them to the Procrustean bed of Latin grammar. Even if one fully knows how false a representation this gives, it is hard, in writing a grammar, to resist the temptation to make use of brief familiar phrases which are, after all, as nearly right as any idea one can convey without much trouble and labor both to the reader and to oneself. For that reason, it will not suffice to get one’s idea of an uninflected language from any mere grammar. It is necessary to have some real, living acquaintance with it, in order to appreciate its modes of thought, especially since these will be most difficult for us to grasp‘. – CP 󰀂.󰀃󰀅󰀈 (‚Baldwin’s Dictionary of Philosophy and Psychology‘, Bd. 󰀂: Art. ‚Predicate‘, 󰀁󰀉󰀀󰀂/󰀁󰀁): ‚The view which pragmatic logic takes of the predicate, in consequence of its assuming that the entire purpose of deductive logic is to ascertain the necessary conditions of the truth of signs, without any regard to the accidents of Indo-European grammar, will be here briefly stated‘. 󰀁󰀄󰀁. Jan Pinborg, Die Entwicklung der Sprachtheorie im Mittelalter, Beiträge zur Geschichte der Philosophie und Theologie des Mittelalters. Texte und Untersuchungen XLII/󰀂, 󰀂. Aufl. (Münster, 󰀁󰀉󰀈󰀅), 󰀅󰀉: ‚Die Modisten geben sich nicht Rechenschaft darüber, ob sie sich mit einer Einzelsprache oder mit einer Universalsprache beschäftigen. [...] sie [bleiben] der lateinischen Sprache verhaftet. Sie geben sich auch nicht Rechenschaft darüber, ob die Sprache, die sie beschreiben, eine gesprochene Sprache oder eine mentale Sprache ist; diese Frage würde ihnen sicher auch ziemlich unwichtig erschienen sein, weil die beiden Stufen für sie wesentlich übereinstimmen. Dennoch hat diese Unklarheit Diskussionen innerhalb der Gattung hervorgerufen und schliesslich zum Sturz der modi significandi beigetragen. Dennoch bleibt die modistische Grammatik der einzig ernstzunehmende Versuch des Mittelalters, eine Linguistik zu begründen‘. 󰀁󰀄󰀂. S. Grotz, ‚Einleitung‘ (󰀁󰀉󰀈󰀈), xiv, Anm. 󰀂󰀃: ‚Begünstigt wird dieser Anspruch auf Universalität sicher auch durch die merkwürdige Tatsache, daß die lateinische Sprache für die modistischen Autoren, die allesamt in der Fremdsprache „Latein“ schreiben, nie eigens in ihrem

P EIRCE

ALS

M ODIST ?

󰀁󰀉󰀃

Spekulative Grammatik ihren programmatischen Anspruch, eine Universalgrammatik zu bieten, nicht einlöse, weil sie sich allzusehr an einer bestimmten Sprache, dem Lateinischen bzw. Griechischen, orientiere. Peirce, der die natürlichen Sprachen nur für Ausdrucksgestalten des Denkens hält, für dessen ‚Vehikel‘, wie er sagt, oder für die ‚Häute der Zwiebel‘,󰀁󰀄󰀃 zieht als der Empiriker, als der er sich stets auch versteht, im Laufe der Zeit eine Vielzahl ihm möglichst abgelegener Sprachen heran, um deren Grammatiken zu vergleichen. So dient ihm das Gälische bzw. Irische als Beleg dafür, dass das logische Subjekt einer Aussage grammatikalisch anstatt den Nominativ auch einen anderen Kasus annehmen könne (z.B. den subjektiven Genetiv der Handlung󰀁󰀄󰀄 oder den Dativus sprachpraktisch universellen Status zur Debatte steht und daß das modistische Sprachdenken so dazu tendiert, die lateinische Sprache unausgesprochen mit „Sprache überhaupt“ gleichzusetzen‘. 󰀁󰀄󰀃. CP 󰀄.󰀆 (‚Phaneroscopy‘, 󰀁󰀉󰀀󰀆): ‚Not that the particular signs employed are themselves the thought! Oh, no; no whit more than the skins of an onion are the onion. (About as much so, however.) One selfsame thought may be carried upon the vehicle of English, German, Greek, or Gaelic; in diagrams, or in equations, or in graphs: all these are but so many skins of the onion, its inessential accidents. Yet that the thought should have some possible expression for some possible interpreter, is the very being of its being‘. 󰀁󰀄󰀄. CP 󰀂.󰀆󰀇 (‚Minute Logic‘, 󰀁󰀉󰀀󰀂): ‚One needs but to turn over the leaves of a few of the first logical treatises that come to hand, especially if they are English, nor will he have to search long, in order to meet with appeals to the ordinary usages of speech as determinative of logical doctrines. Some recent books are quite crowded with this type of argument. It seems usually to be employed unreflectively; but there are works in which it is deliberately laid down as the principal basis of logical science‘. CP 󰀂.󰀆󰀈: ‚The greater number of those who regard this method as very efficient would seem to have in mind an extremely small group of closely similar and highly peculiar languages – say Latin and a few literary languages of modern Europe. For some of the necessities of thought which they profess to deduce in this way are violated by the Greek, the language nearest, in every sense, to these I have mentioned. Even if they took into account the entire group of Aryan and Shemitic languages – although within that group they would find modes of thought that would somewhat embarrass them, such as the usage of the Gaelic and Old Irish of putting the subject of a sentence in the genitive – yet this would be like judging of botanical possibilities by phanerogamous plants, so small and so peculiar is that group as compared with the great world of languages, the negative resemblance between which may be very roughly described by saying that they make no use of abstract ideas, but which differ as much from one another in their ways of thinking as they do from the inflected languages‘. – CP 󰀂.󰀃󰀃󰀈 (‚That Categorical and Hypothetical Propositions are one in essence‘, ca. 󰀁󰀈󰀉󰀅): ‚I term those occasions or objects which are denoted by the indices the subjects of the assertion. But these will not coincide with the objects denoted by the grammatical subjects. It has always been the habit of logicians to consider propositions only (or chiefly) after they have been expressed in certain standard, or canonical, forms. To treat them just as they are expressed in this or that language (as Hoppe and some others do) makes of logic a philological, not a philosophical, study. But the canonical forms chosen have been suggested by the usage of a narrow class of languages, and are calculated to lead philosophy astray. That which is called the subject is the noun which is in the nominative, although, even in our relatively small family of Indo-European languages, there are several in which that noun which in Latin, Greek, and the modern European languages is put in the nominative, is put in an oblique case. Witness the Irish and Gaelic‘. – CP 󰀈.󰀂󰀄󰀂 (Brief an John Dewey, 󰀁󰀉󰀀󰀄): ‚There are several sciences to which logicians often make appeal by arguments

󰀁󰀉󰀄

G ESCHE L INDE

auctoris); das Baskische󰀁󰀄󰀅 und das Altägyptische󰀁󰀄󰀆 illustrieren ihm, dass natürliche Sprachen auch ohne Kopula auskommen können; und der which would be circular if they rose to the degree of correctness necessary to that kind of fallacy. They are Metaphysical Philosophy, Psychology, Linguistics (of which they barely know that of the Aryan Languages, – and not Gaelic which does not ordinarily give a sentence a subject nominative), History, etc.‘ – CP 󰀄.󰀄󰀃󰀈, P󰀁 (‚Logical Tracts, No. 󰀂‘, ca. 󰀁󰀉󰀀󰀃): ‚Now unless we were prepared to say that for different languages there are different doctrines of logic (which would be contrary to the essence of logic, as all will admit) we cannot, in this definition, take the preposition de in so narrow a sense as to exclude the grammatical accusative, dative, genitive and ablative of the verb. For dispersed through all the families of speech there are a dozen languages which either habitually or frequently express a proposition completely without putting any noun in the nominative. Among the European languages, Gaelic is an example, in which the principal subject is most commonly put in the genitive. But the logical fact is simply that it frequently makes a difference in the sense of a proposition which of the different nouns, naming objects to which the verb refers, is considered to be immediately attached to the verb, which to the combination of these two, and so on. Thus, in the sentence, „Some angel gives every man some gift“, the verb „gives“ is directly applied to „some gift“, making „gives-a-gift“; then this action of gift-giving is applied to „every man“; finally the compound „gives-gift to every man“ is applied to a certain angel; while in the sentence „A certain gift (perhaps, speech) is given to every man by some angel or other“ the verb „is given by“ is applied directly to „some angel“, making „is angelgiven to“, which is applied to „every man“, and then „is angel-given to every man“ is applied to a certain gift. One sentence represents one angel as distributing gifts to all men, the other represents one gift as bestowed by one or another angel on each man. Thus, the subject-nominative is ordinarily of all the subjects the one of which the verb is least directly said‘. 󰀁󰀄󰀅. CP 󰀂.󰀃󰀂󰀈 (‚Syllabus‘, ca. 󰀁󰀉󰀀󰀂): ‚Their [the logicians‘] usual doctrine is (though often not directly stated in one sentence), that such a proposition has three terms, the subject, predicate, and copula (Abelard). The correct designation of the subject and predicate, in accord with their doctrine, is the extremes, which is translated from the same Greek word as term [...]. The ordinary doctrine makes the copula the only verb, and all other terms to be either proper names or general class-names. The present author leaves the is as an inseparable part of the class-name; because this gives the simplest and most satisfactory account of the proposition. It happens to be true that in the overwhelming majority of languages there are no general class names and adjectives that are not conceived as parts of some verb (even when there really is no such verb) and consequently nothing like a copula is required in forming sentences in such languages. The author (though with no pretension to being a linguist), has fumbled the grammars of many languages in the search for a language constructed at all in the way in which the logicians go out of their way to teach that all men think (for even if they do so, that has really nothing to do with logic). The only such tongue that he has succeeded in finding is the Basque, which seems to have but two or three verbs, all the other principal words being conceived as nouns‘. – Vgl. CP 󰀂.󰀄󰀃󰀉 (‚Short Logic‘, ca. 󰀁󰀈󰀉󰀆): ‚In order properly to exhibit the relation between premisses and conclusion of mathematical reasonings, it is necessary to recognize that in most cases the subject-index is compound, and consists of a set of indices. Thus, in the proposition, „A sells B to C for the price D“, A, B, C, D form a set of four indices. The symbol „sells—to—for the price—“ refers to a mental icon, or idea of the act of sale, and declares that this image represents the set A, B, C, D, considered as attached to that icon, A as seller, C as buyer, B as object sold, and D as price. If we call A, B, C, D four subjects of the proposition and „—sells—to—for the price“ a predicate, we represent the logical relation well enough, but we abandon the Aryan syntax‘. 󰀁󰀄󰀆. CP 󰀄.󰀄󰀈 (‚Grand Logic‘, 󰀁󰀈󰀉󰀃): ‚The next question, in order, which we put to the traditional logic, is, how do you know that all that is true? to divide the question, tell us, first, how you know that that analysis of the nature of assertion is correct. To this, the traditional logic has not one traditional word to say. It is perfectly plain, however, that the reason it thinks so, is that that seems a satisfactory analysis of a sentence. So it is of the majority of sentences in the Greek, Latin, English, German, French, Italian, Spanish, languages – in short, in the Indo-European languages;

P EIRCE

ALS

M ODIST ?

󰀁󰀉󰀅

semitischen Sprachfamilie entnimmt er, dass das Substantiv keinen logischen essentiellen Bestandteil natürlicher Sprachen bilde.󰀁󰀄󰀇 Ein analoger Einwand lässt sich für Urteile formulieren: Die beiden syntaktisch verschieden organisierten Sätze ‚die Katze wird vom Hund gebissen‘ and European grammarians, true children of Procrustes, manage to exhibit sentences in other languages forced into the same formula. But outside of that family of languages which bears somewhat the same relation to language in general as the phanerogams do to all plants, or the vertebrates to all animals – while there are of course proper names – it seems to me that general terms, in the logical sense, do not exist. That the analysis of the proposition into subject and predicate represents tolerably the way we, Arians, think, I grant; but I deny that it is the only way to think. It is not even the clearest way nor the most effective way‘. CP 󰀄.󰀄󰀉: ‚There appear to be very many languages in which the copula is quite needless. In the Old Egyptian language, which seems to come within earshot of the origin of speech, the most explicit expression of the copula is by means of a word, really the relative pronoun, which. Now to one who regards a sentence from the Indo-European point of view, it is a puzzle how ‚which‘ can possibly serve the purpose in place of „is“. Yet nothing is more natural. The fact that hieroglyphics came so easy to the Egyptians shows how their thought is pictorial. . . . [e.g.] „Aahmes what we write of is a soldier which what we write of is overthrown“, means „Aahmes the soldier is overthrown“. Are you on the whole quite sure that this is not the most effective way of analyzing the meaning of a proposition?‘ 󰀁󰀄󰀇. CP 󰀂.󰀃󰀄󰀁 (‚That Categorical and Hypothetical Propositions are One in Essence‘, ca. 󰀁󰀈󰀉󰀅): ‚[...] common nouns, which, with their equivalents, are what is meant by terms, are mere accidental grammatical forms which happen to be very prominent in the languages most familiar to us, but which hardly exist, or at least are far from prominent, in the vast majority of tongues, and are really not needed, at all, and ought to be unknown to the Grammatica Speculativa. It is absurd, indeed, to erect this unnecessary part of speech into a logical form and leave the indispensable prepositions unrepresented, merely because in Indo-European languages they often appear in the form of terminations‘. – CP 󰀈.󰀃󰀃󰀇 (Brief an Victoria Lady Welby, 󰀁󰀂.󰀁󰀀.󰀁󰀉󰀀󰀄): ‚In regard to its relation to its signified interpretant, a sign is either a Rheme, a Dicent, or an Argument. This corresponds to the old division, Term, Proposition, and Argument, modified so as to be applicable to signs generally. A Term is simply a class-name or proper-name. I do not regard the common noun as an essentially necessary part of speech. Indeed, it is only fully developed as a separate part of speech in the Aryan languages and the Basque, – possibly in some other out of the way tongues. In the Shemitic languages it is generally in form a verbal affair, and usually is so in substance, too. As well as I can make out, such it is in most languages. In my universal algebra of logic there is no common noun‘. – Vgl. CP 󰀄.󰀅󰀆 (‚Grand Logic‘, 󰀁󰀈󰀉󰀃): ‚There are more than a dozen different families of languages, differing radically in their manner of thinking; and I believe it is fair to say that among these the Indo-European is only one in which words which are distinctively common nouns are numerous. And since a noun or combination of nouns by itself says nothing, I do not know why the logician should be required to take account of it at all. Even in Indo-European speech the linguists tell us that the roots are all verbs. It seems that, speaking broadly, ordinary words in the bulk of languages are assertory. They assert as soon as they are in any way attached to any object. If you write GLASS upon a case, you will be understood to mean that the case contains glass‘. – Auch CP 󰀇.󰀃󰀈󰀅, Anm. 󰀂󰀂 d. Hgg. (‚Minute Logic‘, 󰀁󰀉󰀀󰀂): ‚The Indo-European languages are singular in having the common noun distinctly and fully developed as a separate part of speech, and by more or less development even of abstract nouns. I do not mean to say that the common noun is not fully developed in any other language; but only that such a phenomenon is exceptional in every other great family of speech. This requires and evidences considerable power of thought on the part of those who use these languages‘. – CP 󰀃.󰀄󰀄󰀀 (‚The Regenerated Logic‘, 󰀁󰀈󰀉󰀆): ‚The common noun happens to have a very distinctive character in the Indo-European languages. In most other tongues it is not sharply discriminated from a verb or participle‘.

󰀁󰀉󰀆

G ESCHE L INDE

und ‚der Hund beißt die Katze‘ unterscheiden sich semiotisch nur dann, wenn die Interpretierenden sie einmal als Aussage über den Hund, ein anderes Mal als Aussage über die Katze und ein drittes Mal als Aussage über das Verhältnis zwischen Hund und Katze versteht: je nachdem, welche sprachliche Einheit sie als Zeichen und welche sie als Objekt heranzieht. Im Lichte dieser Warnung vor einer Verwechslung der Universalgrammatik des Denkens bzw. Interpretierens mit den Grammatiken natürlicher Sprachen hat für Peirce offenbar vor allem die Analyse von Termen, die er weder bei Thomas noch bei Ockham überzeugend durchgeführt fand, ein Problem dargestellt. Aus der entscheidenden These der Jahre 󰀁󰀈󰀆󰀆/󰀆󰀇, dass Argumente und Propositionen grundsätzlich derselben Struktur gehorchen,󰀁󰀄󰀈 hätte folgen müssen, dass diese Struktur auch für Terme aufzuweisen sei. Während Peirce in On A New List Terme auf symbols zu beschränken scheint und in diesem Rahmen verschiedene Formen des Prädikats unterscheidet, legt er ein Jahr zuvor, in der neunten der Lowell Lectures von 󰀁󰀈󰀆󰀆, einen anders gearteten Vorschlag vor, der auch likenesses und indices einbezieht;󰀁󰀄󰀉 und er wird die Jahre hindurch immer wieder neue Versuche mit neuen Nomenklaturen vortragen. Mit bestimmten Wortklassen, die auch Thomas erörtert, etwa Pronomina und Interjektionen, hat Peirce sich gesondert befasst; bekanntlich ist er derjenige gewesen, auf den der heute mehr denn je diskutierte Begriff der indexicals bzw. der Indexwörter zurückgeht.

󰀁󰀄󰀈. CP 󰀄.󰀃 (‚Detached Ideas on Vitally Important Topics‘, 󰀁󰀈󰀉󰀈): ‚It would be tedious to show how this discovery led to the thorough refutation of the third and most important of Kant’s triads, and the confirmation of the doctrine that for the purposes of ordinary syllogism categorical propositions and conditional propositions, which Kant and his ignorant adherents call hypotheticals, are all one. This led me to see that the relation between subject and predicate, or antecedent and consequent, is essentially the same as that between premiss and conclusion‘. – Vgl. K. Oehler, Charles Sander Peirce (󰀁󰀉󰀉󰀃), 󰀅󰀁: ‚Während Kant [...] der Auffassung ist, daß die Unterschiede der Schlußarten sich von den Unterschieden der Urteilsarten herleiten, ist Peirce der gegensätzlichen Ansicht, daß die logisch relevanten Urteilsarten sich von den Schlußformen herleiten. [...] Es gelang Peirce in der Tat gegen Kants Behauptung der Nachweis, daß jede der Figuren ein eigenes Prinzip des Schließens enthält. [...] Damit war klargestellt, daß die drei Figuren drei verschiedene Regeln des Schließens enthalten, was für Peirce gleichbedeutend war mit der Feststellung, daß dies die Formen des Schließens sind, die den Urteilsfunktionen und den Kategorien zugrunde liegen‘. 󰀁󰀄󰀉. Siehe W 󰀁, 󰀄󰀈󰀀.

P EIRCE

ALS

M ODIST ?

󰀁󰀉󰀇

Einen entscheidenden Fortschritt scheint Peirce mir allerdings erst mit der Einsicht zu erreichen, dass der Gebrauch von Wörtern ein Geschehen zwischen einem Sprecher und einem Hörer darstellt, der versucht, einen Sprecher zu verstehen und das mutmaßlich Gemeinte in seinen eigenen Horizont hinein zu übersetzen, sowie mit den Zeichenklassifikationssystemen nach 󰀁󰀉󰀀󰀀, die das Zeichen unter verschiedenen Aspekten thematisieren und diese Aspekte zugleich konditional ordnen. In der Logik dieser Systeme liegt es, dass die Vokabeln natürlicher Sprachen als Zeichen aufgefasst werden können, die unter anderem in der Lage sind, termförmige Interpretanten zu generieren. Im System von 󰀁󰀉󰀀󰀃 lässt sich (nach meinem Verständnis) für ein Zeichen, dessen Interpretant termförmig auftritt, eine Kombination von zwei weiteren Strukturmerkmalen einfordern, im System von 󰀁󰀉󰀀󰀄 eine Kombination von drei weiteren Strukturmerkmalen und im System von 󰀁󰀉󰀀󰀅 eine Kombination von sieben weiteren Strukturmerkmalen, mit dem Resultat, dass sich im System von 󰀁󰀉󰀀󰀃 sechs Arten von Termen ergeben und in den beiden anderen Systemen entsprechend mehr. Peirce selbst hat zumal das letzte der drei Systeme nicht mehr ausführen bzw. erläutern können; und doch hat er damit den Anspruch erhoben, das Programm, eine Universalgrammatik des Denkens im Medium der Zeichen zu entwickeln, für das er Thomas als Kronzeugen aufruft, weiterzuführen und zu überbieten.

Ein ‚ewig Unwiderlegbares‘. Heideggers Missverständnis der averroistischen Abbildtheorie der Sprache des Thomas von Erfurt in seiner Freiburger Habilitationsschrift (Die Kategorien- und Bedeutungslehre des Duns Scotus) ANDRÉS QUERO-SÁNCHEZ, ERFURT Abstract In his ‚Habilitationsschrift‘ at the University of Freiburg (Duns Scotus’ Theory of the Categories and of Meaning [󰀁󰀉󰀁󰀅/󰀁󰀉󰀁󰀆]) Martin Heidegger misunderstood the Speculative Grammar of Thomas of Erfurt, which at this time was thought, also by Heidegger himself, to be a work by the Franciscan John Duns Scotus. Nevertheless, Heidegger’s Work is a very interesting one, since it enables us to understand an early turn (‚Kehre‘) in his way of thinking. Heidegger understood the philosophical positions of Thomas of Erfurt to be similar to those of his philosophical teachers in Freiburg: Edmund Husserl and Heinrich Rickert. But even such an interpretation is inappropriate, because Thomas’ Speculative Grammar is an averroistic picture theory of language, whereas both Husserl and Rickert criticized this kind of a theory of language. 󰀁. Einleitung: Heideggers Habilitationsschrift als Momentaufnahme eines Überganges ‚Wir suchen überall das Unbedingte, und finden immer nur Dinge‘. So lautet der erste Satz der von Novalis im Jahre 󰀁󰀇󰀉󰀈 veröffentlichten Fragmentsammlung Blüthenstaub.󰀁 Dieser Satz ist für uns nur insofern 󰀁. Friedrich von Hardenberg (Novalis), Blüthenstaub, in Schriften. Die Werke Friedrich von Hardenbergs, hg. von Paul Kluckhohn und Richard Samuel. Dritte, nach den Handschriften ergänzte,

󰀂󰀀󰀀

A NDRÉS Q UERO -S ÁNCHEZ

interessant, als Martin Heidegger ihn als Motto für das Schlusskapitel seiner Habilitationsschrift gewählt hat, die er bekanntlich über Die Kategorien- und Bedeutungslehre des Duns Scotus im Jahre 󰀁󰀉󰀁󰀅 der Philosophischen Fakultät der Universität Freiburg im Breisgau vorgelegt hat.󰀂 Das Motto ist tatsächlich, wie wir noch sehen werden, bestens ausgesucht. Heidegger schreibt die genannte Qualifikationsarbeit über den Traktat De modis significandi – in der Überlieferung auch als Novi modi significandi (bzw. Modi significandi noviter compilati) sowie als Grammatica speculativa bekannt –, den er, wie damals üblich, dem Franziskaner Johannes Duns Scotus (ca. 󰀁󰀂󰀆󰀆-󰀁󰀃󰀀󰀈) zuschrieb. Sieben Jahre später konnte der Oberpfälzer Martin Grabmann nachweisen, dass Thomas von Erfurt der wahre Verfasser der Schrift gewesen ist.󰀃 Ein solcher ‚Umstand‘ hätte Heideggers Universitätskarriere völlig zerstören können, zumal seine Deutung des Traktats im zweiten Teil der Habilitationsschrift auf der im ersten Teil durchgeführten Darlegung der Metaphysik des Scotus entscheidend basiert. Doch ist wirkliches Philosophieren, wie es scheint, zufallsresistent. So hat jedenfalls Heidegger selbst gedacht, als er im Jahre 󰀁󰀉󰀇󰀂 die Schrift wieder veröffentlichen ließ,󰀄 und zwar ohne darin irgendeine Passage geändert zu haben. Seine Deutung jedoch war – und ist – falsch; ja, wie unten noch gezeigt werden soll, von G r u n d a u f falsch. Aber sie war – und ist – echte Auseinandersetzung mit der Sache der Philosophie; wenn man so will: falsche Philosophie ja, aber doch e c h t e s und damit w a h r e s , ja ‚ewig unwiderlegbares‘ Philosophieren, welches als solches, so dachte der Nietzsche-Leser Martin Heidegger jedenfalls, nichts als konkret sein kann: erweiterte und verbesserte Auflage, Bd. 󰀂: Das philosophische Werk I (Darmstadt, 󰀁󰀉󰀈󰀁), 󰀄󰀁󰀃,󰀄 (n. 󰀁). Siehe unten, 󰀂󰀁󰀅. 󰀂. Martin Heidegger, Die Kategorien- und Bedeutungslehre des Duns Scotus, ed. von Fr.-W. von Herrmann, in: Gesamtausgabe, Bd. 󰀁: Frühe Schriften (Frankfurt a.M., 󰀁󰀉󰀇󰀈), 󰀃󰀄󰀁. Die erste gedruckte Ausgabe der Schrift erschien im Jahre 󰀁󰀉󰀁󰀆 in Tübingen beim Mohr-Verlag. 󰀃. Vgl. Martin Grabmann, ‚De Thoma Erfordiensi auctore Grammaticae quae Ioanni Duns Scoto adscribitur speculativae‘, Archivum Franciscanum Historicum 󰀁󰀅 (󰀁󰀉󰀂󰀂), 󰀂󰀇󰀃-󰀇. Grabmann erwähnt in diesem Aufsatz, 󰀂󰀇󰀄, Heideggers Habilitationsschrift: ‘Martinus Heidegger, qui in opere perdocto Grammaticam speculativam explicat et cum modernorum philosophorum praeprimis E. Husserl confert, quaestionem et dubium de authenticitate movere praetermittit’. Die im Laufe der handschriftlichen Überlieferung entstandene falsche Zuschreibung hängt, wie ich meine, damit zusammen, dass Thomas von Erfurt u.a. auch im Schottenkloster in Erfurt doziert hat; wie es auf Latein heißt: apud Scotos. Siehe oben, 󰀂󰀉-󰀃󰀀. 󰀄. Vgl. Martin Heidegger, Frühe Schriften (Frankfurt a.M., 󰀁󰀉󰀇󰀂), 󰀁󰀃󰀀-󰀃󰀇󰀅. Die Schrift erschien sechs Jahre später auch im ersten Band der Gesamtausgabe der Schriften Heideggers (siehe oben, Fußnote 󰀂.

E IN ‚ EWIG U NWIDERLEGBARES ‘

󰀂󰀀󰀁

von einem konkreten Lebenden, in einer konkreten Situation und mitten in einem konkreten Denk- oder gar Lebensweg vollzogen.󰀅 Liest man Heideggers Habilitationsschrift in diesem Lichte, so ist sie auf keinen Fall als ‚eine Luftnummer‘ zu betrachten,󰀆 sondern sie protokolliert – auch dies soll im Folgenden gezeigt werden – einen Übergang im ‚Denkweg Martin Heideggers‘. Ja, sie ist Momentaufnahme eines Überganges, der von Heidegger als eine Selbstbefreiung konzipiert war. 󰀂. Der Ausgangspunkt: Der ,logische Absolutismus‘ Edmund Husserls und Heinrich Rickerts Der Ausgangspunkt des Überganges lässt sich nun gut erkennen. Die Arbeit ist dem Freiburger Professor Heinrich Rickert (󰀁󰀈󰀆󰀃-󰀁󰀉󰀃󰀆) gewidmet, der das Habilitationsverfahren eingeleitet und bis zum Schluss geführt hatte.󰀇 Rickert hatte schon bei der Dissertation Heideggers, die dieser bei Artur Schneider (󰀁󰀈󰀇󰀆-󰀁󰀉󰀄󰀅) ebenso in Freiburg über Die Lehre vom Urteil im Psychologismus bis 󰀁󰀉󰀁󰀃 verfasst hatte, eine wichtige Rolle gespielt. ,Ihm verdanke ich‘, so hatte Heidegger im Vorwort der Dissertation über Rickert geschrieben, ,Sehen und Verstehen der modernen logischen Probleme‘.󰀈 Tatsächlich ist der Begriff des ,Logischen‘ für das Verständnis 󰀅. Heidegger, der sich schon in seiner Habilitationsschrift – zumindest in der Druckfassung derselben – von Nietzsche beeinflusst zeigt (siehe unten, Anm. 󰀃󰀆), hätte sicherlich kein Problem gehabt, um sich dessen Worte in der im Jahre 󰀁󰀈󰀇󰀃 verfassten Abhandlung über Die Philosophie im tragischen Zeitalter der Griechen, in Werke. Kritische Gesamtausgabe, Bd. III,󰀂 (Berlin und New York, 󰀁󰀉󰀇󰀃), 󰀂󰀉󰀇,󰀅-󰀁󰀃, zu Eigen zu machen: ‚Es sind aber die Lehren ausgewählt worden, in denen das Persönliche eines Philosophen am stärksten nachklingt, während eine vollständige Aufzählung aller möglichen überlieferten Lehrsätze, wie sie in den Handbüchern Sitte ist, jedenfalls Eins zu Wege bringt, das völlige Verstummen des Persönlichen. Dadurch werden jene Berichte so langweilig: denn an Systemen, die widerlegt sind, kann uns eben nur noch das Persönliche interessiren, denn dies ist das ewig Unwiderlegbare‘. Zum Thema siehe neulich Andrés Quero-Sánchez, ‚Einsam die Straße zu ziehn, gehört zum Wesen des Philosophen. Nietzsches Einsamkeit als metaphysisches Grundprinzip‘, Freiburger Zeitschrift für Philosophie und Theologie 󰀆󰀁 (󰀂󰀀󰀁󰀄), 󰀉󰀆-󰀁󰀂󰀆. 󰀆. Vgl. Milutin Michael Nickl, Zur Aktualität des Thomas von Erfurt und Jan de Stobnica (Lauf an der Pegnitz, 󰀂󰀀󰀀󰀄), XXII: ‚Alle artefaktischen Produktionen und Relationen in Martin Heideggers Pseudo-Duns-Scotus-Abhandlung von 󰀁󰀉󰀁󰀅 sind wertlos und seit dem 󰀁󰀉󰀇󰀂er Nachdruck kaum mehr der Rede wert. Nirgendwo wird darin wirklich neues, standhaltendes, positives Wissen gesetzt. Der umgangssprachliche Kalauer von philosophischer Quatschologie läßt sich leider nicht völlig abweisen. Salopp gesagt: eine Luftnummer‘. 󰀇. Vgl. M. Heidegger, Kategorien- und Bedeutungslehre, ed. F.-W. von Herrmann (󰀁󰀉󰀇󰀈), 󰀁󰀉󰀀. 󰀈. Martin Heidegger, Die Lehre vom Urteil im Psychologismus. Ein kritisch-positiver Beitrag zur Logik (󰀁󰀉󰀁󰀃), ed. von Fr.-W. von Herrmann, in Gesamtausgabe, Bd. 󰀁 (Frankfurt a.M., 󰀁󰀉󰀇󰀈), 󰀆󰀁,󰀁󰀂-󰀃.

󰀂󰀀󰀂

A NDRÉS Q UERO -S ÁNCHEZ

nicht nur der Dissertation, sondern auch der Habilitationsschrift entscheidend, zumal Heidegger ihn sogar als Schlüsselbegriff zur Deutung der Metaphysik des Scotus gebraucht.󰀉 Den Begriff kannte er nun nicht nur über Rickert, sondern natürlich auch über Edmund Husserl, dessen Assistent Heidegger in Freiburg ab 󰀁󰀉󰀁󰀉 sein wird sowie dessen Nachfolger ab 󰀁󰀉󰀂󰀈. Heideggers erstes Meisterwerk, Sein und Zeit (󰀁󰀉󰀂󰀇), ist bekanntlich Husserl gewidmet, wobei das Werk sich eigentlich bestens als Husserl-Kritik deuten lässt. Nun – was ist das ,Logische‘ überhaupt, von dem hier die Rede ist? Heidegger selbst bestimmt es in seinem im Jahre 󰀁󰀉󰀁󰀂 erschienenen Aufsatz mit dem Titel Das Realitätsproblem in der modernen Philosophie unter Berufung auf das erste Buch von Husserls Logischen Untersuchungen (󰀁󰀉󰀀󰀀), wie folgt: ,Die psychische Existenz eines Begriffes und das ideale Sein des Begriffsinhaltes sind total verschiedene Dinge‘.󰀁󰀀 Es geht dabei in erster Linie – bekanntlich – um Kritik am Psychologismus, der nicht in der Lage sei, d en f a kti s c he n V o l l z u g d e s D e n k e n s (νόησις) – der immer von irgendeinem bestimmten Individuum, zu irgendeiner bestimmten Zeit, in irgendeiner bestimmten Situation sowie aus welchen bestimmten Motiven auch immer zustande gebracht wird – vom idealen oder eben logischen Inhalt de s De nkens (νόημα) zu unterscheiden, der als solcher über jegliche Form von realer Konkretheit erhaben ist, oder zumindest erhaben sein s ollt e . Wie die Menschen tatsächlich oder de facto denken, ist sicherlich eine interessante Frage, die für den streng wissenschaftlichen Standpunkt der Husserlschen Phänomenologie jedoch völlig irrelevant ist. 󰀂 × 󰀂 ist nämlich gleich 󰀄 völlig unabhängig davon, ob alle lebenden Menschen de facto anders denken würden. Der Philosoph untersucht keine psychischen Tatsachen, ja, überhaupt keine Tatsachen – weder psychische noch physische noch metaphysische Tatsachen –, sondern bloß l o g i s c h e Phänomene, welche eine G e l t u n g haben, die völlig unabhängig von der Existenz und gerade deswegen ewig – sprich: völlig zeitlos – ist. ,Keine Wahrheit‘, so schreibt Husserl im ersten Band seiner Logischen Untersuchungen,

󰀉. Siehe unten, 󰀂󰀁󰀆-󰀉. 󰀁󰀀. Martin Heidegger, Das Realitätsproblem in der modernen Philosophie (󰀁󰀉󰀁󰀂), ed. von Fr.-W. von Herrmann, in Gesamtausgabe, Bd. 󰀁 (Frankfurt a.M., 󰀁󰀉󰀇󰀈), 󰀇,󰀅-󰀇.

E IN ‚ EWIG U NWIDERLEGBARES ‘

󰀂󰀀󰀃

ist eine Tatsache, d.i. ein zeitlich Bestimmtes. Eine Wahrheit kann freilich die Bedeutung haben, daß ein Ding ist, ein Zustand besteht, eine Veränderung von statten geht u. dgl. Aber die Wahrheit selbst ist über alle Zeitlichkeit erhaben, d.h. es hat keinen Sinn, ihr zeitliches Dasein, Entstehen oder Vergehen zuzuschreiben.󰀁󰀁 Bleiben Historizismus und Naturalismus, wie Husserl es ausdrückt, am ,Aberglauben der Tatsache‘ – sprich: am Dasein – hängen,󰀁󰀂 so ist die Phänomenologie hingegen ,nur Wesensforschung und gar nicht Daseinsforschung‘.󰀁󰀃 Das Logische als das Gebiet des Wesens betrifft in diesem Sinne – und in diesem Punkt stimmen Husserl und Heinrich Rickert völlig überein – eben nicht das Gebiet des ,Seins‘ – gemeint ist: n i c ht das Gebiet des ,Daseins‘, des ,Existierenden‘, des ,Zeitlichen‘, des bloß ,Realen‘ –, sondern allein – so heißt es bei Heidegger, der sich dabei nicht nur auf Husserl und Rickert, sondern vor allem auf Hermann Lotze beruft – das Gebiet des ,Geltenden‘, ,des geltenden Sinnes‘.󰀁󰀄 Es handelt 󰀁󰀁. Edmund Husserl, Logische Untersuchungen, I: Prolegomena zur reinen Logik, ed. von E. Holenstein (Den Haag, 󰀁󰀉󰀇󰀅) (= Husserliana. Edmund Husserl, Gesammelte Werke, Bd. 󰀁󰀈), 󰀈󰀇,󰀁󰀁-󰀆. Vgl. ibid., 󰀁󰀃󰀄,󰀂󰀄-󰀈. 󰀁󰀂. Vgl. id., Philosophie als strenge Wissenschaft, ed. von Th. Nenon und H.R. Sepp, in Aufsätze und Vorträge (󰀁󰀉󰀁󰀁-󰀁󰀉󰀂󰀁) (Dordrecht, Boston und Lancaster, 󰀁󰀉󰀈󰀇) (= Husserliana. Edmund Husserl, Gesammelte Werke, Bd. 󰀂󰀅), 󰀅󰀆,󰀂󰀇-󰀃󰀂. 󰀁󰀃. Ibid., 󰀃󰀆,󰀁󰀃; vgl. ibid., 󰀃󰀃,󰀃󰀄-󰀃󰀄,󰀆; id., Logische Untersuchungen, II. Band, 󰀁. Teil: Untersuchungen zur Phänomenologie und Theorie der Erkenntnis, ed. von U. Panzer (Den Haag, Boston und Lancaster, 󰀁󰀉󰀈󰀄) (= Husserliana. Edmund Husserl, Gesammelte Werke, Bd. 󰀁󰀉,󰀁), 󰀂󰀇,󰀂󰀇-󰀂󰀈,󰀂; ibid., 󰀂󰀄󰀃,󰀁󰀈-󰀂󰀄; ibid., 󰀃󰀅󰀇,󰀂󰀂-󰀃󰀅󰀈,󰀁; ibid., 󰀄󰀁󰀂,󰀁󰀉-󰀄󰀁󰀃,󰀃󰀃; id., Logische Untersuchungen, I, ed. E. Holenstein (󰀁󰀉󰀇󰀅), 󰀈󰀃,󰀃󰀉-󰀈󰀄,󰀁󰀁. 󰀁󰀄. Vgl. Martin Heidegger, Neuere Forschungen über Logik (󰀁󰀉󰀁󰀂), ed. von Fr.-W. von Herrmann, in Gesamtausgabe, Bd. 󰀁 (Frankfurt a.M., 󰀁󰀉󰀇󰀈), 󰀂󰀄,󰀁-󰀂: ‚[...] des Logischen. Dieses Reich des Geltenden [...]‘; ibid., 󰀂󰀂,󰀁󰀈-󰀂󰀅: ‚die Unterscheidung von psychischem Akt und logischem Inhalt, von realem in der Zeit verlaufenden Denkgeschehen und dem idealen außerzeitlichen identischen Sinn, kurz die Unterscheidung dessen, was „ist“, von dem, was „gilt“. Dieser reine, in sich Bestand habende Sinn ist Gegenstand der Logik, und damit wird ihr von Anfang an der Charakter einer empirischen Disziplin genommen‘; id., Lehre vom Urteil, ed. Fr.-W. von Herrmann (󰀁󰀉󰀇󰀈), 󰀁󰀇󰀈,󰀂󰀃󰀁󰀇󰀉,󰀃: ‚Dieses Sein bedeutet nicht reales Existieren oder sonst welche Relation, sondern das Gelten; [...]. [...], ist es Sinn, der gilt. [...] etwas eminent Logisches, sofern dessen Wirklichkeitsform gerade das Gelten ist‘; ibid., 󰀁󰀈󰀃,󰀃󰀂-󰀁󰀈󰀄,󰀁󰀀; ibid., 󰀁󰀆󰀉,󰀂󰀆-󰀁󰀇󰀀,󰀁󰀃 (mit ausdrücklichem Verweis auf Hermann Lotze). Vgl. Heinrich Rickert, Der Gegenstand der Erkenntnis. Einführung in die Transzendentalphilosophie (Tübingen, 󰀁󰀉󰀁󰀅 [Dritte völlig umgearbeitete und erweiterte Auflage]), 󰀂󰀆󰀅,󰀃-󰀇: ‚Wir brauchen dies Wort, das einen Begriff bezeichnet, der sich ebensowenig wie der des Seins definieren läßt, für Gebilde, die nicht existieren und trotzdem „Etwas“ sind, und wir drücken dies am besten dadurch aus, daß wir sagen, sie gel t en ‘. Ich zitiere Rickerts Hauptwerk nach der 󰀃. Auflage aus dem Jahre 󰀁󰀉󰀁󰀅, welche für unseren Kontext relevant ist (󰀁. Auflage 󰀁󰀈󰀉󰀂; ²󰀁󰀉󰀀󰀃). Es gibt freilich auch spätere, noch vom Autor selbst ausgearbeitete Auflagen der Schrift (󰀆󰀁󰀉󰀂󰀈).

󰀂󰀀󰀄

A NDRÉS Q UERO -S ÁNCHEZ

sich dabei um ein ,Unwirkliches‘ oder – auch diesen Ausdruck gebraucht Rickert, den ich im Rahmen meiner Untersuchung privilegieren möchte – ein ,Irreales‘, welches ,wegen seiner Zeitlosigkeit überhaupt keine empirische Realität besitzt‘.󰀁󰀅 Denn ,die „Welt“ ist in ihrer Totalität eben „größer“ als die „Wirklichkeit“‘ – ich würde lieber sagen: ,als die Realität‘ –; und Rickert fügt in diesem Sinne noch hinzu: ,Wer nur Wirkliches [= Reales] zu denken vermag, denkt sie notwendig zu klein und wird sich nie in ihr zurechtfinden‘.󰀁󰀆 Sowohl Rickert als auch Husserl erklären das Logische zum eigentlichen Erkenntnisgegenstand der – so heißt es bei Husserl wörtlich – ,theoretischen Menschen‘,󰀁󰀇 die als solche von pragmatischen und überhaupt praktischen Motivationen – im philosophischen Sinne – absehen. Denn der ,Pragmatismus‘ ist, so schreibt Rickert, eine ,Meinung‘, die den Begriff der Wahrheit überhaupt zerstört [...]. Erkennen um des Erkennens willen, theoretisches Verhalten, das in sich beschlossen ist und nicht nach etwas hinschielt, wofür es da ist, das seine Bedeutung nicht von etwas ihm innerlich Fremden zu borgen braucht, sondern von seinem eigenen Reichtum zehrt, hört dann gänzlich auf, begründbar zu sein.󰀁󰀈 Das (angebliche) Erkennen des Pragmatikers ist also ein a-theoretisches Verhalten, ,das nicht in sich beschlossen ist, sondern immer nach etwas hinschielt, wofür es da ist‘; es ist nicht durch sich selbst reich, wenn man so will: 󰀁󰀅. Vgl. H. Rickert, ibid., 󰀂󰀅󰀇,󰀃󰀇-󰀂󰀅󰀈,󰀆: ,Wir wiesen bereits darauf hin, daß dies Sinngebilde, welches nicht nur e i n e m Individuum allein angehört wie alles Psychische, sondern von vielen gemeinsam als dasselbe verstanden wird, nichts Psychisches sein kann, ja, daß es wegen seiner Zeitlosigkeit überhaupt keine empirische Realität besitzt, also als etwas „Unwirkliches“ bezeichnet werden und dadurch vor der Verwechslung mit allen physischen und psychischen Realitäten geschützt werden muß‘; ibid., 󰀁󰀆󰀅,󰀁󰀈-󰀁󰀆󰀇,󰀁󰀁 (insbesondere 󰀁󰀆󰀇,󰀈-󰀁󰀁: ,Er gehört als S i n n des Aktes in eine besondere Sphäre des Irrealen, die vom psychisch Seienden ebenso wie vom objektiv gültigen Gehalt des Urteils als ein eigentümliches unwirkliches Mi tte l r e i c h zu trennen ist‘). 󰀁󰀆. Ibid., 󰀃󰀅󰀃,󰀂󰀆-󰀂󰀈. 󰀁󰀇. Vgl. E. Husserl, Philosophie als strenge Wissenschaft, ed. Th. Nenon und H.R. Sepp (󰀁󰀉󰀈󰀇), 󰀅󰀃,󰀂󰀈-󰀃󰀀; 󰀅󰀄,󰀁-󰀇: ,theoretische Menschen, von Natur aus geneigt, ihren Beruf in streng wissenschaftlicher Forschung zu suchen, [...]. [...]. Freilich ganz rein ist, in der Lebenswirklichkeit selbst, die Scheidung nicht; und gerade in einer Zeit, in der praktische Motive übermächtig empordrängen, wird auch eine theoretische Natur der Kraft solcher Motive stärker nachgeben können, als dies ihr theoretischer Beruf gestatten würde. Hier liegt aber im besonderen für die Philosophie unserer Zeit eine große Gefahr‘; H. Rickert, Gegenstand der Erkenntnis (³󰀁󰀉󰀁󰀅), XI,󰀁󰀄-󰀂󰀀: ,[E]s gibt noch eine „andere Welt“ als die immanente wirkliche […]. Sie besteht „unabhängig“ von jedem Realen und ist insofern transzendent, ja erst in ihr haben wir die letzte Grundlage des Theoretischen überhaupt oder den „Gegenstand“ der Erkenntnis. So kommen wir zu zwei Welten, einer seienden und einer geltenden‘. 󰀁󰀈. H. Rickert, ibid., 󰀁󰀂󰀈,󰀁󰀆-󰀂󰀃.

E IN ‚ EWIG U NWIDERLEGBARES ‘

󰀂󰀀󰀅

non est dives per se ipsum.󰀁󰀉 Und Husserl gebraucht in diesem Zusammenhang sogar einen Ausdruck, der zentral sein wird, um Heideggers ,Übergang‘ zu verstehen, wenn er nämlich schreibt, der den theoretischen Menschen beschäftigende Gegenstand, nämlich das Wesen an sich, bestehe ,unbekümmert um alle anderen [von ihm verschiedenen Inhalten]‘: ,In der „Natur“ des Inhalts selbst, in seinem idealen Wesen gründet keine Abhängigkeit von anderen Inhalten, er ist in seinem Wesen, durch das er ist, was er ist, unbekümmert um alle anderen‘.󰀂󰀀 Das Wesen gilt in diesem Sinne unbedingt,󰀂󰀁 󰀁󰀉. Vgl. Anonymus, Liber de causis, n. 󰀂󰀀. (󰀂󰀁.), ed. von A. Schönfeld (Hamburg, 󰀂󰀀󰀀󰀃), 󰀄󰀂 (n. 󰀁󰀆󰀂): ‘Primum est dives per se ipsum et non est dives maius’. Zu Eckharts Gebrauch dieses Satzes siehe Fiorella Retucci, ,Her ûf sprichet ein heidenischer meister in dem buoche, daz dâ heizet daz lieht der liehte: Eckhart, il Liber de causis e Proclo‘, in Loris Sturlese (Hg.), Studi sulle fonti di Meister Eckhart, Bd. I: Aristoteles, Augustinus, Avicenna, Dionysius, Liber de causis, Proclus, Seneca (Freiburg i.Br., 󰀂󰀀󰀀󰀈), 󰀁󰀃󰀅-󰀆󰀆. Obwohl es bekanntlich nicht wenige Studien gibt, die den Zusammenhang zwischen Heidegger und Meister Eckhart zu thematisieren suchen (vgl. etwa Ricardo Baeza, Die Topologie des Ursprungs. Der Begriff der Gelassenheit bei Eckhart und Heidegger und seine Entfaltung in der abendländischen Mystik und im zeitgenössischen Denken [Berlin, 󰀂󰀀󰀀󰀉], 󰀁󰀀󰀇-󰀄󰀂 [,Die Verwandschaft zwischen Heidegger und Meister Eckhart in der zeitgenössischen Diskussion‘]), scheint mir die ,Mystik‘ Eckharts dem logischen Absolutismus Rickerts und Husserls näher zu sein als der auf der Kritik an demselben basierenden Position Heideggers. Rickert kennt jedenfalls Meister Eckhart und gebraucht eine Stelle aus dessen Predigten als Motto für seinen Aufsatz ,Das Eine, die Einheit und die Eins. Bemerkungen zur Logik des Zahlbegriffs‘, in Logos 󰀂 (󰀁󰀉󰀁󰀁/󰀁󰀂), 󰀂󰀆-󰀇󰀈, 󰀂󰀆: ‚Aber do si ein sein in dem wesen da ensein si niht geleich, wann geleicheit stet in unterscheid‘. Vgl. Meister Eckhart (unsichere Zuschreibung), Pr. 󰀈󰀂 (Jostes) (= LW IV,󰀂, Pr. 󰀁󰀁󰀇), ed. von Fr. Jostes, Meister Eckhart und seine Jünger – ungedruckte Texte zur Geschichte der deutschen Mystik (Freiburg [Schweiz], 󰀁󰀈󰀉󰀅), 󰀉󰀄,󰀃󰀂-󰀄. Darauf bezieht sich Heidegger selbst in seiner Habilitationsschrift, Kategorien- und Bedeutungslehre, ed. F.-W. von Herrmann (󰀁󰀉󰀇󰀈), 󰀂󰀁󰀈,󰀂󰀁-󰀄. Recht verstanden, besagt das theoretische Interesse (!) bei Eckhart, Rickert und Husserl nicht das Andere des (oder gar den Gegensatz) zum ,Pragmatismus‘, sondern zum ,Opportunismus‘. Anders gesagt: Sie gebrauchen einen zu engen Begriff vom ,Pragmatismus‘, der dieser mit ,Opportunismus‘ gleichsetzt. Zum Verhältnis zwischen Theoretischem und Praktischem (oder gar Pragmatischem) im Werk Eckharts ist nach wie vor Dietmar Mieths Kommentierung von Eckharts Predigt 󰀈󰀆 (,Maria-Martha-Predigt‘) heranzuziehen; vgl. Dietmar Mieth, ,Predigt 󰀈󰀆: Intravit Iesus in quoddam castellum‘, in L. Sturlese und G. Steer (Hgg.), Lectura Eckhardi. Predigten Meister Eckharts von Fachgelehrten gelesen und gedeutet, Bd. 󰀂 (Stuttgart, 󰀂󰀀󰀀󰀃), 󰀁󰀃󰀉-󰀇󰀆. 󰀂󰀀. Vgl. E. Husserl, Logische Untersuchungen, II,󰀁, ed. U. Panzer (󰀁󰀉󰀈󰀄), 󰀂󰀃󰀉,󰀄-󰀁󰀃: ,[Es sei so], daß die Existenz dieses Inhalts, soviel an ihm selbst, seinem Wesen nach, liegt, durch die Existenz anderer Inhalte gar nicht bedingt ist, daß er, so wie er ist, a priori, d.i. eben seinem Wesen nach, existieren könnte, auch wenn außer ihm gar nichts da wäre oder wenn sich alles um ihn herum willkürlich, d.i. gesetzlos änderte. // Oder was offenbart gleichwertig ist: I n d e r „N at u r “ d e s Inhalts selbst, in s ein em id ea l en Wesen , grün det k e i n e A b h än g i g k e i t vo n an d e ren Inhalten, er ist in seinem Wesen, durch das er ist, was er ist, unbekümmert um alle anderen‘. 󰀂󰀁. Vgl. ibid., 󰀂󰀉󰀇,󰀄-󰀁󰀂: ,Von vornherein ist es aber zweifellos, daß die Naturgesetze im gewöhnlichen Sinn zu diesem Apriori, dieser reinen und allgemeinen „Form“ der Natur, nicht gehören, daß sie nicht den Charakter von Wesenswahrheiten, sondern von Tatsachenwahrheiten haben. Ihre Allgemeinheit ist also keine „reine“ oder „unbedingte“, und ebenso ist die „Notwendigkeit“ alles ihnen untergeordneten dinglichen Geschehens mit „Zufälligkeit“ behaftet. Die Natur mit all ihren physikalischen Gesetzen ist eben ein Faktum, das auch anders sein könnte‘.

󰀂󰀀󰀆

A NDRÉS Q UERO -S ÁNCHEZ

voraussetzungslos,󰀂󰀂 absolut, an sich,󰀂󰀃 a priori, somit nicht bloß für uns Menschen oder für irgendetwas sonst als für d i e S a c h e s e l b s t : ,Wissenschaft ist ein Titel für absolute, zeitlose Werte‘, welche ,durch keine Relation auf den Geist einer Zeit begrenzt‘ werden.󰀂󰀄 Der Sinn gilt, so schreibt Rickert, ,unbedingt oder „kategorisch“‘. ,Es gibt da kein „wenn“‘.󰀂󰀅 Ja, Husserl selbst spricht im ersten Buch seiner Logischen Untersuchungen von sich selbst als einem ,logischen Absolutisten‘: ,Wir, logische Absolutisten‘.󰀂󰀆 Martin Heidegger hat seine Freiburger Universitätskarriere also unter der Herrschaft des Theoretischen begonnen, in einem dem Pragmatismus gegenüber feindlichen, das absolut geltende Irreale anstrebenden Milieu. Seine Habilitationsschrift, und zwar die gedruckte Form derselben, die das Schlusskapitel als neues Bestandstück inkorporiert, protokolliert nun seine Befreiung von einer solchen – wenn man so will – ,abstrakten Herrschaft‘. 󰀃. Heideggers Habilitationsschrift: Momentaufnahme einer grundlegenden ‚Kehre‘ Der Begriff des Logischen in der gerade erklärten Bedeutung – des geltenden Sinnes, des Irrealen – hatte Heideggers Freiburger Dissertation über Die Lehre vom Urteil im Psychologismus eindeutig bestimmt, aber 󰀂󰀂. Vgl. ibid., 󰀂󰀄,󰀆-󰀉: ,Eine erkenntnistheoretische Untersuchung, die ernstlichen Anspruch auf Wissenschaftlichkeit erhebt, muß, wie man schon oft betont hat, dem P r i n zi p d e r V o r au s setzungslosi gk eit genügen‘. 󰀂󰀃. Vgl. ibid., I, ed. E. Holenstein (󰀁󰀉󰀇󰀅), 󰀁󰀂󰀅,󰀉-󰀁󰀅: ,Was wahr ist, ist absolut, ist „an sich“ wahr; die Wahrheit ist identisch eine, ob sie Menschen oder Unmenschen, Engel oder Götter urteilend erfassen. Von der Wahrheit in dieser idealen Einheit gegenüber der realen Mannigfaltigkeit von Rassen, Individuen und Erlebnissen sprechen die logischen Gesetze und sprechen wir alle, wenn wir nicht etwa relativistisch verwirrt sind‘. 󰀂󰀄. Vgl. E. Husserl, Philosophie als strenge Wissenschaft, ed. Th. Nenon und H.R. Sepp (󰀁󰀉󰀈󰀇), 󰀅󰀂,󰀂󰀀-󰀈: ,Die „Idee“ der Wissenschaft hingegen ist eine überzeitliche, und das sagt hier, durch keine Relation auf den Geist einer Zeit begrenzt. [...]. Überhaupt sind ja unsere Lebensziele von doppelter Art, die einen für Zeit, die anderen für Ewigkeit, die einen unserer eigenen Vollkommenheit und der unserer Zeitgenossen dienend, die anderen der Vollkommenheit auch der Nachlebenden, bis in die fernsten Generationen. Wissenschaft ist ein Titel für absolute, zeitlose Werte‘; vgl. auch ibid., 󰀄󰀃,󰀂󰀄-󰀃󰀃. 󰀂󰀅. Vgl. H. Rickert, Gegenstand der Erkenntnis (³󰀁󰀉󰀁󰀅), 󰀂󰀉󰀇,󰀂󰀉-󰀃󰀂: ,In beiden Fällen gelten die Werte, zu denen Stellung genommen wird, unbedingt oder „kategorisch“. Es gibt da kein „wenn“. In beiden Fällen wird ein Wert allein um des Wertes, ein Sollen allein um seiner Geltung willen anerkannt‘. Siehe auch ibid., 󰀂󰀇󰀉,󰀁󰀀-󰀉. 󰀂󰀆. Vgl. E. Husserl, Logische Untersuchungen, I, ed. E. Holenstein (󰀁󰀉󰀇󰀅), 󰀁󰀄󰀄,󰀂󰀃-󰀄; ibid., 󰀁󰀄󰀆,󰀁󰀅; ibid., 󰀁󰀄󰀇,󰀂󰀁-󰀃󰀀.

E IN ‚ EWIG U NWIDERLEGBARES ‘

󰀂󰀀󰀇

selbst in der Habilitationsschrift nimmt es einen herausragenden Platz ein. Schon das für die Einleitung gewählte Motto – ein Hegel-Zitat – bewegt sich in dieser Bahn, wenn es nämlich heißt: ,in Rücksicht aufs innere Wesen der Philosophie gibt es weder Vorgänger noch Nachgänger‘.󰀂󰀇 Die vom Interpreten durch die Deutung von Texten aus der Vergangenheit (!) gesuchte, r e i n p h i l o s o p h i s c h e Wahrheit ist also eine l o g i s c h e , die als solche ,über alle Zeitlichkeit erhaben ist‘. Und Heidegger selbst erklärt seinen methodischen Ansatz zu Beginn der Habilitationsschrift in diesem vom Idealismus Husserls und Rickerts bestimmten Sinne: Wenn auch die religiösen, politischen und im engeren Sinne kulturellen Momente einer Zeit unentbehrlich sind für das Verständnis der Entstehung und der historischen Bedingtheit einer Philosophie, so kann doch im rein philosophischen Interesse, das sich als solches eben nur um die Probleme an sich bewegt, von diesen Momenten abgesehen werden. Die Zeit, als historische Kategorie hier verstanden, wird gleichsam ausgeschaltet.󰀂󰀈 Den philosophischen Interpreten interessiert also nicht die historisch und damit zeitlich bedingte νόησις, sondern das letztlich von derselben völlig unabhängige νόημα. Doch schon beim Vorwort der Habilitationsschrift hatte Heidegger betont, wie seine Dankbarkeit gegenüber Rickert ,bei völlig freier Wahrung des eigenen „Standpunktes“‘ bestehe.󰀂󰀉 Denn die Philosophie sei, so sagt er noch an der gleichen Stelle, ,zu einer entscheidenden Vorwärtsbewegung [...] berufen‘.󰀃󰀀 Worin das angestrebte Neue besteht, das Ziel des Überganges oder gar der Befreiung, kann man – zwar nicht nur, so doch insbesondere – ,dem nachträglich geschriebenen Schlußkapitel‘ bestens ablesen.󰀃󰀁 ,Man vermag die Logik und ihre Probleme überhaupt‘, so liest man dort, ,nicht im wahren 󰀂󰀇. M. Heidegger, Kategorien- und Bedeutungslehre, ed. Fr.-W. von Herrmann (󰀁󰀉󰀇󰀈), 󰀁󰀉󰀃,󰀅-󰀇. Vgl. Georg Wilhelm Friedrich Hegel, Differenz des Fichte’schen und Schelling’schen Systems der Philosophie, in Gesammelte Werke, Ed. der Rheinisch-Westfälischen Akademie der Wissenschaften, Bd. 󰀄: Jenaer kritische Schriften, hg. von H. Buchner und O. Pöggeler (Hamburg, 󰀁󰀉󰀆󰀈), 󰀁󰀀,󰀃󰀀-󰀁. 󰀂󰀈. M. Heidegger, Kategorien- und Bedeutungslehre, ed. Fr.-W. von Herrmann (󰀁󰀉󰀇󰀈), 󰀁󰀉󰀆,󰀁󰀉-󰀂󰀅. 󰀂󰀉. Ibid., 󰀁󰀉󰀁,󰀉-󰀁󰀀. 󰀃󰀀. Ibid., 󰀁󰀉󰀁,󰀁󰀁-󰀃. 󰀃󰀁. Ibid., 󰀁󰀉󰀁,󰀃-󰀄.

󰀂󰀀󰀈

A NDRÉS Q UERO -S ÁNCHEZ

Lichte zu sehen, wenn nicht der Zusammenhang, aus dem heraus sie gedeutet werden, ein translogischer wird‘.󰀃󰀂 Denn: ,Innerhalb des Reichtums der Gestaltungsrichtungen des lebendigen Geistes ist die theoretische Geisteshaltung nur eine‘,󰀃󰀃 so dass man ,den logischen Sinn auch seiner ontischen Bedeutung nach zum Problem machen‘ soll.󰀃󰀄 Den logischen, über alle Zeitlichkeit (angeblich) erhabenen Sinn will Heidergger jetzt also doch in jeweiliger, durch die Zeit jeweils anders bestimmten Kontext – wie es heißt: seiner ontischen (sprich: realen, daseienden, k o n k r e t e n ) Bedeutung nach – erschließen. Denn die Wahrheit, so denkt Heidegger bereits im Jahre 󰀁󰀉󰀁󰀆, könne nicht zeitlos, nicht unhistorisch – eben nicht rein logisch! – sein: ,Der lebendige Geist ist als solcher wesensmäßig historischer Geist im weitesten Sinne des Wortes. Die wahre Weltanschauung ist weit entfernt von bloßer punktueller Existenz einer vom Leben abgelösten Theorie‘.󰀃󰀅 Im Mittelpunkt soll also das konkrete, zeitliche Leben des konkreten, in einer bestimmten Zeit und überhaupt historischen Situation lebenden Individuums stehen. Hatte sich Heidegger zu Beginn der Habilitationsschrift auf Hegel berufen, um seinen durch den Idealismus Husserls und Rickerts bestimmten methodologischen Ansatz zu unterstützen, so verweist er jetzt – und zwar ein paar Seiten unten – auf Nietzsche, um die im Grunde gegenteilige These zu vertreten: ,Dieses Bestimmtsein aller Philosophie vom Subjekt her hat Nietzsche in seiner unerbittlich herben Denkart und plastischen Darstellungsfähigkeit auf die bekannte Formel gebracht vom „Trieb, der philosophiert“‘.󰀃󰀆 Diese für die gedruckte Fassung der Schrift charakteristische Position ,bewegt sich nicht mehr‘, so stellt FriedrichWilhelm von Herrmann treffend fest, ,auf der gedanklichen Ebene der 󰀃󰀂. Ibid., 󰀄󰀀󰀅,󰀂󰀈-󰀃󰀀. 󰀃󰀃. Ibid., 󰀄󰀀󰀆,󰀉-󰀁󰀀. 󰀃󰀄. Ibid., 󰀄󰀀󰀆,󰀂󰀁-󰀂. 󰀃󰀅. Ibid., 󰀄󰀀󰀇,󰀁󰀉-󰀄󰀀󰀈,󰀂. Siehe auch ibid., 󰀂󰀀󰀅, Anm. 󰀁󰀀; ibid., 󰀂󰀀󰀇,󰀁󰀀-󰀈; id., Der Zeitbegriff in der Geschichtswissenschaft (󰀁󰀉󰀁󰀆), ed. von Fr.-W. von Herrmann, in Gesamtausgabe, Bd. 󰀁 (Frankfurt a.M., 󰀁󰀉󰀇󰀈), 󰀄󰀂󰀇,󰀂󰀃-󰀄󰀂󰀈,󰀁󰀀; ibid., 󰀄󰀃󰀁,󰀅-󰀁󰀇. 󰀃󰀆. Vgl. M. Heidegger, Kategorien- und Bedeutungslehre, ed. Fr.-W. von Herrmann (󰀁󰀉󰀇󰀈), 󰀁󰀉󰀆,󰀃-󰀆. Heidegger hat dabei Nietzsches Jenseits vom Gut und Böse, § 󰀆, in Werke. Kritische Gesamtausgabe, ed. von G. Colli und M. Montinari, Bd. VI,󰀂 (Berlin, 󰀁󰀉󰀆󰀈), 󰀁󰀃-󰀄, im Sinne. Zur Zentralität des Persönlich-Erlebten bei Nietzsche siehe A. Quero-Sánchez, ,Einsam die Straße zu ziehn‘ (󰀂󰀀󰀁󰀄). Zum Verhältnis Heideggers zu Nietzsches Werk siehe ibid., sowie id., ,Treue zur Erde als Wille zum Willen: Friedrich Nietzsches Philosophie der Wünschbarkeit‘, in Matthias Mayer (ed.), Also wie sprach Zarathustra? West-östliche Spiegelungen im kulturgeschichtlichen Vergleich (Würzburg, 󰀂󰀀󰀀󰀆), 󰀈󰀉-󰀁󰀁󰀀, 󰀁󰀀󰀁-󰀂, Anm. 󰀅󰀀.

E IN ‚ EWIG U NWIDERLEGBARES ‘

󰀂󰀀󰀉

Habilitationsschrift‘󰀃󰀇 – genauer: nicht mehr auf der gedanklichen Ebene der der Fakultät ursprünglich vorgelegten Fassung der Habilitationsschrift.󰀃󰀈 Der philosophierende Trieb ist jedenfalls das Andere vom (oder gar das Gegenteil zum) reinen phänomenologischen, auf das vom realen Dasein völlig unabhängige logische Wesen gerichteten, rein theoretischen Blick. Ausgangspunkt also und Ziel des Überganges – beide – sind in Heideggers Habilitationsschrift deutlich feststellbar, welche in diesem Sinne Momentaufnahme des Überganges ist. 󰀄. Das Leben an sich: Die (angebliche) Selbstaufhebung des Idealismus Wir erleben mit Heideggers Habilitationsschrift also den Beginn eines Prozesses, der 󰀁󰀉󰀂󰀇 in Sein und Zeit – zumindest: zunächst – kulminieren wird und der insbesondere in den früheren Freiburger Vorlesungen aus der Privatdozent-Zeit gut bezeugt ist. ,Diese Vorherrschaft des Theoretischen 󰀃󰀇. Vgl. Friedrich-Wilhelm von Herrmann, ,Ansatz und Wandlungen der Gottesfrage im Denken Martin Heideggers‘, in Jakub Sirovátka (Hg.), Endlichkeit und Transzendenz. Perspektiven einer Grundbeziehung (Hamburg, 󰀂󰀀󰀁󰀂), 󰀁󰀅󰀃-󰀈󰀄, 󰀁󰀅󰀄: ,In das Jahr 󰀁󰀉󰀁󰀆 fällt auch die Korrekturarbeit für den Satz und Druck von Heideggers Habilitationsschrift Die Kategorien- und Bedeutungslehre des Duns Scotus, die im Herbst erscheint. Für die Drucklegung verfaßt Heidegger einen 󰀁󰀂 Seiten langen „Schluß“ mit dem Titel Das Kategorienproblem. Dieser „Schluß“ bewegt sich nicht mehr auf der gedanklichen Ebene der Habilitationsschrift, sondern bereits auf jener gewandelten Ebene, die sich in jenem Brief vom 󰀅. März 󰀁󰀉󰀁󰀆 ausspricht. Es ist die neu gewonnene Ebene des „lebendigen Lebens“, das dem theoretischen Leben voraufgeht‘. Die entscheidende Passage im erwähnten Brief Heideggers vom 󰀅. März 󰀁󰀉󰀁󰀆 an seine Braut und spätere Ehefrau Elfride Petri hatte von Herrmann, ibid., 󰀁󰀅󰀃, selbst zitiert; vgl. ,Mein liebes Seelchen‘. Briefe Martin Heideggers an seine Frau Elfride 󰀁󰀉󰀁󰀅-󰀁󰀉󰀇󰀀, hg., ausgewählt und kommentiert von G. Heidegger (München, 󰀂󰀀󰀀󰀅), 󰀃󰀆,󰀂󰀀-󰀅; 󰀃󰀆,󰀃󰀀-󰀃󰀇,󰀃 (Heidegger bezieht sich dabei auf eine Vorlesung, die er im Wintersemester 󰀁󰀉󰀁󰀅/󰀁󰀆 in Freiburg i.Br. gehalten hatte, welche leider nicht erhalten geblieben ist): ,was ich letztlich suchte u. worunter ich beständig litt, hab ich gefunden, die erste u. die letzte Vorlesung dieses Semesters sind in mir zu einer einzigen Wirklichkeit geworden – was vordem mir immer Schranke, Problem, Zweifelhaftes, Fernes war, ist mir nun Nähe, Gewißheit, Fraglosigkeit, Befreiung – [...] ich weiß heute, daß es eine Philosophie des lebendigen Lebens geben darf – daß ich dem Rationalismus den Kampf bis aufs Messer erklären darf – ohne dem Bannstrahl der Unwissenschaftlichkeit zu verfallen – ich darf es – ich muß es – u. so steht heute vor mir die Notwendigkeit des Problems: wie ist Philosophie als lebendige Wahrheit zu schaffen u. als Schöpfung der Persönlichkeit wert- u. machtvoll‘. 󰀃󰀈. Die Exemplaren der ursprünglichen, der Fakultät vorgelegten Fassung der Habilitationsschrift sind, wie es scheint, nicht mehr auffindbar, wie Fr.-W. von Herrmann in einer mir im Dezember 󰀂󰀀󰀁󰀃 geschickten Email wissen lies: ,Ich habe mich beim Universitätsarchiv nach dem Exemplar von Heideggers Habilschrift, das der Fakultät vorgelegt hat, erkundigt. Leider beginnt die Sammlung der Habilitationsschriften erst viele Jahre später. Im Heidegger-Nachlaß des Deutschen Literaturarchivs Marbach gibt es auch nicht die Handschrift der Habilitationsschrift. Das bedeutet, daß das von Ihnen gesuchte Exemplar weder in Freiburg noch in Marbach vorliegt‘.

󰀂󰀁󰀀

A NDRÉS Q UERO -S ÁNCHEZ

muß gebrochen werden‘, so heißt es etwa in der Vorlesung mit dem Titel Die Idee der Philosophie und das Weltanschauungsproblem, aus dem Jahre 󰀁󰀉󰀁󰀉, plakativ und unmissverständlich.󰀃󰀉 Denn gerade das ausschließlich auf das Logische gerichtete theoretische Verhalten hält uns von der wahren, historisch, ja situativ bestimmten Wirklichkeit – nämlich vom wirklichen Leben – ab: ,Das Gegenstand-, das Objektsein als solches‘, so kritisiert Heidegger, ,berührt mich [sc. im theoretischen Verhalten] nicht. Das Ich, das fest-stellt, bin ich gar nicht mehr. Das Feststellen als Erlebnis ist nur noch ein Rudiment von Er-leben; es ist ein Ent-leben‘,󰀄󰀀 und zwar wegen der dadurch zustande gebrachten ,Unterbindung des lebendigen Bezugs des Ich zu seiner Situation‘,󰀄󰀁 d.h. wegen des Ausschließens des Pragmatischen als eines solchen. Gerade durch die theore t is che , letztlich vom Platonismus󰀄󰀂 beherrschte Einstellung geht die Welt also, wie sie sich selbst uns ursprünglich gi b t, verloren. Durch das durch die theoretische Einstellung dominierte Streben nach der Sache selbst geht also eben die Sache, wie sie ursprünglich ist, verloren.󰀄󰀃 Die 󰀃󰀉. Martin Heidegger, Die Idee der Philosophie und das Weltanschauungsproblem (󰀁󰀉󰀁󰀉), ed. von B. Heimbüchel, in Gesamtausgabe, Bd. 󰀅󰀆/󰀅󰀇 (Frankfurt a.M., 󰀁󰀉󰀈󰀇), 󰀅󰀉,󰀂󰀈-󰀉. Siehe auch ibid., 󰀈󰀇,󰀂󰀃-󰀆. 󰀄󰀀. Vgl. M. Heidegger, Idee der Philosophie und das Weltanschauungsproblem, ed. B. Heimbüchel (󰀁󰀉󰀈󰀇), 󰀇󰀃,󰀃󰀀-󰀇󰀄,󰀁. Siehe auch ibid., 󰀁󰀀󰀀,󰀂󰀇-󰀉: ,in der Reflexion sind wir theoretisch eingestellt. Alles theoretische Verhalten, sagten wir, ist ein entlebendes‘. 󰀄󰀁. Vgl. M. Heidegger, Über das Wesen der Universität und des akademischen Studiums (󰀁󰀉󰀁󰀉), ed. von B. Heimbüchel, in Gesamtausgabe, Bd. 󰀅󰀆/󰀅󰀇 (Frankfurt a.M., 󰀁󰀉󰀈󰀇), 󰀂󰀀󰀆,󰀃󰀀-󰀄: ,Damit wird zugleich das Situations-Ich, das „historische“ Ich, verdrängt. Es tritt die „Entgeschichtlichung des Ich“ ein. Unterbindung des lebendigen Bezugs des Ich zu seiner Situation. Der Lebensbezug des Situations-Ich ist kein bloßes Gerichtetsein auf bloße Gegenstände‘. 󰀄󰀂. Vgl. Martin Heidegger, Einleitung in die Phänomenologie der Religion (󰀁󰀉󰀂󰀀/󰀂󰀁), ed. von M. Jung und Th. Regehly, in Gesamtausgabe, Bd. 󰀆󰀀 (Frankfurt a.M., 󰀁󰀉󰀉󰀅), 󰀃󰀈,󰀂󰀇-󰀉: ,Der platonische Weg: Das Historische ist etwas, demgegenüber eine Abkehr gewonnen werden muß. Das SichBehaupten ist eine Abkehr gegen das Historische selbst‘; ibid., 󰀃󰀉,󰀈-󰀄󰀀,󰀁󰀂; id., Phänomenologie der Anschauung und des Ausdrucks. Theorie der philosophischen Begriffsbildung (󰀁󰀉󰀂󰀀), ed. von Cl. Strube, in Gesamtausgabe, Bd. 󰀅󰀉 (Frankfurt a.M., 󰀁󰀉󰀉󰀃), 󰀂󰀀,󰀅-󰀂󰀁,󰀅. 󰀄󰀃. Vgl. id., Grundprobleme der Phänomenologie (󰀁󰀉󰀁󰀉/󰀂󰀀), ed. von H.-H. Gander, in Gesamtausgabe, Bd. 󰀅󰀈 (Frankfurt a.M., 󰀁󰀉󰀉󰀃), 󰀂󰀀󰀉,󰀁󰀀-󰀃󰀂: ,Wie kommt die Gleichartigkeit der Erfahrung zustande? – In der Botanik zum Beispiel muß ein einheitlicher Erfahrungsboden da sein. Ich habe mich vielleicht also über Blumen gefreut, von fremden Gewächsen gehört etc. Aber alle diese verschiedenen Situationen sollen jetzt aus dem neuen „sachlichen“ Zusammenhang herausfallen. Ich kann die genannten Erfahrungen (als persönliche) gewissermaßen von mir abstößen, meine persönlichen Beziehungen zu ihnen abbrechen, die betreffenden Verfügbarkeiten gehen mich nichts mehr an – (z.B. ich habe vorhin den Lastwagen durch das Fenster auf der Straße fahren sehen. – Jetzt sehe ich nur noch einen Körper, der sich bewegt). Meine Beziehungen zum Erfahrenen sind abgeschnitten. Die Verfügbarkeit verschwindet nicht als Ganzes, aber der Bezugscharakter zu meiner Selbstwelt ist gestört. Allen Erfahrungen kann das geschehen, daß sie kein Verhältnis mehr zur

E IN ‚ EWIG U NWIDERLEGBARES ‘

󰀂󰀁󰀁

Husserlsche Phänomenologie widerspreche sich somit selbst, so dass, wie Heidegger meint, ,der Radikalismus der Phänomenologie am radikalsten sich gegen sich selbst zu richten hat‘.󰀄󰀄 Ursprünglich sei die Welt nämlich n i c h t so, wie die theoretische Einstellung oder das theoretische Verhalten sie habe n will. An sich ist die Welt nach Heidegger kein zeitloses Ansich: sie ist an sich ansich-los. Wer die Sache selbst nämlich sucht, findet sie nicht in der theoretischen Einstellung, sondern im alltäglichen Umgang mit der Welt, nicht also beim Zusehen, sondern beim Leben – im Um-gang mit der Welt – gibt sich uns die Welt, wie sie ursprünglich ist: Unser Leben ist unsere Welt – und selten so, daß wir zusehen, sondern immer, wenn auch ganz unauffällig, versteckt, „dabei sind“: „gefesselt“, „abgestoßen“, „genießend“, „entsagend“. „Wir begegnen immer irgendwie“. Unser Leben ist die Welt, in der wir leben, in die hinein und je innerhalb welcher die Lebenstendenzen laufen. Und unser Leben ist nur als Leben, insofern es in einer Welt lebt.󰀄󰀅 Und Heidegger fügt noch hinzu: ,So ist nun einmal das Leben, so gibt es sich. [...] das „Leben an sich“ ‘.󰀄󰀆 Und von diesem ursprünglichen Leben in der Welt – welche, wie Heidegger sagt, nicht bloß ,ist‘, noch bloß ,gilt‘, sondern ,weltet‘ – hält uns eben die theoretische Einstellung ab, und zwar gerade durch ihr Streben nach dem zeitlosen Ansich, nach einer Welt nämlich, in der die Dinge nicht ,welten‘, sondern bloß ,sind‘ oder – genauer – ,daseinlos‘ ,gelten‘. Die theoretische Einstellung ist in diesem Sinne, so Heidegger, ,das absolute Weltlose, Welt-fremde; es ist die Sphäre, wo einem der Atem ausgeht und man nicht leben kann‘.󰀄󰀇 Selbstwelt haben. Diese Antastung ist der erste Schritt zur Zerstörung des Umwelt-Lebens. Die Durchstreichung der Bezüge der Erfahrung zur Selbstwelt ist zugleich eine positive Charakterisierung für sie: und zwar eine Charakterisierung als bloße Sache. Jetzt besteht die Möglichkeit für sie, in ihrem Sachcharakter und ihrem Sachzusammenhang betrachtet zu werden. Die Erfahrungen sind ja jetzt frei geworden von „mir“ und können in „ihren“ Zusammenhang treten‘. 󰀄󰀄. Vgl. ibid., 󰀁󰀄󰀅,󰀅-󰀁󰀂: ,Bereits in den ersten Vorlesungsstunden wurde betont, daß der Radikalismus der Phänomenologie am radikalsten sich gegen sich selbst zu richten hat, [...], gegen das gerade hier meist unvermerkte Hineingleiten in nichtursprüngliche Haltung und Stabilisierung und Gewinnung nichtsursprünglicher Motive‘. 󰀄󰀅. Ibid., 󰀃󰀃,󰀃󰀁-󰀃󰀄,󰀅. 󰀄󰀆. Ibid., 󰀃󰀅,󰀃󰀁-󰀂. 󰀄󰀇. Id., Die Idee der Philosophie und das Weltanschauungsproblem, ed. B. Heimbüchel (󰀁󰀉󰀈󰀇), 󰀁󰀁󰀂,󰀂󰀈-󰀃󰀀. Siehe auch id., Grundprobleme der Phänomenologie, ed. von H.H. Gander (󰀁󰀉󰀉󰀃), 󰀇󰀇,󰀁󰀃󰀇󰀈,󰀂.

󰀂󰀁󰀂

A NDRÉS Q UERO -S ÁNCHEZ

Zum Verständnis dessen, was Heidegger mit dem Ausdruck ,UmWelt‘ meint, ist insbesondere die Vorsilbe ,um‘ entscheidend, wie sie etwa im Ausdruck ,Umsicht‘ (oder ,sich umsehen‘) gebraucht wird. Ist das Wesen nach der bereits zitierten Forderung Husserls an sich selbst und damit ,unbekümmert um alle anderen [von ihm verschiedenen Dinge]‘ – sozusagen ,gleichgültig‘ gegenüber dem Dasein als einem solchen󰀄󰀈 –, so ist das in der Umwelt Lebende – das wirklich Lebende, dem allein die ansichlose Welt an sich erschließt – eben durch dasjenige Prinzip gekennzeichnet, das Heidegger in den früheren Freiburger Vorlesungen ,Bekümmerung‘ nennt: ,Alle Wirklichkeit erhält ihren ursprünglichen Sinn durch die Bekümmerung des Selbst‘.󰀄󰀉 In Sein und Zeit taucht dieser Begriff bekanntlich als die ,Sorge‘ (cura) wieder auf.󰀅󰀀 Aber schon im Wintersemester 󰀁󰀉󰀂󰀁/󰀂󰀂 schreibt Heidegger Entsprechendes in seiner Vorlesung Phänomenologische Interpretationen zu Aristoteles: Leben, im verbalen Sinne genommen, ist nach seinem Bezugssinn zu interpretieren als Sorgen; sorgen für und um etwas, sorgend von etwas leben. Mit diesem Charakter ist nicht gemeint, daß das Leben immer mit einer Leichenbittermiene umginge. Im 󰀄󰀈. Zu der für die idealistische Metaphysik kennzeichnenden These der ,Gleichgültigkeit‘ des Wesentlichen gegenüber dem Dasein als einem solchen siehe Andrés Quero-Sánchez, Über das Dasein. Albertus Magnus und die Metaphysik des Idealismus (Stuttgart, 󰀂󰀀󰀁󰀃), 󰀇󰀄-󰀆; 󰀂󰀈󰀇-󰀉󰀃. 󰀄󰀉. Vgl. M. Heidegger, Phänomenologie der Anschauung und des Ausdrucks, ed. Cl. Strube (󰀁󰀉󰀉󰀃), 󰀁󰀇󰀃,󰀁󰀃-󰀂󰀀; 󰀁󰀇󰀃,󰀃󰀄-󰀁󰀇󰀄,󰀂󰀀: ,Das Selbst im aktuellen Vollzug der Lebenserfahrung, das Selbst im Erfahren seiner selbst ist die Urwirklichkeit. Erfahrung ist nicht Kenntnisnehmen, sondern das lebendige Beteiligtsein, das Bekümmertsein, so daß das Selbst ständig von dieser Bekümmerung mitbestimmt ist. – Umwelt, Mitwelt und Selbstwelt sind keine Seinsbereiche, nicht bestimmt in irgendetwas. Alle Wirklichkeit erhält ihren ursprünglichen Sinn durch die Bekümmerung des Selbst. [...]. Diese Bedeutsamkeit des Vollzugs muß uns bekümmern, und die Destruktion dieser Bedeutsamkeit muß rein erhalten werden und gesichert werden vor Umfall in die Sachlichkeit. [...]. // Die Philosophie hat die Aufgabe, die Faktizität des Lebens zu erhalten und die Faktizität des Daseins zu stärken. Philosophie als faktische Lebenserfahrung bedarf eines Motivs, wo die Bekümmerung um die faktische Lebenserfahrung selbst verbleibt. Das bezeichnen wir als philosophische Grunderfahrung. [...]. Sie ist keine besondere Erleuchtung, sondern in jedem konkreten Dasein möglich, wo die Bekümmerung sich auf das aktuelle Dasein zurückbringt. [...]. Die Strenge der Philosophie ist ursprünglicher als alle wissenschaftlicueh Strenge. Sie ist eine über alle wissenschaftliche Strenge hinausgehende Explikation, das Bekümmertsein in seiner ständigen Erneuerung in die Faktizität des Daseins zu erheben und das aktuelle Dasein letztlich unsicher zu machen‘. Der Zusammenhang von ,Ursprünglichkeit‘ und ,Unsicherheit‘ ist insbesondere für Nietzsches Philosophie kennzeichnend, welche der gerade zitierten Passage wiederum zugrunde liegt. Zum Thema siehe neuerdings Quero-Sánchez, ,Einsam die straße zu ziehn‘ (󰀂󰀀󰀁󰀄), Abschnitt B.󰀂: ,Die Bodenständigkeit des ,letzten Menschen‘‘. 󰀅󰀀. Vgl. M. Heidegger, Sein und Zeit, ed. von Fr.-W. von Herrmann, in Gesamtausgabe, Bd. 󰀂 (Frankfurt a.M., 󰀁󰀉󰀇󰀇), 󰀂󰀄󰀀-󰀃󰀀󰀅 (,Die Sorge als Sein des Daseins‘).

E IN ‚ EWIG U NWIDERLEGBARES ‘

󰀂󰀁󰀃

ausgelassenen Taumel, in der Gleichgültigkeit, in der Stagnation – wie immer ist „Leben“ charakterisiert als sorgen. Worauf und warum das Sorgen ist, woran es sich hält, ist zu bestimmen als Bedeutsamkeit. Bedeutsamkeit ist eine kategoriale Determination von Welt; die Gegenstände einer Welt, die weltlichen, welthaften Gegenstände sind gelebt im Charakter der Bedeutsamkeit.󰀅󰀁 Das sorglose, sich an dem rein logischen Wesen interessierende (!) theoretische Verhalten sei, so schreibt Heidegger 󰀁󰀉󰀂󰀀, nichts Anderes als ,ein Lebendiges für die Toten, die es sich leicht gemacht haben‘.󰀅󰀂 Denn das Leben – das ansichlose Leben, das das Leben an sich ist – ist – an sich – schwer; man muss sich ständig um es kümmern, man ist ständig um etwas oder gar um Vieles besorgt. In der Schwere der alltäglichen Bekümmerung um das Viele gibt sich sie uns: die Welt.󰀅󰀃 Beim Theoretiker, beim Platoniker, hingegen, so heißt es ausdrücklich, ,schläft die Sorge‘.󰀅󰀄 Und Heidegger kann dies wunderschön ironisch ausdrücken: ,Am bequemsten ist es allerdings, sich außerhalb der Welt und des Lebens gleich ins Land der Seligen und des Absoluten zu setzen. Ich verstehe nur nicht, warum man dann überhaupt noch philosophiert, wenn man schon „soweit“ ist‘.󰀅󰀅 󰀅󰀁. Martin Heidegger, Phänomenologische Interpretationen zu Aristoteles. Einführung in die phänomenologische Forschung (󰀁󰀉󰀂󰀁/󰀂󰀂), ed. von W. Bröcker und K. Bröcker-Oltmanns, in Gesamtausgabe, Bd. 󰀆󰀁 (Frankfurt a.M., 󰀁󰀉󰀈󰀅; ²󰀁󰀉󰀉󰀄), 󰀉󰀀,󰀂-󰀁󰀂. Siehe auch ibid., 󰀉󰀀,󰀃󰀂-󰀉󰀁,󰀁󰀄; id., Ontologie (Hermeneutik der Faktizität) (󰀁󰀉󰀂󰀃), ed. von K. Bröcker-Oltmanns, in Gesamtausgabe, Bd. 󰀆󰀃 (Frankfurt a.M., 󰀁󰀉󰀈󰀈), 󰀈󰀅,󰀂󰀉-󰀈󰀆,󰀂: ,[...] die Welt als das Besorgte; sie ist „da“ im Wie des Besorgtseins. Unmittelbarer Da- und Begegnischarakter des Besorgtseins. Als Besorgtes ist die Welt da als Umwelt, Umhaftes‘. 󰀅󰀂. Vgl. M. Heidegger, Phänomenologie der Anschauung, ed. Cl. Strube (󰀁󰀉󰀉󰀃), 󰀁󰀄󰀂,󰀃󰀂-󰀁󰀄󰀃,󰀈. 󰀅󰀃. Vgl. ibid., 󰀁󰀄󰀂,󰀂-󰀁󰀆: ,Die Situation des Sicheinstellens, des In-die-Einstellung-gehens, die Einstellung ist Hingabe an eine Aufgabe, an die Sache als Sache. Die Einstellung ist Vollzug einer Selbstwelt, aber gerade ein solcher, daß in ihm der Bezug gerade selbstweltunbekümmert ist. Einstellung ist Wegstellung von der Selbstwelt. Sie ist leicht, weil sie der selbstweltlichen Bekümmerung enthoben ist, sich ihrer selbst enthebt, einer Bekümmerung, die schwer ist. Diese „Leichtigkeit“ und „Schwere“ sind spezifisch selbstweltliche Daseinsbegriffe. Es ist typisch für das heutige Leben und seine Beherrschtheit durch das Theoretische, daß man gerade die wissenschaftliche und sonstige Sachlichkeit als das Schwierigste ausgibt, die selbstweltliche Bekümmerung leicht nimmt und sich abnehmen läßt durch ein Gebildetsein und ein Darum-wissen, oder daß man sie überhaupt nicht ernst nimmt‘. 󰀅󰀄. Vgl. id., Ontologie (Hermeneutik der Faktizität), ed. K. Bröcker-Oltmanns (󰀁󰀉󰀈󰀈), 󰀁󰀀󰀃,󰀁󰀄-󰀆: ,In diesem nivellierten Da der besorgenden Sorglosigkeit, in dem die Welt als Selbstverständlichkeit begegnet, schläft die Sorge‘. 󰀅󰀅. M. Heidegger, Phänomenologische Interpretationen zu Aristoteles, ed. W. Bröcker und K. Bröcker-Oltmanns (󰀁󰀉󰀈󰀅; ²󰀁󰀉󰀉󰀄), 󰀉󰀉,󰀃󰀂-󰀅.

󰀂󰀁󰀄

A NDRÉS Q UERO -S ÁNCHEZ

Die ,Bekümmerung‘ gibt also dem im Grunde vortheoretischen, p ragm at ischen und damit ansichlosen Ansich des Lebens und überhaupt der Um-Welt Ausdruck, welche durch Relationalität oder gar Relativität konstituiert wird und damit durch das Ausschließen jeglicher Form von Absolutheit: Die intransitiv-verbale Bedeutung „leben“ expliziert sich, konkret vergegenwärtigt, selbst immer als „in“ etwas leben, „aus“ etwas leben, „für“ etwas leben, „mit“ etwas leben, „gegen“ etwas, „auf“ etwas „hin“ leben, „von“ etwas leben. Das „etwas“, was seine Beziehungsmannigfaltigkeit zu „leben“ anzeigt in diesen scheinbar nur gelegenheitlich aufgerafften und aufgezählten präpositionalen Ausdrücken, fixieren wir mit dem Terminus „Welt“.󰀅󰀆 Es sei doch gerade die Suche nach dem Absoluten, dem Unbedingten – also die theoretische Einstellung im Sinne Husserls und Rickerts – dasjenige, was alles verdingliche, wohingegen der alltägliche, praktische Umgang mit all dem, was im Lichte eines Sinnzusammenhangs aufeinander bezogen ist und eben in solcher Bezogenheit eine situationsgebundene Bedeutung erhalte, die Welt in deren Ursprünglichkeit sein lasse. Denn die Welt und überhaupt die Wahrheit ist eben, so Heidegger ausdrücklich, ,etwas Historisches, d.h. dem Dasein verhaftet [...], kein außerzeitliches chimärisches Ansich‘.󰀅󰀇 Ohne Zeit also, kein Sein; wenn man so will: Sein und Zeit; oder auch: Sein und ,Da‘ – sprich: Da-Sein. Allein im ,Da‘ ,gilt‘ nach Heidegger also das ,Geltende‘, welches gerade deshalb kein absolut Irreales besagt, sondern ein im konkreten Leben je nach Situation und Lage jeweils anders realisiertes – und somit zugleich reales – Irreales: ein ,Weltendes‘. Ausdrücklich betont Heidegger in den früheren Freiburger Vorlesungen immer wieder, dass das von der theoretischen Einstellung ,ausgeschaltete‘, ,zurückgedrängte‘ oder ,beiseitegestellte,‘ ,konkrete‘ oder ,aktuelle Dasein‘ für die Phänomenologie zurückzugewinnen sei; wie es heißt: ,der Vollzug in seiner faktischen Konkretion nach der Seite der Konkretion in ihrem Jetzt, Hier und So‘.󰀅󰀈 Und dabei 󰀅󰀆. Ibid., 󰀈󰀅,󰀂󰀁-󰀈. Siehe auch id., Ontologie (Hermeneutik der Faktizität), ed. K. BröckerOltmanns (󰀁󰀉󰀈󰀈), 󰀉󰀃,󰀂󰀂-󰀉; ibid., 󰀉󰀀,󰀁󰀁-󰀉󰀁,󰀁󰀅; ibid., 󰀉󰀅,󰀁󰀅-󰀂󰀆; ibid., 󰀉󰀇,󰀁󰀈-󰀂󰀇. 󰀅󰀇. Ibid., 󰀈󰀃,󰀅-󰀇. 󰀅󰀈. Vgl. M. Heidegger, Phänomenologie der Anschauung und des Ausdrucks, ed. Cl. Strube (󰀁󰀉󰀉󰀃), 󰀆󰀃,󰀁󰀁-󰀂󰀆: ,Das ist nicht nur trivial, sondern für die eigentlich philosophische Betrachtung

E IN ‚ EWIG U NWIDERLEGBARES ‘

󰀂󰀁󰀅

geht es um ,jeweiliges Dasein‘, was Heidegger erst Jahre später, in Sein und Zeit, ,jemeiniges‘ Dasein nennen wird.󰀅󰀉 Das Ursprüngliche ist also gerade nicht das Unbedingte, sondern das durch die jeweilige Situation Bedingte. Wir erinnern uns am Heideggers Novalis-Motto zum nachträglichen Schlusskapitel der Habilitationsschrift, das ich zu Beginn meiner Ausführungen bereits zitiert habe: ,Wir suchen überall das Unbedingte, und finden immer nur Dinge‘.󰀆󰀀 Dabei gebraucht Heidegger den Ausdruck ,Ding‘ in derselbe Bedeutung, die für Novalis selbst charakteristich ist, welche sicherlich von der Bestimmung von Schelling in dessen Abhandlung Vom Ich als Prinzip der Philosophie aus dem Jahre 󰀁󰀇󰀉󰀅 abhängig ist: ,Ding‘ ist dabei das ,Be-dingte‘, als dasjenige nämlich, das durch irgendwelche ,Be-dingungen‘ eben zum ,Ding‘ gemacht – sprich: verdinglicht – wird.󰀆󰀁 ,Wir Phänomenologen sogar belanglos, sofern für sie der aktuelle faktische Vollzug des „empirischen“, „faktischen“, „psychologischen“ oder „anthropologischen“ Subjekts, d.h. der Vollzug in seiner faktischen Konkretion nach der Seite der Konkretion in ihrem Jetzt, Hier und So ausgeschaltet wird. In der Sphäre der theoretischen Akte und Aktvollzüge handelt es sich nicht um einen konkreten Urteilsvollzug, sondern um das urteilende Bewußtsein überhaupt, die reine Form des Urteilens. Man sieht nicht, daß hier der Vollzug bereits ausgeschaltet ist mit der formalen Betrachtung; alles andere ist Psychologismus und führt aus der Philosophie heraus in empirische Tatsachenfeststellung. Man hat mit der Bekämpfung des Anthropologischen auch alle Existenzprobleme, obschon sie etwas wesenhaft anderes sind, von neuem aus der Philosophie verdrängt‘. Siehe auch ibid., 󰀁󰀇󰀀,󰀇-󰀂󰀆. 󰀅󰀉. Vgl. id., Sein und Zeit, ed. Fr.-W. von Herrmann (󰀁󰀉󰀇󰀇), 󰀅󰀇,󰀆-󰀁󰀃. Schon im Jahre 󰀁󰀉󰀂󰀃 sprach Heidegger, Ontologie (Hermeneutik der Faktizität), ed. K. Bröcker-Oltmanns (󰀁󰀉󰀈󰀈), 󰀈󰀅,󰀆, vom jeweiligen Dasein in eben diesem Sinne: ,Dasein ist, was es ist, in seiner Jeweiligkeit‘. Vgl. ibid., 󰀇,󰀄-󰀁󰀂: ,Faktizität ist die Bezeichnung für den Seinscharakter „unseres“ „eigenen“ Daseins. Genauer bedeutet der Ausdruck: jeweilig dieses Dasein (Phänomen der „Jeweiligkeit“; vgl. Verweilen, Nichtweglaufen, Da-bei-, Da-sein), sofern es seinsmäßig in seinem Charakter „da“ ist. [...]. [...], Dasein ist ihm selbst da im Wie seines eigensten Seins‘; ibid., 󰀂󰀉,󰀂󰀄f.; ibid., 󰀄󰀈,󰀃-󰀅. 󰀆󰀀. Siehe oben, 󰀁󰀉󰀉. 󰀆󰀁. Vgl. Friedrich Wilhelm Joseph Schelling, Vom Ich als Princip der Philosophie oder über das Unbedingte im menschlichen Wissen, in Werke, Ed. der Bayerischen Akademie der Wissenschaften, Bd. 󰀂, hg. von H. Buchner und J. Jantzen (Stuttgart, 󰀁󰀉󰀈󰀀), 󰀈󰀉,󰀁󰀅-󰀂󰀅: ,Die philosophische Bildung der Sprachen, die vorzüglich noch an den ursprünglichen sichtbar wird, ist ein wahrhaftes durch den Mechanismus des menschlichen Geistes gewirktes Wunder. So ist unser bißher unabsichtlich gebrauchtes deutsches Wort Bedingen nebst den abgeleiteten in der That ein vortrefliches Wort, von dem man sagen kann, daß es beynahe den ganzen Schaz philosophischer Wahrheit enthalte. // Bedingen heißt die Handlung, wodurch etwas zum Ding wird, bedingt, das was zum Ding gemacht ist, woraus zugleich erhellt, daß nichts durch sich selbst als Ding gesetzt seyn kann, d. h. daß ein unbedingtes Ding ein Widerspruch ist. Unbedingt nemlich ist das, was gar nicht zum Ding gemacht ist, gar nicht zum Ding werden kann‘. Novalis’ Lektüre der gerade zitierten Abhandlung Schellings ist nachweisbar; siehe Novalis’ Tagebucheintrach vom 󰀃󰀀. Juni 󰀁󰀇󰀉󰀇, in Schriften, ed. P. Kluckhohn und R. Samuel, Bd. 󰀄: Tagebücher, Briefwechsel, Zeitgenössische Zeugnisse, hg. von R. Samuel in Zusammenarbeit mit H.-J. Mähl und G. Schulz. Zweite, unveränderte Auflage (Stuttgart, Berlin und Köln, 󰀁󰀉󰀉󰀈), 󰀄󰀈,󰀃󰀃-󰀄󰀉,󰀁: ,Gestern Abend im Bett errinnerte ich mich lebhaft an Sofie. Heute fuhren

󰀂󰀁󰀆

A NDRÉS Q UERO -S ÁNCHEZ

suchen also überall das Absolute – das Logische, das Wesen, das Irreale, das Daseinlose, das Unbedingte –, aber das Wahre, das Ursprüngliche – wenn man so will: das Ansich – ist nichts als eben das Bedingte‘. An sich ist das Wahre also kein Ansich; das Absolute oder Unbedingte ein (jeweils anders) Bedingtes; das Logische, das Wesentliche, ja das Daseinlose ein (jeweils anders) Daseiendes; das Irreale ein (jeweils anders) Reales. Heideggers Philosophie ist in diesem Sinne ein Aufruf zur Endlichkeit, und zwar als zu dem einzig möglichen Weg zur Annahme des (jeweils anders) sich selbst gebenden Unendlichen. 󰀅. Heideggers Missverständnis der Spekulativen Grammatik des Thomas von Erfurt Bei Heideggers Deutung des Traktats De modis significandi des Thomas von Erfurt spielt der Begriff des Logischen nun die zentrale Rolle. Im ersten Abschnitt der Habilitationsschrift bietet Heidegger eine Darlegung der Metaphysik des Duns Scotus an, und zwar als Grundlage für die im zweiten Abschnitt durchgeführte Auslegung des genannten Traktats. Bestimmte Momente der Darlegung Heideggers sind sicherlich treffend, etwa wenn er Scotus‘ Interesse für Individualität und überhaupt für Konkretheit betont, welches, so heißt es ausdrücklich, zu den ,unverkennbar modernen Zügen‘ seiner Metaphysik gehöre.󰀆󰀂 ,Was real existiert‘, so fasst Heidegger die Position des Scotus diesbezüglich zusammen, ist ein Individuelles. [...]. Individuum besagt: Bestimmtheit als diese einzigartige, sonst nie und nirgends antreffbare, der es wesensmäßig widerstrebt, noch weiter in selbständige qualitative Momente zerlegt zu werden. Das Individuelle [...] bedeutet den realen Gegenstand κατ᾿ ἐξοχήν prout includit existentiam et tempus. Zwei Äpfel an demselben Baum haben nicht denselben „Hinblick“ zum Himmel, jeder ist vom anderen, möchten sie wir nach Dürrenberg. Nachmittags blättert ich in Schellings Ich und gieng nachher spatziern‘. Den Zusammenhang zwischen ,Ding‘ und ,be-dingt‘ wird auch von Heidegger selbst bei Gelegenheit bemerkt; vgl. M. Heidegger, Die Idee der Philosophie, ed. B. Heimbüchel (󰀁󰀉󰀈󰀇), 󰀆󰀆,󰀃-󰀈: ,Es darf sich in das Wort Motiv kein Mißverständnis hineinschleichen. Motive heraushören besagt nicht, nach Ursachen des Entstehens, nach Be-dingungen, Dingen suchen, die das Erlebnis als Ding und Verdinglichtes erklären, d.h. in einen Sachzusammenhang hineinstellen. Verstehen sollen wir die reinen Motive des Sinnes des reinen Erlebnisses‘. 󰀆󰀂. Vgl. M. Heidegger, Kategorien- und Bedeutungslehre, ed. F.-W. von Herrmann (󰀁󰀉󰀇󰀈), 󰀂󰀀󰀃,󰀅-󰀁󰀆.

E IN ‚ EWIG U NWIDERLEGBARES ‘

󰀂󰀁󰀇

sonst vollständig sich gleichen, durch seine räumliche Bestimmtheit schon verschieden. Alles, was real existiert, ist ein „Solches-Jetzt-Hier“. Die Form der Individualität (haecceitas) ist dazu berufen, eine Urbestimmtheit der realen Wirklichkeit abzugeben.󰀆󰀃 Zugleich will Heidegger jedoch Scotus‘ Bestimmung des esse in anima oder des esse rationis, also des gedachten oder vorgestellten Seins der Dinge in der erkennenden Seele, welches Scotus, wie die spätmittelalterliche Scholastik überhaupt, im Unterschied zum esse in rerum natura als zum realen Sein der natürlichen Dinge auffasst,󰀆󰀄 im Sinne des für die Phänomenologie Husserls und die Erkenntnistheorie Rickerts charakteristischen Logischen verstehen: als den ,geltenden Sinn‘ nämlich, der als solcher völlig unabhängig vom realen Dasein I s t (ist; gilt). Das Mittelalter bezeichnet das ens in anima oder das ens rationis als ens diminutum, ein ,vermindertes Seiendes‘, da sein Wirklichkeitsgrad im Vergleich zu dem des realen Seins der natürlichen Dinge außerhalb der Seele – wie ohnehin auch im Vergleich zum Sein des Dinges im Sinne des esse essentiae –, ,geringer‘ ist.󰀆󰀅 Heidegger deutet den Ausdruck jedoch im positiven Sinne: Das gedachte Seiende habe insofern ein vermindertes Sein, als es kein bloß reales Sein habe, sondern – ähnlich wie das Logische nach der Charakterisierung des Habilitationsbetreuers Rickert – ein Irreales angehe: Das ens logicum wird ferner charakterisiert als ein ens diminutum; es bedeutet gegenüber der realen Naturwirklichkeit eine herabgeminderte Art des Seins und gehört deshalb nicht in das Gegenstandsgebiet der Metaphysik, die unstreitig eine Realwissenschaft 󰀆󰀃. Ibid., 󰀂󰀅󰀂,󰀂󰀇-󰀂󰀅󰀃,󰀁󰀂. Vgl. Johannes Duns Scotus (!), Quaestiones disputatae de rerum principio sive Quaestiones universales in philosophiam, q. 󰀁󰀃, art. 󰀂, in Opera omnia. Editio nova, Bd. 󰀄 (Paris, 󰀁󰀈󰀉󰀁 [Nachdruck Farnborough, 󰀁󰀉󰀆󰀉]), 󰀅󰀀󰀂a,󰀃󰀈-󰀄󰀀: sicut etiam duo poma in una arbore nunquam habent eundem aspectum ad cœlum. Es handelt sich dabei eigentlich um ein Werk des Franziskaners Vitalis de Furno (ca. 󰀁󰀃󰀆󰀀-󰀁󰀃󰀂󰀇); vgl. R. Schönberger, A. Quero-Sánchez, Br. Berges und L. Jiang (Hgg.), Repertorium edierter Texte des Mittelalters aus dem Bereich der Philosophie und angrenzender Gebiete (Berlin, ²󰀂󰀀󰀁󰀁), Bd. 󰀃, 󰀃󰀉󰀇󰀀-󰀂 (nn. V󰀁󰀁󰀅󰀀), 󰀃󰀉󰀇󰀁b (n. V󰀁󰀁󰀅󰀀-󰀅󰀀). 󰀆󰀄. Vgl. A. Quero-Sánchez, Über das Dasein (󰀂󰀀󰀁󰀃), 󰀁󰀈󰀆-󰀇; 󰀂󰀉󰀀-󰀃; 󰀅󰀄󰀂-󰀄. Das esse essentia Heinrichs von Gent ließe sich sicherlich im Sinne des esse logicum der Husserlschen Phänomenologie verstehen, nicht jedoch das esse in anima oder das esse cognitum; siehe ibid., 󰀇󰀇-󰀈󰀀. 󰀆󰀅. Zum Ausdruck ‚ens diminutum‘, der auf eine falsche Übersetzung von Aristoteles‘ Metaphysik, 󰀁󰀀󰀂󰀇b󰀃󰀃, zurückzuführen sei, siehe Armand Maurer, ,Ens diminutum: A Note on its Origin and Meaning‘, Mediaeval Studies 󰀁󰀂 (󰀁󰀉󰀅󰀀), 󰀂󰀁󰀆-󰀂󰀂. Siehe noch A. Quero-Sánchez, Über das Dasein (󰀂󰀀󰀁󰀃), 󰀅󰀄󰀂-󰀄.

󰀂󰀁󰀈

A NDRÉS Q UERO -S ÁNCHEZ

ist. Nicht uninteressant ist, nebenbei bemerkt, ein Vergleich dieser Bezeichnung ens diminutum für das Logische mit einer modernen: Rickert nennt den logischen Sinn das „Unwirkliche“. Duns Scotus sagt sogar ausdrücklich, das logische Sein habe nicht die Wirklichkeit der realen Existenz, und deshalb sei auch auf diesen Bereich die Kategorie der „Kausalität“ nicht anwendbar.󰀆󰀆 Nach Heidegger habe Scotus (!) im Traktat De modis significandi die Bedeutungen und überhaupt die verschiedenen Bedeutungsmodi als logi s che Entitäten im Sinne des Rickertschen Irrealen oder des phänomenologischen Wesens verstanden: Die Bedeutung gibt sich sonach als losgelöst von Realitäten; Existenzfragen bezüglich der bedeuteten Gegenstände sind etwas der Lehre von den Bedeutungen Transzendentes. [...]. Es ist, sagt Duns Scotus ausdrücklich, der Bedeutung völlig fremd, zu existieren (res ut untelligitur, cui extraneum est existere secundum quod significatur). Dieser Gedanke ist prinzipiell und wichtig genug, um ihn ganz zu Ende zu denken. Duns Scotus lehrt die Existenzfreiheit des Bedeutungsbereiches.󰀆󰀇 Wir erinnern uns an die bereits zitierten Worte Husserls, nach denen die Phänomenologie ,nur Wesensforschung und gar nicht Daseinsforschung‘ sei.󰀆󰀈 Ja, gerade deshalb habe Duns Scotus keine Abbildtheorie der Sprache vertreten können. ,Die Abbildtheorie‘, so Heidegger bei seiner Darlegung der Bedeutungslehre des Scotus (!) im Traktat De modis significandi, bietet hier eine unüberwindliche Schwierigkeit. Konsequenterweise gibt Duns Scotus diese Theorie auf und entscheidet sich 󰀆󰀆. Vgl. M. Heidegger, Kategorien- und Bedeutungslehre, ed. F.-W. von Herrmann (󰀁󰀉󰀇󰀈), 󰀂󰀇󰀅,󰀁󰀄-󰀂󰀇󰀈,󰀁󰀆 (insbesondere 󰀂󰀇󰀆,󰀅-󰀂󰀅). Siehe noch ibid., 󰀂󰀆󰀉,󰀂󰀁-󰀅: ,das „est“ im Urteil [...] bedeutet [...] nicht etwa „existieren“, wirklichsein nach der Art der sinnlichen und übersinnlichen Gegenstände. Gemeint ist vielmehr die Wirklichkeitsweise (esse verum), für deren Bezeichnung uns heute der glückliche Ausdruck „Gelten“ zur Verfügung steht‘. 󰀆󰀇. Ibid., 󰀃󰀀󰀁,󰀁󰀂-󰀃󰀁. Siehe auch ibid., 󰀃󰀄󰀃,󰀂󰀂-󰀅. Heidegger verweist dabei auf Johannes Duns Scotus, Quaestiones in libros Perihermeneias Aristotelis, q. 󰀃 (‚Utrum facta transmutatione circa rem quae significatur, fiat transmutatio in significatione vocis‘), resp., ed. von R. Andrews, G. Etzkorn, G. Gál, R. Green, T. Noone, R. Plevano, A. Traver und R. Wood, in Opera philosophica, Bd. 󰀂 (St. Bonaventure NY, 󰀂󰀀󰀀󰀄), 󰀆󰀃,󰀆-󰀆󰀅,󰀂󰀅 (nn. 󰀁󰀀-󰀉); vgl. insbes. 󰀆󰀅,󰀂󰀂-󰀅 (n. 󰀁󰀉): ,Ad illud est facilis responsio: quia nec prius significabatur per vocem res exsistens, neque nunc res non-exsistens, sed res ut intelligitur, cui extraneum est exsistere et non-exsistere secundum quod significatur‘. 󰀆󰀈. Siehe oben, 󰀂󰀀󰀁-󰀆.

E IN ‚ EWIG U NWIDERLEGBARES ‘

󰀂󰀁󰀉

für den Immanenzgedanken. [...]. Der richtig verstandene Gedanke der Immanenz hebt die Realität nicht auf und verflüchtigt die Außenwelt nicht zu einem Traum, sondern gerade durch den absoluten Primat des geltenden Sinnes ist über alle physiologischen und psychologischen und ökonomisch-pragmatischen Erkenntnistheorien der Stab gebrochen und die absolute Geltung der Wahrheit, die echte Objektivität, unumstößlich fundiert.󰀆󰀉 Es besteht kein Zweifel daran, dass Rickert solche Sätze gerne gelesen hat. Geht man jedoch von einem solchen, dem Betreuer der Habilitation zufrieden stellenden Verständnis der Bedeutungslehre des Scotus aus, so muss die Interpretation des Traktats De modis significandi des Thomas von Erfurt notwendig fehlschlagen, nicht zuletzt deshalb, weil dieser Traktat – obwohl dies in der Forschung oft verkannt wird – sehr wohl eine Abbildtheorie der Sprache darstellt. Ja, sogar Heidegger selbst ist diese Tat s ach e i rgend w ie aufgefallen: ,Bei der im nächsten Kapitel darzustellenden Ableitung der einzelnen Bedeutungsformen aus dem Modus essendi läßt Scotus nun fast ausschließlich die reale, sinnliche Naturwirklichkeit in formdifferenzierende Funktion treten‘.󰀇󰀀 Dazu würde ich sagen: ,Eben!‘. Heideggers Einsicht bleibt jedoch eher bescheiden. Er bemüht sich vielmehr – und zwar an mehreren Stellen des Traktats – darum, eine solche zunächst befremdliche Vorgangsweise des Scotus (!) zu rechtfertigen, etwa dann, wenn es heißt: Es ist das nicht nur eine Folge seines bei allem Scharfblick für das Logische empirisch gerichteten Denkens, sondern entspringt der ganz richtigen Einsicht, daß die Bedeutungsformen ursprünglich auf die unmittelbar gegebene empirische Wirklichkeit berechnet sind.󰀇󰀁 󰀆󰀉. M. Heidegger, Kategorien- und Bedeutungslehre, ed. Fr.-W. von Herrmann (󰀁󰀉󰀇󰀈), 󰀂󰀇󰀃,󰀆-󰀁󰀉. Siehe auch ibid., 󰀂󰀇󰀀,󰀁󰀃-󰀂󰀇󰀁,󰀂: ,Die Konformität mit dem Gegenstand ist nach Duns Scotus nicht einfach als „Abbildung“, als Wiederholung dessen zu denken, was „in den Dingen liegt“, als ob die Urteilsbeziehung auch als ontologische existierte. [...] der fragliche Gehalt erhält durch das Urteil eine Formung und wird dadurch geltende Erkenntnis. In der Erkenntnis konstituiert sich das Wahre‘; ibid., 󰀂󰀈󰀁,󰀄-󰀉: ,Durch das Urteil haben wir Erkenntnis. Die einzelnen Bestandteile dieser Ordnungsform sind die Kategorien. Sie werden nicht etwa als bloße Abbilder dem realen Objektbereich entnommen. Das Reale gibt gleichsam nur den Anstoß (occasio), bietet den Ansatzpunkt für die Schaffung ordnender Beziehungen, die im Realen keine adäquate Entsprechung haben‘. 󰀇󰀀. Ibid., 󰀃󰀁󰀄,󰀁󰀄-󰀇. 󰀇󰀁. Ibid., 󰀃󰀁󰀄,󰀁󰀇-󰀂󰀁. Siehe auch ibid., 󰀃󰀁󰀄,󰀃󰀀-󰀃󰀁󰀅,󰀁󰀃; ibid., 󰀂󰀆󰀄,󰀂󰀃-󰀃󰀂; ibid., 󰀃󰀄󰀈,󰀁󰀃-󰀃󰀃.

󰀂󰀂󰀀

A NDRÉS Q UERO -S ÁNCHEZ

󰀆. Die Spekulative Grammatik des Thomas von Erfurt als averroistische Abbildtheorie der Sprache Der eben zitierte Erklärungsversuch Heidegger geht sicherlich in die richtige Richtung, er greift jedoch zu kurz. Denn Thomas’ von Erfurt Traktat De modis significandi ist eine empiristische Theorie, ja eine Abbildtheorie der Grammatik, die nicht nur die Bedeutung der einzelnen Wörter, sondern darüber hinaus auch die der verschiedenen Wortarten und sogar der syntaktischen Struktur der Sprache auf die Struktur d e r Re ali t ät selbst zurückzuführen sucht. Aber wieso nennt man eine solche Grammatik dann überhaupt ,spekulativ‘? Was hat Empirismus mit Spekulation zu tun? Bei seiner Antwort auf diese Frage verweist Darius Gabler – dem Christian Lehmann in diesem Punkt stillschweigend folgt – auf die ursprüngliche Bedeutung des lateinischen Ausdrucks speculum, ,Spiegel‘ oder eben ,Abbild‘.󰀇󰀂 Aber dieser sicherlich kluge Erklärungsversuch ist nicht richtig. In dem uns beschäftigenden Traktat sagt Thomas selbst nichts darüber, inwieweit seine Ausführungen als ,spekulative‘ Grammatik zu bezeichnen seien, anders verhält es sich jedoch mit Boethius von Dacien. In seinem Traktat De modis significandi, entstanden in Paris um 󰀁󰀂󰀇󰀀, den sowohl Eckhart als auch Thomas von Erfurt mit an der Sicherheit grenzender Wahrscheinlichkeit kennen, nennt Boethius seine Grammatik insofern eine s p e k u l a t i v e Wissenschaft, als sie eben keine p r a k t i s c h e ist, keine scientia practica, sondern speculativa: Zum dritten Punkt muss man sagen, dass die Grammatik eine spekulative Wissenschaft ist. Sie ist dennoch eine andere Wissenschaft als die Physik, die Mathematik und die Metaphysik, [und zwar] deshalb, weil sie kein wesentlicher Teil 󰀇󰀂. Vgl. Darius Gabler, Die semantischen und syntaktischen Funktionen im Tractatus ,De modis significandi sive grammatica speculativa‘ des Thomas von Erfurt. Die Probleme der mittelalterlichen Semiotik (Bern, Frankfurt a.M., New York und Paris, 󰀁󰀉󰀈󰀇), 󰀂󰀅: ,Das Adjektiv „speculativa“ ist mit Absicht verwandt worden. „Speculum“ wurde von Cicero im Sinne von „Abbild“ verstanden‘; Christian Lehmann, ,Thomas von Erfurt‘, in D. von der Pfordten (Hg.), Große Denker Erfurts und der Erfurter Universität (Göttingen, 󰀂󰀀󰀀󰀂), 󰀄󰀅-󰀇󰀃, 󰀅󰀂-󰀃: ,Diese Richtung nennt sich grammatica speculativa, „spekulative Grammatik“. Die Struktur der Sprache bildet, wenn auch mittelbar, die Struktur des Seins ab. Das lateinische Wort für „Abbild“ ist bei Cicero speculum. Eine grammatica speculativa ist also eine solche, die die sprachlichen Kategorien als Abbild der Seinskategorien erklärt. Die Kritiker des Modismus freilich, die im 󰀁󰀅. Jh. die Oberhand gewinnen, nehmen auf den pejorativen Sinn des Wortes spekulativ Bezug‘.

E IN ‚ EWIG U NWIDERLEGBARES ‘

󰀂󰀂󰀁

der Philosophie ist, sondern sie ist [nur] eine propädeutische Wissenschaft und dient der Erkenntnis der spekulativen Wissenschaften, die wesentlicher Teil der Philosophie sind. Man muss daher wissen, dass es nur drei spekulative Wissenschaften gibt, die wesentlicher Teil der Philosophie sind: Physik, Mathematik und Metaphysik.󰀇󰀃 Boethius bringt damit Antwort auf einen Einwand, den er kurz vorher wie folgt, formuliert hatte: Eine Wissenschaft ist entweder aktiv oder spekulativ. Die Grammatik ist [nun] keine aktive Wissenschaft, denn bei ihr geht es nicht um etwas, was wir durch Handeln tun. Sie ist ebenso wenig spekulativ, denn, wie Aristoteles im sechsten Buch der Metaphysik sagt, gibt es [nur] drei spekulative Wissenschaften, nämlich Physik, Mathematik und die göttliche Wissenschaft [= Metaphysik]. Nun ist es offenkundig, dass die Grammatik keine von diesen drei Wissenschaften ist; also usw.󰀇󰀄 ,Spekulativ‘ nennt man eine solche Grammatik also insofern, als sie eben nicht ,praktisch‘, nicht ,aktiv‘, ist, d.h. sie präsentiert die grammatischen Strukturen der Sprache nicht als etwas, was wir durch Handeln t u n , wenn wir reden, sondern was mit unserer Erke n n tn i s dessen, w i e e s s i c h i n d e r R e a l i t ä t v e r h ä l t , zu tun hat. Nun – gilt ein solches Verständnis auch für Thomas von Erfurt? In seiner Grammatica speculativa sagt er nichts zu diesem Thema, aber er tut es in seinem IsagogeKommentar, einem bis dato unedierten Werk, die in drei Handschriften, welche zwei voneinander verschiedene Fassungen des Werkes überliefern, erhalten geblieben ist. Die unsere Frage betreffenden Passagen, die den 󰀇󰀃. Boethius von Dacien, Modi significandi sive Quaestiones super Priscianum Maiorem, ed. von J. Pinborg und H. Roos (Kopenhagen, 󰀁󰀉󰀆󰀉) (Boethii Daci Opera, Bd. IV,󰀁), q. 󰀃,󰀆󰀃-󰀉 (󰀁󰀈): ,Ad tertium est dicendum, quod grammatica est sciencia speculativa, non tamen ipsa est naturalis nec mathematica nec divina. Et hoc quia ipsa non est essentialis pars philosophiae, sed est scientia introductoria et valet ad cognitionem scientiarum speculativarum, quae essentiales partes philosophiae sunt. Unde sciendum quod omnis scientia speculativa, quae est pars essentialis philosophiae vel est naturalis vel mathematica vel divina‘. Zitiertweise: Quaestio (mit Zeilenangaben der jeweiligen Quästio); anschließend gebe ich die Seite in Klammern an. 󰀇󰀄. Ibid., q. 󰀃,󰀁󰀀-󰀅 (󰀁󰀆): ,Omnis scientia aut est activa aut speculativa. Grammatica non est activa, quia ipsa non est de bonis agibilibus a nobis. Nec est speculativa, quia tres sunt scientiae speculativae secundum Aristotelem in VI. Metaphysicae, scilicet naturalis, mathematica et divina. Et grammatica nulla est istarum ut patet de se. Ergo et cetera‘. Vgl. Aristoteles, Metaphysica, 󰀁󰀀󰀂󰀆a󰀁󰀈-󰀉.

󰀂󰀂󰀂

A NDRÉS Q UERO -S ÁNCHEZ

Anfang des Werks konstituieren, sind unten im Anhang ediert bzw. ins Deutsche übersetzt.󰀇󰀅 Die freien Künste oder freien Wissenschaften (scientiae liberales), die als solche – als freie – von den technischen Wissenschaften (scientiae mechanicae) zu unterscheiden sind,󰀇󰀆 werden von Thomas von Erfurt, der sich dabei ausdrücklich auf Avicennas Metaphysik beruft, in praktische und spekulative Wissenschaften eingeteilt: Innerhalb der freien Wissenschaft unterscheidet man nun zwischen der praktischen und der spekulativen Wissenschaft, und zwar entsprechend ihren [voneinander verschiedenen] Zielen. Denn die praktischen Wissenschaften betreffen Gegenstände, die unser Werk sind. Und sie zielen [darüber hinaus auch] auf unser Handeln, was ich ja deshalb hinzufüge, weil es [auch] gewisse Wissenschaften gibt, deren Gegenstand [zwar] durch unser Handeln entsteht (wie es sich ja bei den Hilfswissenschaften, nämlich der Grammatik, der Logik und der Rhetorik, verhält), die dennoch nicht auf das Handeln [selbst] zielen, sondern auf die Erkenntnis, und deshalb nicht praktische, sondern [doch] spekulative Wissenschaften sind. Die spekulativen Wissenschaften betreffen nun von uns erkennbare Gegenstände und sie zielen auf unsere Erkenntnis. Diesen Unterschied findet man im ersten Buch der Metaphysik Avicennas.󰀇󰀇 Die spekulativen Wissenschaften, darunter auch die Grammatik als propädeutische Wissenschaft, haben als Ziel also die Erkenntnis dessen, wie 󰀇󰀅. Siehe unten, 󰀂󰀆󰀇-󰀃󰀀󰀃. 󰀇󰀆. Vgl. Thomas von Erfurt, Expositio Porphyrii, Einleitung, ed. von A. Quero-Sánchez (siehe unten, 󰀂󰀈󰀄,󰀁-󰀂󰀃): ,Et istae dividuntur, quia quaedam est mechanica, quae ordinatur ad supplendum defectus ex parte corporis, c uiusm od i sunt agricultura, lanificium, navigatio, venatio et caetera huiusmodi. Et dicitur a „moechor“, „moecharis“, quod est „adultero“, „adulteras“; inde „mechanica“ est idem quod adultera et vilis, quia sicut corpus et ea quae sunt corporis respectu animae sunt vilia, sic scientia mechanica est vilis respectu scientiae liberalis. Quaedam autem est liberalis, quae sic dicitur, quia hominem a curis terrenorum liberat et in amorem caelestium erigit‘. Ähnliches finden wir sowohl bei Albertus Magnus als auch bei Meister Eckhart; siehe die Diskussion in A. Quero-Sánchez, Über das Dasein (󰀂󰀀󰀁󰀃), 󰀃󰀀󰀂-󰀈. 󰀇󰀇. Thomas von Erfurt, Expositio Porphyrii, Einleitung, ed. A. Quero-Sánchez (󰀂󰀀󰀁󰀄), 󰀂󰀈󰀆,󰀁-󰀁󰀅: ,Et ista dividitur per practicam et speculativam, quae differunt penes fines earum. Quia practicae sunt de rebus quae sunt nostra opera – et sunt propter nostrum operari, quod propter hoc addo, quia quaedam sunt scientiae quae sunt de illis quae sunt nostra operatio (ut organica scientiae, scilicet grammatica, logica, rhetorica), q u a e t a m e n non sunt propter operari, sed propter scire, ideo non practicae, sed speculativae). Scientiae autem speculativae sunt de rebus a nobis speculabilibus, et sunt propter nostrum scire. Istam differentiam ponit Avicennam, primo suae „Metaphysicae“‘.

E IN ‚ EWIG U NWIDERLEGBARES ‘

󰀂󰀂󰀃

es sich in der Realität – de facto – verhält. Thomas macht also dieselbe Unterscheidung wie Boethius von Dacien, indem er nämlich innerhalb der spekulativen Wissenschaften zwischen den Hauptwissenschaften (scientiae speculativae principales) – Physik, Mathematik und Metaphysik – und den propädeutischen Wissenschaften (scientiae speculativae adminiculativae seu organicae) – Grammatik, Logik und Rhetorik – unterscheidet.󰀇󰀈 Die propädeutischen Wissenschaften sind also Werkzeuge, Instrumenta (organa), Stütze, Hilfsmittel (adminicula) für die spekulativen Hauptwissenschaften, welche sie bei ihrem Geschäft – der Erkenntnis dessen, wie es sich in der Realität de facto verhält – unterstützen: Innerhalb der [spekulativen] Hilfs- oder instrumentellen Wissenschaften unterscheidet man [nun] Grammatik, Logik und Rhetorik, die deshalb ,Hilfs- und instrumentelle Wissenschaften‘ genannt werden, weil sie uns bei der Erwerbung anderer Wissenschaften unterstützen und sozusagen Instrumente sind, die wir gebrauchen, wenn wir andere Wissenschaften erwerben. Das gilt erstens für die Grammatik, denn, wie im zweiten Buch der Metaphysik gesagt wird: ,Das Wissen, das ein jeder selbst (allein) erwirbt, ist wenig; vieles lernt man aber von anderen [Menschen]‘. Nun kann man nichts von anderen [Menschen] lernen, es sei denn man tut es mit Hilfe der grammatisch richtig geformten Rede, deren Struktur [eben] die Grammatik lehrt. Daher heißt es im ersten Buch Über die Wahrnehmung und die Gegenstände der Wahrnehmung: ,Die verständliche Rede ist das Instrument der Lehre‘; also usw.󰀇󰀉 󰀇󰀈. Vgl. ibid., 󰀂󰀉󰀀,󰀁-󰀂󰀉󰀂,󰀂󰀁: ,Scientia autem speculativa dividitur in principalem et adminiculativam. Speculativa principalis dividitur in metaphysicam, physicam et mathematicam. Metaphysica est de entibus abstractis ab omni motu et materia secundum esse et considerationem. Et licet in metaphysica multa considerentur quae sunt coniuncta motui et materiae, tamen quia principaliter sunt ibi substantiae separatae, ideo dicitur esse de abstractis et a motu et a materia secundum esse et considerationem simpliciter. Physica autem est de entibus coniunctis motui secundum esse et considerationem. Et licet abstrahat ab hac materia sensibili et ab illa, non tamen a materia sensibili simpliciter, ut homo determinat sibi compositionem qualitatum sensibilium, scilicet calidi et frigidi, humidi et sicci, non tamen hanc vel illam determinate. Mathematica autem est de entibus abstractis a materia sensibili secundum considerationem, licet secundum esse sint coniuncta materiae sensibili, ut magnitudo, linea, circulus non determinant sibi aliquam materiam sensibilem, bene talia possunt intelligi non intelligendo aliquod sensibile, nec calidum nec frigidum, etc.; ideo de sui natura sunt abstracta‘. 󰀇󰀉. Ibid., 󰀂󰀉󰀄,󰀁-󰀂󰀉󰀆,󰀁󰀀: ,Adminiculativa sive organica dividitur in grammaticam, logicam, rhetoricam, quae dicuntur „adminiculativae“ et „organicae“, quia adminiculantur et cooperantur nobis in acquisitione aliarum scientiarum, et sunt quasi organa quibus utimur alias scientias acquirendo. Quod patet primo de grammatica, quia, ut dicitur secundo „Metaphysicae“, „quod

󰀂󰀂󰀄

A NDRÉS Q UERO -S ÁNCHEZ

Damit sind wir in der Lage zu verstehen, welches Problem Thomas von Erfurt – wie vor ihm ja auch Boethius von Dacien – mit seiner Grammatica speculativa zu lösen hat. Wenn die Wissenschaft nämlich ohne Sprache weder formuliert noch mitgeteilt werden kann, dann – da es nun viele voneinander verschiedene Sprachen gibt –, muss man daraus, wie es scheint, folgern, dass es viele voneinander verschiedene, von der für die Formulierung bzw. Mitteilung der Wissenschaft jeweils gebrauchten Sprache abhängige Wissenschaften gibt. Wäre eine solche Schlussfolgerung richtig, so gäbe es nicht d i e Physik, sondern verschiedene ,Physiken‘, je nach gebrauchter Sprache: eine lateinische, eine griechische, eine deutsche Physik etwa, welche eine sprachlich anders bedingte und bestimmte Realität jeweils erschließen. Die Sprache ermöglichte uns dann keinen Zugang zu der Realität, sondern sie bestimmte die jeweils partikuläre – sprich: der jeweiligen Sprache gehörigen – Realität und verhindere eben dadurch die Erkenntnis derselben, wie sie a n s i ch ist. Um ein solches Problem zu umgehen, müsste man zeigen, dass es – erstens – eine Universalsprache, eine Universalgrammatik gibt, welche – zweitens – die ontologischen Strukturen der Realität selbst widerspiegelt oder – eben – abbildet. Und genau das streben sowohl Boethius von Dacien als auch Thomas von Erfurt an. Thomas geht freilich bei seiner Diskussion von dem modus significandi act ivu s aus, aber das bedeutet keineswegs, dass er die Grammatik und überhaupt die Sprache als ein Instrument auffasst, mit welchem wir etwas – etwa Dinge oder überhaupt Realität – handelnd hervorbringen. Die Grammatik ist ja, wie wir gesehen haben, keine scientia practica, sondern speculativa. Aber was ist dann der modus significandi activus? Er ist nach Thomas jedenfalls von dem modus significandi passivus zu unterscheiden. Diese Unterscheidung lässt sich am besten verstehen, wenn man von der doppelten Gebrauchsweise des Verbs significare im Lateinischen ausgeht. Der Ausdruck ,Hund‘ etwa significat ein durch bestimmte Eigenschaften und Verhaltensweisen charakterisiertes Tier. Das ist der modus significandi passivus: die Bedeutung nämlich e i n e s s p r a c h l i c h e n A u s d r u c k e s . Ich kann aber im Lateinischen auch quilibet p e r s e i p s u m d e s c i e n t i a invenit, modicum est, multum autem ab alio addiscit“. Sed aliquis ab alio addiscere non potest, nisi per sermonem congruum, cuius constitutionem docet grammatica. Unde in primo „De sensu et sensato“: „Sermo bene audibilis instrumentum est doctrinae“; ergo etc.‘

E IN ‚ EWIG U NWIDERLEGBARES ‘

󰀂󰀂󰀅

sagen: Durch den Ausdruck ,Hund‘ significamus ein durch bestimmte Eigenschaften und Verhaltensweisen charakterisiertes Tier. Und das ist der modus significandi activus: die Bedeutung nämlich, die w i r einem sprachlichen Ausdruck g e b e n , damit er dann selbst etwas bedeutet, d.h. das, was w ir durch einen sprachlichen Ausdruck m e i n e n oder z u v e rs t e h e n geben: Der aktive Modus des Bedeutens besagt ein Modus oder eine Eigenschaft des sprachlichen Ausdrucks, welche diesem vom [menschlichen] Denken verliehen wird und durch welche der sprachliche Ausdruck [dann selbst] eine Eigenschaft eines realen Dinges bedeutet. Der passive Modus des Bedeutens ist [nun] ein Modus oder eine Eigenschaft eines realen Dinges, insofern sie Bedeutung eines sprachlichen Ausdrucks ist.󰀈󰀀 Die Bedeutung nun – und zwar sowohl diejenige, die d e r Au s d r u c k h a t , als auch diejenige, die w i r durch den Ausdruck zur Sprache b r i n gen (was wir nämlich durch den Ausdruck zu verstehen geben oder m e i ne n) – bezieht sich unmittelbar auf ein Gedachtes oder Vorgestelltes, was Thomas ja als modus intelligendi passivus bezeichnet,󰀈󰀁 󰀈󰀀. Thomas von Erfurt, Tractatus de modis significandi siue Grammatica speculativa, ed. von M. Fernández García, in Lexicon Scholasticum philosophico-theologicum, in quo termini, definitiones, distinctiones et effata seu axiomaticae propositiones philosophiam ac theologiam spectantes a B. Ioanne Duns Scoto Doctore Subtili atque Mariano O.F.M. exponuntur, declarantur opera et studio R. P. Mariani Fernandez Garcia O.F.M. (Ad Claras Aquas, 󰀁󰀉󰀁󰀀 [Nachdruck: Hildesheim und New York, 󰀁󰀉󰀇󰀄]), c. 󰀁, n. 󰀃,󰀅-󰀁󰀁 (󰀁b): ,Modus significandi activus est modus, sive proprietas vocis, ab intellectu sibi concessa, mediante qua, vox proprietatem rei significat. – Modus significandi passivus est modus, siue proprietas rei, prout est per vocem significata‘. In seiner Ausgabe übernimmt Fernández García den Text der Edition von L. Wadding, mit verschiedenen, nicht eigens begründeten Veränderungen; vgl. Johannes Duns Scotus, Opera omnia, ed. von L. Wadding (Lyon, 󰀁󰀆󰀃󰀉 [Nachdruck: Hildesheim (mit einem Vorwort von T. Gregory), 󰀁󰀉󰀆󰀈]), Bd. I, 󰀃󰀉-󰀇󰀆. Die Ausgabe von Fernández García zitiere ich nach Kapitel und Nummer, mit Zeilenangabe, welche sich auf die Zeileanordnung innerhalb der jeweiligen Nummer bezieht und die Edition freilich nicht ausdrücklich anführt. Anschließend und in Klammern gebe ich die Seite (mit Spalte: a bzw. b) an. Weder die Ausgabe von Wadding noch die von Fernández García sind kritisch. Eine neue, historisch-kritische Ausgabe des Traktats ist dringendes Forschungsdesiderat. Es gibt außerdem englische Übersetzung von G.L. Bursill-Hall: Thomas of Erfurt, Grammatica speculativa. An Edition with Translation and Commentary (London, 󰀁󰀉󰀇󰀂). Bursill-Halls Edition des lateinischen Textes ist auch keine kritische. Es gibt auch deutsche Übersetzung von Stephan Grotz, Abhandlung über die bedeutsamen Verhaltensweisen der Sprache (Tractatus de modis significandi). Aus dem Lateinischen übersetzt und eingeleitet (Amsterdam und Philadelphia, 󰀁󰀉󰀉󰀈). Ich biete im Folgenden meine eigene Übersetzung der zitierten Passagen an. 󰀈󰀁. Vgl. Thomas von Erfurt, De modis significandi, ed. M. Fernández García (󰀁󰀉󰀁󰀀), c. 󰀃, n. 󰀁󰀀,󰀈-󰀁󰀃 (󰀃a): ,Modus intelligendi activus est ratio concipiendi, qua mediante, intellectus rei proprietates significat, concipit vel apprehendit. – Modus autem intelligendi passivus est proprietas rei, prout ab intellectu apprehensa‘.

󰀂󰀂󰀆

A NDRÉS Q UERO -S ÁNCHEZ

letztlich jedoch – und das ist die Grundthese des Traktats, die auch für Boethius von Dacien entscheidend ist – auf den modus essendi, d.h. auf den r e a l e n Seinsmodus. Und dieses Prinzip gilt nicht nur für die Bedeutung der einzelnen Wörter, sondern ebenso für die Wortarten und sogar für die syntaktische Struktur der Sprache: Da solche Begriffe oder aktive Modi des Bedeutens keine Erdichtungen sind, muss jeder aktive Modus des Bedeutens von irgendwelcher realen Eigenschaft seinen Ursprung nehmen. [...]. [...] wenn das Denken einem Ausdruck eine Bedeutung im Sinne eines aktiven Modus des Bedeutens gibt, wird er dazu notwendig von irgendwelcher realen Eigenschaft bewegt. Also entspricht jedem aktiven Modus des Bedeutens irgendwelche reale Eigenschaft oder irgendwelcher reale Seinsmodus.󰀈󰀂 Eben diese These ist auch für Boethius von Dacien zentral.󰀈󰀃 Thomas von Erfurt betont in diesem Sinne, dass die reale Eigenschaft, die gedachte oder vorgestellte Eigenschaft und die vom sprachlichen Ausdruck bedeutete Eigenschaft realiter oder materialiter ein und dasselbe sind, obwohl sie sich formaliter voneinander unterscheiden: die reale Eigenschaft ist nämlich eben etwas Reales, die gedachte oder vorgestellte Eigenschaft eben etwas Gedachtes oder Vorgestelltes, die vom sprachlichen Ausdruck 󰀈󰀂. Vgl. ibid., c. 󰀂, n. 󰀆,󰀄-󰀁󰀉 (󰀂a): ,[...] cum huiusmodi rationes, sive modi significandi activi non sint figmenta, oportet omnem modum significandi activum ab aliqua rei proprietate radicaliter oriri. Quod sic patet; quia cum intellectus vocem ad significandum sub aliquo modo significandi activo imponit, ad ipsam rei proprietatem aspicit, a qua modum significandi activum originaliter trahit; quia intellectus cum sit virtus passiva, de se indeterminata, ad actum determinatum non vadit, nisi aliunde determinetur. Unde cum imponit vocem ad significandum sub determinato modo significandi activo, a determinata rei proprietate necessario movetur; ergo cuilibet modo significandi activo correspondet aliqua proprietas rei, seu modus essendi rei‘. Siehe auch ibid., c. 󰀃, n. 󰀁󰀁,󰀂-󰀁󰀁 (󰀃a); ibid., c. 󰀁󰀈, n. 󰀈󰀄,󰀉-󰀁󰀄 (󰀁󰀅a); ibid., c. 󰀂󰀅, n. 󰀁󰀁󰀀,󰀂-󰀄 (󰀂󰀁b); ibid., n. 󰀁󰀁󰀁,󰀂-󰀈 (󰀂󰀂a); ibid., c. 󰀃󰀂, n. 󰀁󰀄󰀇,󰀂-󰀈 (󰀂󰀉a); c. 󰀃󰀉, n. 󰀁󰀇󰀀,󰀁-󰀆 (󰀃󰀄ab); ibid., c. 󰀄󰀁, n. 󰀁󰀇󰀆,󰀁-󰀇 (󰀃󰀅b). 󰀈󰀃. Vgl. Boethius von Dacien, Modi significandi, ed. J. Pinborg und H. Roos (󰀁󰀉󰀆󰀉), q. 󰀁,󰀃󰀈󰀅󰀂 (󰀆-󰀇): ,Aliquis est grammaticus in habendo grammaticam. Ipsam autem nullus habere potuit ante suam generationem. Ideo qui invenit eam, non fuit grammaticus, sed erat philosophus proprias naturas rerum diligenter considerans. Modi enim significandi tam essentiales quam accidentales, tam generales quam speciales a modis intelligendi accepti sunt, et quanta est differentia inter modos significandi, tanta est differentia inter modos intelligendi, a quibus accepti sunt. Modi autem intelligendi accepti sunt a propriis modis essendi rerum. Aliter enim essent figmenta intellectus, quod non videtur possibile. Et quanta est differentia inter istos modos intelligendi, tanta necessario debet esse inter modos essendi rerum, a quibus accepti sunt. Modi autem essendi appropriati rebus diversis cognoscuntur ex propriis rerum naturis, quas per se considerare non potest grammaticus, sed metaphysicus‘. Siehe auch ibid., q. 󰀁󰀇,󰀆󰀇-󰀁󰀀󰀀 (󰀆󰀄-󰀅).

E IN ‚ EWIG U NWIDERLEGBARES ‘

󰀂󰀂󰀇

bedeutete Eigenschaft schließlich eben etwas, was Bedeutung eines sprachlichen Ausdrucks ist.󰀈󰀄 Und gerade deswegen, weil die Realität e i n e e i n z i g e komplexe Struktur aufweist, die in den verschiedenen Sprachen aufgenommen wird, gibt es – worauf insbesondere Boethius von Dacien immer wieder hinweist – i m W e s e n t l i c h e n e i n e e i n z i g e Grammatik, die allen Sprachen, welche freilich sich voneinander a kz i d e n te l l unterscheiden, zugrunde liegt. Boethius antwortet auf die in seinem Traktat De modis significandi aufgeworfene zweite Quästio (,Ob alle [verschiedenen] Sprache ein und dieselbe Grammatik haben‘) in diesem Sinne wie folgt: Alle Sprachen haben eine einzige Grammatik. Der Grund dafür liegt darin, dass, da jegliche Grammatik in den realen Dingen ihren Ursprung findet – denn sie kann keine [bloße] Erdichtung im Denken sein, und alles, was im Denken ist, ohne den realen Dingen außerhalb der Seele zu entsprechen, ist Erdichtung – und die Naturen der realen Dinge für alle Menschen dieselben sind, deshalb ist sowohl der Seinsmodus des Realen als auch der Modus des Begreifens [oder des Vorstellens] bei allen Menschen ein und derselbe, auch für die, die verschiedene Sprachen sprechen. Und folglich sind die Modi des Bedeutens ein und dieselben; und folglich auch die syntaktische Struktur und der Modus des Sprechens sind ein und dieselben.󰀈󰀅 󰀈󰀄. Vgl. Thomas von Erfurt, De modis significandi, ed. M. Fernández García (󰀁󰀉󰀁󰀀), c. 󰀄, n. 󰀁󰀂,󰀄-󰀃󰀈 (󰀃b): ,modi essendi, et modi intelligendi passivi, et modi significandi passivi, sunt idem materialiter et realiter, sed differunt formaliter; quia modus essendi est rei proprietas absolute; modus intelligendi passivus est ipsa proprietas rei, prout ab intellectu apprehensa; modus significandi passivus est eiusdem rei proprietas, prout per vocem significatur. Et sunt eadem materialiter et realiter, quia quod dicit modus essendi absolute, dicit modus intelligendi passivus, prout refertur ad intellectum; et quod dicit modus intelligendi passivus, dicit modus significandi passivus, prout refertur ad vocem; ergo sunt eadem materialiter. – Sed differunt formaliter; quod sic patet: quia qui dicit modum essendi, dicit proprietatem rei absolute, sive sub ratione existentiae; sed qui dicit modum intelligendi passivum, dicit eamdem rei proprietatem, ut materiale, et rationem intelligendi, sive concipiendi, ut formale; sed qui dicit modum intelligendi passivum, dicit eamdem rei proprietatem ut materiale, et dicit rationem consignificandi, ut formale. Et cum alia sit ratio essendi, alia intelligendi, alia significandi, differunt secundum formales rationes. // Conveniunt autem realiter; nam modus essendi dicit absolute proprietatem rei; et modus intelligendi passivus dicit proprietatem rei sub modo intelligendi; et modus significandi passivus dicit proprietatem rei sub ratione consignificandi. Sed eadem est proprietas rei, ut absolute accipitur, et sub modo intelligendi, et sub modo consignificandi‘. 󰀈󰀅. Boethius von Dacien, Modi significandi, ed. J. Pinborg und H. Roos (󰀁󰀉󰀆󰀉), q. 󰀂,󰀄󰀁-󰀉 (󰀁󰀂): ,omnia idiomata sunt una grammatica. Et causa huius est, quia cum tota grammatica accepta sit a rebus – non enim potest esse figmentum intellectus; illud enim est figmentum intellectus, cui nihil respondet in re extra animam – et quia naturae rerum sunt similes apud omnes, ideo et modi essendi

󰀂󰀂󰀈

A NDRÉS Q UERO -S ÁNCHEZ

Bekanntlich gilt Boethius von Dacien – neben Siger von Brabant – als einer der wichtigsten Pariser Averroisten des 󰀁󰀃. Jahrhunderts. Auch Thomas‘ von Erfurt Traktat De modis significandi lässt sich als ,averroistische Grammatik‘ bezeichnen, zumindest als eine im Geiste des Averroismus verfasste Grammatik. Auffällig ist es jedenfalls, dass sowohl die Physik als auch die Metaphysik des Aristoteles nach der Einteilung der Averroes-Kommentare zitiert werden.󰀈󰀆 Nun – was ist überhaupt ,Averroismus‘? Das ist eine umstrittene Frage. Die Doxographie bestimmt diesen Begriff gewöhnlich ausgehend von den Pariser Verurteilungen des Bischofs Etienne Tempier in den 󰀁󰀂󰀇󰀀er Jahren sowie vom Untertitel zweier berühmten Traktate – eines des Thomas von Aquin, eines anderen des Albertus Magnus – Contra Averroistas.󰀈󰀇 D e r Sac he n ac h ist ,Averroismus‘ jedoch im Wesentlichen Kritik am Avicennas Seinsverständnis, insbesondere an dessen These, nach der das wirkliche Sein des Dinges ein Absolutes besage, das als solches völlig unabhängig davon bestünde, ob es irgendwelches reales Ding überhaupt gäbe – sei es in anima, sei es in rerum natura –, an dem ein solches Absolutes tatsächlich festzustellen wäre.󰀈󰀈 Der Idealismus Rickerts und Husserls ist sicherlich nicht ganz entfernt von der Metaphysik Avicennas. Und dasselbe gilt für das Seinsverständnis Meister Eckharts, wie ich in meiner Habilitationsschrift zu zeigen versucht habe.󰀈󰀉 Der Averroist ist hingegen der et modi intelligendi sunt similes apud omnes illos, apud quos sunt illa diversa idiomata, et per consequens similes modi significandi, et ergo per consequens similes modi construendi vel loquendi‘. Siehe auch ibid., q. 󰀄,󰀄󰀀-󰀅󰀀 (󰀂󰀀); ibid., q. 󰀂,󰀇󰀂-󰀈 (󰀁󰀄). 󰀈󰀆. Vgl. Thomas von Erfurt, De modis significandi, ed. M. Fernández García (󰀁󰀉󰀁󰀀), Prooemium auctoris, n.󰀁,󰀁-󰀄 (󰀁a): ,Quoniam q u i d e m i n t e l l i g e r e e t s c i r e c o n t i n g i t i n o m n i scientia ex c ogn it ion e prin c ipiorum , ut scribitur I. P h ys i c o r u m text. Comment. 󰀁 [...]‘; ibid., c. 󰀂, n. 󰀉,󰀁󰀂-󰀆 (󰀂b-󰀃a): ,Iuxta quod sciendum, quod licet privationes non sint entia positiva extra animam , sunt tamen entia positiva i n a n im a , ut patet IV. M e t ap h ys i c ae text 󰀉, et sunt entia secundum animam‘. Siehe auch ibid., c. 󰀈, n. 󰀂󰀄,󰀂󰀀-󰀆 (󰀆a); ibid., n. 󰀂󰀆,󰀁󰀃-󰀇; ibid., c. 󰀂󰀄, n. 󰀁󰀀󰀇,󰀂󰀀-󰀃 (󰀂󰀁a); ibid., n. 󰀁󰀀󰀉,󰀅-󰀉 (󰀂󰀁b); ibid., n. 󰀁󰀀󰀉,󰀃󰀂-󰀄 (󰀂󰀁b); ibid., c. 󰀂󰀅, n. 󰀁󰀁󰀂,󰀂󰀃-󰀃󰀀 (󰀂󰀂ab); ibid., c. 󰀄󰀅, n. 󰀁󰀈󰀈,󰀃-󰀄 (󰀃󰀉b); ibid., c. 󰀄󰀆, n. 󰀁󰀈󰀉,󰀂󰀇-󰀃󰀂 (󰀄󰀀a); ibid., c. 󰀄󰀇, n. 󰀁󰀉󰀁,󰀁-󰀅 (󰀄󰀀ab); ibid., n. 󰀁󰀉󰀁,󰀃󰀃-󰀅 (󰀄󰀀b); ibid., c. 󰀅󰀄, n. 󰀂󰀂󰀆,󰀁-󰀁󰀂 (󰀄󰀉b). 󰀈󰀇. Siehe dazu A. Quero-Sánchez, Über das Dasein (󰀂󰀀󰀁󰀃), 󰀆󰀃󰀁, Anm. 󰀂󰀂󰀉󰀀. 󰀈󰀈. Ausführlich zu diesem Thema: Andrés Quero-Sánchez, ,Individuum, Modernität und Aufklärung im Denken Meister Eckharts und Sigers von Brabant‘, in Fr. Löser und D. Mieth (Hgg.), Religiöse Individualisierung in der Mystik: Meister Eckhart, Heinrich Seuse, Johannes Tauler, MeisterEckhart-Jahrbuch 󰀈 (Stuttgart, 󰀂󰀀󰀁󰀄), 󰀁󰀃-󰀅 Abschnitt II (,Aufklärung im Mittelalter? Der umstrittene Averroismus‘); id., Über das Dasein (󰀂󰀀󰀁󰀃), 󰀂󰀆-󰀈, 󰀁󰀉󰀂-󰀂󰀀󰀇 (hier 󰀂󰀀󰀄-󰀅: Boethius von Dacien) und 󰀆󰀃󰀁-󰀂, Anm. 󰀂󰀂󰀉󰀁. 󰀈󰀉. Vgl. A. Quero-Sánchez, Über das Dasein (󰀂󰀀󰀁󰀃), 󰀁󰀉󰀇-󰀂󰀀󰀃, 󰀂󰀇󰀇-󰀃󰀇󰀆, 󰀅󰀉󰀅-󰀆󰀀󰀂 und 󰀆󰀈󰀅-󰀇󰀀󰀄. Siehe auch id., ,Der mittelalterliche Disput zwischen Realismus und Idealismus. Meister Eckhart, Gottfried von Fontaines und Marguerite Porete‘, in D. Mieth, M.-A. Vannier, M. Vinzent and

E IN ‚ EWIG U NWIDERLEGBARES ‘

󰀂󰀂󰀉

Meinung – etwa Siger von Brabant –, dass nur dasjenige überhaupt wirklich ist, was real ist, sei es in der Seele (in anima) als Erkanntes, sei es in der Natur außerhalb der Seele (in rerum natura). Das besagt die These der Identität von Sein und Wesen, auf welche ich hier nicht eingehen kann.󰀉󰀀 Ideen sind nur dann wahr, wenn sie ein fundamentum in re – und das heißt hier: in der daseienden Realität – haben. Und das gilt – wie die Traktate De modis significandi des Boethius von Dacien und des Thomas von Erfurt zeigen – ebenso für die Sprache, und zwar nicht nur für die Semantik, sondern auch für die Syntax und überhaupt die Grammatik. 󰀇. Meister Eckhart und Thomas von Erfurt Was kann man nun über das Verhältnis Meister Eckharts zu Thomas von Erfurt sagen? Ja, was kann man über das Verhältnis d es T ho m as v on E rf urt zu Meister Eckha r t sagen? Sicherlich haben beide sich persönlich gekannt, da sie zur gleichen Zeit in Erfurt gewirkt haben, Eckhart zuletzt als Provinzial der Saxonia, von 󰀁󰀃󰀀󰀃 bis 󰀁󰀃󰀁󰀀, Thomas als Dozent in den Stiftsschulen St. Severi und St. Jakob (dem Schottenkloster) um eben diese Zeit, wo er zeitweise sogar als Rektor amtierte.󰀉󰀁 Dass Meister Eckharts Seinsverständnis nun, wie bereits erwähnt, sehr viel mit dem des Avicenna zu tun hat, haben die Forschungen der letzten Jahre gezeigt. Damit sollte zugleich klar geworden sein, dass man Eckharts Metaphysik – entgegen dem, wofür Kurt Flasch und die Autoren der so genannten ,Bochumer Schule‘ des Öfteren eingetreten sind󰀉󰀂 – C.M. Wojtulewicz (Hgg.), Meister Eckhart in Paris and Strasbourg (Leuven, 󰀂󰀀󰀁󰀇), 󰀁󰀀󰀉-󰀅󰀅, 󰀁󰀂󰀆-󰀃󰀁, Abschnitt 󰀃.󰀂 (,Die Frage nach dem Wirklichsein des Realen‘) und 󰀁󰀃󰀁-󰀄󰀃, Abschnitt 󰀃.󰀃 (,Die Frage nach dem Wirklichsein des Existenzlosen‘). 󰀉󰀀. Vgl. A. Quero-Sánchez, Über das Dasein (󰀂󰀀󰀁󰀃), 󰀁󰀉󰀂-󰀆; id., ,Der mittelalterliche Disput‘  (󰀂󰀀󰀁󰀄), 󰀁󰀂󰀈-󰀃󰀁, Abschnitt 󰀃.󰀂.󰀂 (,Gottfrieds von Fontaines averroistische Rehabilitierung der Endlichkeit des Endlichen‘); id., ,Individuum, Modernität und Aufklärung‘ (󰀂󰀀󰀁󰀄), 󰀁󰀉-󰀂󰀄, Abschnitt II.A (,Die These der Identität von Sein und Wesen‘); id., ,Über die Nichtigkeit des Gegebenen. Schellings und Hegels Verteidigung des ontologischen Arguments und der deutsche Idealismus im Spätmittelalter‘, in Bochumer Philosophisches Jahrbuch für Antike und Mittelalter 󰀁󰀄 (󰀂󰀀󰀀󰀉-󰀂󰀀󰀁󰀁): 󰀁󰀉󰀁-󰀂󰀃󰀂, 󰀂󰀀󰀂-󰀅 (,Die These der Identität von Sein und Wesen im lateinischen Averroismus‘). 󰀉󰀁. Vgl. Jan Pinborg, Die Entwicklung der Sprachtheorie im Mittelalter (Münster, 󰀁󰀉󰀆󰀇), 󰀁󰀃󰀂. Zum Verhältnis Meister Eckhart / Thomas von Erfurt siehe neuerdings Dietmar Mieth, Meister Eckhart (München, 󰀂󰀀󰀁󰀄), 󰀈󰀉-󰀉󰀈, Kap. 󰀉: ,Sprache, Exegese, Handlung: im Dienst der praktischen Metaphysik‘. 󰀉󰀂. Vgl. etwa Kurt Flasch, Die Geburt der ,deutschen Mystik‘ aus dem Geiste der arabischen Philosophie (München, 󰀂󰀀󰀀󰀆), 󰀉󰀁: ,so zeigt sich heute Eckharts Denken als originelle Fortsetzung der Linie Averroes – Albert [der Große] – Dietrich [von Freiberg]‘.

󰀂󰀃󰀀

A NDRÉS Q UERO -S ÁNCHEZ

eher als Averroismus-Kritik und überhaupt als Realismus-Kritik zu betrachten hat. Besonders deutlich wird der Unterschied zwischen dem Averroisten Thomas von Erfurt und dem von Avicennas idealistischer Metaphysik beeinflussten Meister Eckhart, wenn man die Diskussion der Wortart ,Pronomen‘ im Traktat De modis significandi mit dem vergleicht, was Meister Eckhart über dasselbe schreibt. Sagt Christus über sich selbst in Joh 󰀁󰀀,󰀁󰀄: ,Ich bin der gute Hirte‘ (ego sum pastor bonus), so bezeichnet er durch den Gebrauch der Wortart Pronomen – wenn er nämlich sagt: ,Ich‘ (ego) –, so erklärt Eckhart in seinem Johanneskommentar, die reine Substanz (mera, pura substantia), welche, so fügt Eckhart hinzu, ,auf dieser Welt [doch] nicht zu finden ist. [...]. Sie ist insofern rein, als sie keine Qualität, kein Akzidenz aufweist, zu keiner Gattung und zu keiner Art überhaupt gehört, und ist in diesem Sinne „ein Meer unendlicher Substanz“‘.󰀉󰀃 Eine solche Bestimmung der Wortart ,Pronomen‘ finden wir freilich auch bei Thomas von Erfurt, der sich allerdings ausdrücklich auf die alten Grammatiker – gemeint ist insbesondere Priscianus Caesariensis (um 󰀅󰀀󰀀 n. Chr.) – beruft. Das Pronomen bezeichne einen Gegenstand, ohne diesen durch irgendwelche Qualität zu charakterisieren, d.h. es bezeichne die reine Substanz (substantia mera): Der für das Pronomen kennzeichnende allgemeinste wesentliche Modus des Bedeutens besteht darin, dass man etwas als Seiendes und als unbestimmt Erfasstes bezeichnet. [...]. Und diesen allgemeinsten wesentlichen Modus des Bedeutens des Pronomens charakterisieren die [alten] Grammatiker, wenn sie sagen, dass „das Pronomen die reine Substanz bezeichnet, oder 󰀉󰀃. Vgl. Meister Eckhart, In Ioh., n. 󰀅󰀀󰀂 (LW III 󰀄󰀃󰀂,󰀈-󰀄󰀃󰀃,󰀁): ,Notandum quod haec quattuor verba [sc. Ego sum pastor bonus] proprie deo competunt. E g o enim meram substantiam significat, quam non est invenire in hoc mundo. Secundo, eo meram quod non dependens ab alio, sed per se et in se ipsa stans; et ab ipsa et per ipsam stant omnia. Tertio, meram sine qualitate, sine accidente, sine specie, sine genere „pelagus substantiae infinitae“‘. Siehe auch id., In Eccl. n. 󰀁󰀀 (LW II 󰀂󰀃󰀉,󰀄-󰀅; 󰀂󰀃󰀉,󰀁󰀀-󰀂󰀄󰀀,󰀃): ,li ego dicit substantiam sine omni accidente, quin immo accidens in ipsa et per ipsam transit in substantiam. [...]. Tertio relucet ex hoc, quia li e g o non significat substantiam hanc aut illam, sed substantiam meram simpliciter. Quarto quia nec substantiam significat, quae sit in genere substantiae, sed quid altius et per consequens purius, includens perfectiones omnium generum. Quinto, quia substantiae ut sic, quam li e g o significat, non est capax hic mundus nec dignus, sed solus intellectus; nec hic in quantum natura sive ens naturae, sed in quantum altius quid natura‘; ibid., n. 󰀃 (LW II 󰀂󰀃󰀈,󰀈-󰀉); ibid., n. 󰀆 (LW II 󰀂󰀃󰀅,󰀆-󰀇); ibid., n. 󰀈 (LW II 󰀂󰀃󰀅,󰀁󰀄-󰀂󰀃󰀆,󰀁); id., In Ex., n. 󰀁󰀄 (LW II 󰀂󰀀,󰀃-󰀆).

E IN ‚ EWIG U NWIDERLEGBARES ‘

󰀂󰀃󰀁

die qualitätslose Substanz“. Mit „Substanz“ meinten sie den Modus „seiend“, welche hauptsächlich [eben] für die Substanz kennzeichnend ist, wie gesagt wurde; mit „rein“ meinten sie die Qualitätslosigkeit, dass man etwas als Unbestimmtes erfasst.󰀉󰀄 Wie das Nomen, und im Unterschied zum Verb, bezeichnet das Pronomen seine Referenz – in der Regel – als etwas, was ist (als etwas Seiendes, sagt Thomas: per modum entis), nicht als etwas, was geschieht (oder getan wird).󰀉󰀅 Das Nomen bezeichnet seine Referenz nun – im Unterschied zum Pronomen – als etwas, was durch gewisse Eigenschaften bestimmt erfasst wird (per modum determinatae apprehensionis);󰀉󰀆 etwa der Name ,Hund‘, der eine Qualität, eine Seinsweise mit sich bringt, durch welche die Referenz bestimmt wird. Das Pronomen weist hingegen eben keine solche Qualität, keine Seinsweise auf. Dass für Meister Eckhart eine solche Bestimmung (!) der Wortart Pronomen entscheidend ist, steht nun außer Frage. Das belegen die oben angeführten Zitate. Das Wirkliche ist nach Eckhart genau so, wie die Wortart Pronomen es erschließt: qualitäts-, weiselos. Auch im deutschen Werk äußert er sich des Öfteren in diesem Sinne: Das Wirkliche sei sunder wîse und sunder eigenschaft.󰀉󰀇 Nun – bedeutet das nicht etwa, dass 󰀉󰀄. Thomas von Erfurt, De modis significandi, ed. M. Fernández García (󰀁󰀉󰀁󰀀), c. 󰀂󰀁 n. 󰀉󰀆,󰀁󰀈; 󰀂󰀅-󰀃󰀃 (󰀁󰀈a): ,Modus significandi essentialis generalissimus Pronominis est modus significandi per modum entis et indeterminatae apprehensionis. [...]. Et hunc modum generalissimum essentialem Pronominis Grammatici expresserunt, dicentes, Pronomen significare substantiam meram, vel substantiam s in e q ua l it a t e; dantes intelligi per substantiam modum entis, qui in substantia principaliter reperitur, ut dictum est; per meram, vel sine qualitate, modum indeterminatae apprehensionis‘. Vgl. Priscianus Caesariensis, Institutiones grammaticae, Buch XVII, n. 󰀃󰀇, ed. von M. Hertz (Leipzig, 󰀁󰀈󰀅󰀅/󰀁󰀈󰀅󰀉 [󰀂 Bde] [Nachdruck Hildesheim, 󰀁󰀉󰀆󰀁]), Bd. 󰀂, 󰀁󰀃󰀁,󰀈-󰀁󰀀: ,pronomina [...] substantiam solam sine qualitate significant‘. 󰀉󰀅. Thomas von Erfurt unterscheidet nämlich zwischen Bedeuten ,per modum entis‘ und Bedeuten ,per modum esse‘. ,Per modum esse‘ bedeutet, so sagt er, das Verb. Die verbale Form esse meint dabei nun eben den für das Verb kennzeichnenden Modus des Bedeutens, bei welchem etwas als Handlung, Tätigkeit, Geschehen oder Ereignis bezeichnet wird; vgl. Thomas von Erfurt, De modis significandi, ed. M. Fernández García (󰀁󰀉󰀁󰀀), c. 󰀈, n. 󰀂󰀄,󰀃-󰀁󰀀 (󰀆a): ,Notandum est, quod in rebus invenimus quasdam proprietates communissimas, sive modos essendi communissimos, scilicet modum entis, et modum esse. Modus entis est modus habitus et permanentis, rei inhaerens, ex hoc quod habet esse. Modus esse est modus fluxus et successionis, rei inhaerens, ex hoc quod habet fieri‘. 󰀉󰀆. Vgl. ibid., c. 󰀈, n. 󰀂󰀃,󰀂-󰀅 (󰀅b-󰀆a): ,Modus significandi essentialis generalissimus Nominis est modus significandi per modum entis, et determinatae apprehensionis‘. 󰀉󰀇. Vgl. etwa Meister Eckhart, Pr. 󰀂, ed. von G. Steer und H. Vogl, ,Die bürgelîn-Predigt Meister Eckharts. Mutmaßungen zur Entstehung der Predigt und ihrer Beziehung zu Nikolaus von Kues. Neue textgeschichtliche Ausgabe der Predigt und der lateinischen Übersetzung aus der Koblenzer Handschrift‘, in H. Schwaetzer und G. Steer (Hgg.), Meister Eckhart und Nikolaus von

󰀂󰀃󰀂

A NDRÉS Q UERO -S ÁNCHEZ

Meister Eckhart den Traktat des Thomas von Erfurt kennt und sich durch ihn hat beeinflussen lassen? Nicht unbedingt, zumal man dieselbe Bestimmung (!) des Pronomens schon bei Priscian findet, auf den Thomas von Erfurt selbst, wie wir gesehen haben, sich beruft.󰀉󰀈 Und auch Meister Eckhart kennt zweifelsohne die Institutiones grammaticae Priscians, die er gelegentlich sogar – nachweislich – zitiert.󰀉󰀉 Und natürlich stoßen wir auch bei Boethius von Dacien auf die für Priscian charakteristische Bestimmung des Pronomens, in seinem Traktat nämlich De modis significandi, der als Priscian-Kommentar (in Quästionen-Form) konzipiert ist: Man muss dennoch bemerken, dass es nicht nötig ist, dass das Pronomen irgendwelche Substanz bezeichnet, die ohne Qualität wäre – keine Substanz ist nämlich ohne Qualität (nulla enim Kues, Meister-Eckhart-Jahrbuch 󰀄 (Stuttgart, 󰀂󰀀󰀁󰀁), 󰀁󰀃󰀉-󰀂󰀅󰀉, 󰀂󰀃󰀉,󰀁󰀄󰀈-󰀅󰀄 (vgl. DW I 󰀄󰀃,󰀅-󰀄󰀄,󰀂): ‚Diz ist guot ze merkenne, wan diz einic ein daz ist sunder wîse und sunder eigenschaft. Und dar umbe bî gote: sol got iemer dar în geluogen, daz muoz in kosten alle sîne götlîche namen und sîne persônlîche eigenschaft: daz muoz er alzemâle hie vor lâzen, sol er iemer dar în geluogen. Sunder als er ist ein einvaltic ein, sunder alle wîse und sunder eigenschaft: dâ enist er vater noch sun noch heiliger geist in disem sinne und ist doch ein waz, daz enist noch diz noch daz‘. Auch Predigt 󰀂 ist im Baseler Tauler-Druck (󰀁󰀅󰀂󰀁, Nachdruck 󰀁󰀅󰀂󰀂), fol. 󰀂󰀉󰀆ra-󰀂󰀉󰀇vb, enthalten. Sie hat wohl auf diesem Wege ihren Eingang in das Werk Schellings – und somit in die Philosophie des Deutschen Idealismus überhaupt – gefunden; vgl. Schelling, Die Weltalter, Entwürfe und Fragmente zum Ersten Buch, in Die Weltalter. Fragmente. In den Urfassungen von 󰀁󰀈󰀁󰀁 und 󰀁󰀈󰀂󰀃, hg. von M. Schröter (München, 󰀁󰀉󰀄󰀆 [Nachdruck 󰀁󰀉󰀇󰀉]), 󰀂󰀁󰀄,󰀂󰀆-󰀂󰀁󰀅,󰀅: ,Lauterkeit ist, was der Mensch in allen Dingen sucht u. über alles hoch u. werth achtet. […]. Aber alles andre hat Eigenschaften, woran es erkannt u. gefaßt wird, und je mehr Eigenschaften es hat, desto faßlicher ist es. Die vollkommene Lauterkeit aber ist eben das, was übrig bleibt, wenn alle Eigenschaftigkeit abgethan ist, die reine Bloßheit; Abgeschiedenheit von allem, die an nichts hängt, das keine Berührung verträgt, gleichsam eine Jungfräulichkeit, vollkommene Einfalt der man also nicht unmittelbar sich nähern kann als durch ein völliges Aufgeben der Erkenntniß; wenn man sie nicht will ist sie da, wenn man nach ihr greift entflieht sie‘. Zu dem von Schelling dabei gebrauchten Motiv der ,Jungfräulichkeit‘ vgl. Meister Eckhart, Pr. 󰀂, ed. G. Steer und H. Vogl, ,Die bürgelîn-Predigt‘ (󰀂󰀀󰀁󰀁), 󰀂󰀁󰀉,󰀃-󰀂󰀂󰀁,󰀁󰀈 (Vgl. DW I 󰀂󰀄,󰀃-󰀂󰀆,󰀃). Zur Schellings Rezeption der ,Mystik‘ Meister Eckharts siehe Andrés Quero-Sánchez, ,Über die Nichtigkeit des Gegebenen‘ (󰀂󰀀󰀀󰀉-󰀂󰀀󰀁󰀁), 󰀁󰀉󰀁-󰀆; id., Über das Dasein (󰀂󰀀󰀁󰀃), 󰀃󰀇󰀇-󰀈󰀆; id., ,Individuum, Modernität und Aufklärung‘ (󰀂󰀀󰀁󰀄), 󰀄󰀈-󰀅󰀃, Abschnitt 󰀄 (,Idealismus und Modernität‘); id., ,Schellings neuzeitliche Repristination der „mystischen“ Vernunft – als Kritik an der „modernen Ansicht“‘, Bochumer Philosophisches Jahrbuch für Antike und Mittelalter 󰀁󰀇 (󰀂󰀀󰀁󰀄), 󰀁󰀆󰀆-󰀂󰀂󰀀; id., ,Die ›mystische‹ Voraussetzung der Identitätsphilosophie Schellings‘, Allgemeine Zeitschrift für Philosophie 󰀄󰀃 (󰀂󰀀󰀁󰀈), 󰀂󰀁-󰀄󰀈; id., ,Schellings philosophische Lektüre des Buchs von der geistigen Armut (auch Buch von der Nachfolgung des armen Lebens Christi genannt)‘, Freiburger Zeitschrift für Philosophie und Theologie 󰀆󰀂 (󰀂󰀀󰀁󰀅), 󰀂󰀄󰀀-󰀇󰀉. 󰀉󰀈. Siehe oben, 󰀂󰀃󰀀. 󰀉󰀉. Siehe die Diskussion in Andrés Quero-Sánchez, ,Das panentheistische Verständnis der „Mystik“. Meister Eckhart und Nikolaus von Kues über die Nichtigkeit des Bedingten‘, in Aufgang. Jahrbuch für Denken, Dichten, Musik 󰀆 (󰀂󰀀󰀀󰀉), 󰀈󰀆-󰀁󰀁󰀀, 󰀁󰀀󰀃-󰀄.

E IN ‚ EWIG U NWIDERLEGBARES ‘

󰀂󰀃󰀃

substantia est sine qualitate) –, sondern es bezeichnet die Substanz nicht insofern, als sie Qualität aufweist, da es ja – was seine Art und Weise des Bezeichnens angeht – von der Substanz [eben] keine Qualität bezeichnet.󰀁󰀀󰀀 Boethius betont dabei also, dass es keine Substanz gibt, welche ohne Qualität wäre (nulla enim substantia est sine qualitate). Die Ähnlichkeit mit der oben zitierten Passage Eckharts ist frappierend, da auch dieser unterstreicht, dass die qualitätslose, reine Substanz n i c h t auf dieser Welt zu finden sei (quae non est invenire in hoc mundo). Beide Autoren sagen freilich dasselbe, bewerten es jedoch völlig anders. Boethius ist nämlich der Meinung, dass alles, was es überhaupt gibt, auf irgendwelche Weise bestimmt ist. Geht es um etwas Wirkliches, so muss es sich dabei um etwas Reales handeln. Ist es nun etwas Reales, so muss es sich dabei um etwas Bestimmtes – Qualität oder Seinsweise aufweisendes – handeln. Eckhart vertritt hingegen die These, nach der das Wirkliche allein jenseits des Bestimmten, des Endlichen, des Realen, welches als solches Nichts sei, zu finden sei.󰀁󰀀󰀁 Das Wirkliche ist nach Eckhart allein Gott: Esse est deus.󰀁󰀀󰀂 Wirklich ist somit allein das Unendliche, da Gottes Endlichkeit oder Besonderheit gerade darin besteht, dass er keine Besonderheit, keine Eigenschaft – eben keine Qualität, keine Seinsweise – aufweist: indistinctum quoddam, quod sua indistinctione distinguitur.󰀁󰀀󰀃 Die durch 󰀁󰀀󰀀. Vgl. Boethius von Dacien, Modi significandi, ed. J. Pinborg und H. Roos (󰀁󰀉󰀆󰀉), q. 󰀁󰀀󰀄,󰀃󰀉-󰀅󰀃 (󰀂󰀄󰀀): ,Et dicendum ad hoc, quod pronomen significat substantiam sine qualitate, eo quod de modo suo significandi circa suum significatum nullam qualitatem determinat nec aliud, per quod illa substantia contrahitur ad unum suppositum ita quod non ad alterum. Et ideo significatum remanet generale et confusum valde. Ex hoc contingit, quod pronomen ad omne suppositum pertinet, ut dicit Priscianus. Si enim pronomen de suo modo significandi circa significatum suum determinaret aliquam proprietatem, iam illa substantia esset specifica et ad suppositum contracta nec ad omne suppositum pertineret, quod est inconveniens in pronomine. Notandum tamen est, quod non oportet, quod pronomen significat aliquam substantiam, quae est sine qualitate – nulla enim substantia est sine qualitate – sed significat eam non ut qualitatem habentem, quia nullam circa eam designat qualitatem de suo modo significandi‘. 󰀁󰀀󰀁. Vgl. A. Quero-Sánchez, Über das Dasein (󰀂󰀀󰀁󰀃), 󰀂󰀈󰀀-󰀄 (,Über die Nichtigkeit der Bestimmtheit des Bestimmten‘). 󰀁󰀀󰀂. Zur Diskussion dieses zentralen Satzes des Opus tripartitum siehe Andrés Quero-Sánchez, Sein als Freiheit. Die idealistische Metaphysik Meister Eckharts und Johann Gottlieb Fichtes (Freiburg i.Br. und München, 󰀂󰀀󰀀󰀄), 󰀆󰀃-󰀇󰀅; id., ,Das panentheistische Verständnis der „Mystik“‘ (󰀂󰀀󰀀󰀉), 󰀁󰀀󰀂-󰀁󰀀. 󰀁󰀀󰀃. Vgl. etwa Meister Eckhart, In Sap., n. 󰀁󰀅󰀄 (LW II 󰀄󰀉󰀀,󰀇-󰀁󰀀): ,Deus autem indistinctum quoddam est quod sua indistinctione distinguitur, ut ait Thomas p. I q. 󰀇 a. 󰀁 in fine. Est enim deus pelagus infinitae substantiae et per consequens indistinctae, ut ait Damascenus‘.

󰀂󰀃󰀄

A NDRÉS Q UERO -S ÁNCHEZ

das Pronomen ausgedrückte Unbestimmtkeit oder Qualitätslosigkeit ist das Charakteristikum (!) somit des Wirklichen überhaupt; wohl gemerkt: nicht des Realen, welches als solches – darin ist Eckhart mit Boethius einverstanden – eben etwas wie auch immer Bestimmtes ist. Und gerade deshalb ist die durch das Pronomen bezeichnete Substanz, so Eckhart, ni ch t die natürliche Substanz: Fünftens: Weil diese [irdische, reale, natürliche] Welt nicht so vermögend noch so würdevoll wie die Substanz als solche – welche [nämlich] dieses ,Ich‘ bezeichnet – ist, sondern allein die Vernunft, und zwar nicht insofern als sie [sc. die Vernunft] ein natürliches Vermögen oder etwas natürlich Seiendes ist, sondern als etwas Höheres als die Natur.󰀁󰀀󰀄 Nach der Darlegung des Boethius gebe es also eine Wortart – das Pronomen –, die etwas bezeichne, was es in der Natur nicht gebe. Ein solches Verständnis des Pronomens zerstört eigentlich seine dem eigenen Anspruch nach streng realistische Position. Und das hat Meister Eckhart gnadenlos ausgenützt, um seine idealistische Position zu begründen. Dass die Modi significandi noviter compilati des Thomas von Erfurt nun gerade in diesem Punkt etwas Neues anbieten, ließe sich – aber diese These ist schwer, wenn überhaupt, begründbar – als eine Reaktion auf Eckharts Missbrauch der Pronomen-Auffassung des Boethius deuten. Dass Thomas von Erfurt auf den Pariser Magister Echardus de Hochheim reagiert hat, scheint mir jedenfalls wahrscheinlicher zu sein, als umgekehrt. Das N e u e besteht somit in der Radikalisierung des bereits im Ursprung – etwa bei Boethius von Dacien – auf wesentliche Art und Weise präsenten Realismus: Der [für das Pronomen kennzeichnende] Modus [des Bedeutens] nimmt von der für die erste Materie kennzeichnenden Eigenschaft oder Seinsweise seinen Ursprung. Denn die erste Materie ist in sich selbst bezüglich jeglicher natürlichen Form, die sie annimmt, unbestimmt, so dass sie [von sich aus] die Form und die durch dieselbe bewirkte Bestimmung weder einschließt noch ausschließt. [...]. Damit ist nicht gemeint, dass das Pronomen allein die erste Materie bezeichne, sondern, dass die 󰀁󰀀󰀄. Meister Eckhart, In Eccl., n. 󰀁󰀀 (LW II 󰀂󰀄󰀀,󰀁-󰀃): ,Quinto, quia substantiae ut sic, quam li ego significat, non est capax hic mundus nec dignus, sed solus intellectus; nec hic in quantum natura sive ens naturae, sed in quantum altius quid natura‘.

E IN ‚ EWIG U NWIDERLEGBARES ‘

󰀂󰀃󰀅

Vernunft von einer solchen in der ersten Materie gefundenen Seinsweise veranlasst, dazu kommt, eine solche Unbestimmtheit in Betracht zu ziehen sowie einen sprachlichen Ausdruck zu gebrauchen, der auf unbestimmte Art und Weise etwas bezeichnet.󰀁󰀀󰀅 Auch in diesem Fall bleibt Thomas von Erfurt also – wohl bewusst – am Realen hängen.󰀁󰀀󰀆 󰀈. Schluss Sicherlich verdient der Tractatus de modis significandi des Thomas von Erfurt das intensive Interesse der Forschung, allerdings a n s i c h , d.h. nicht bloß deswegen, weil Martin Heidegger sich mit dieser Schrift auseinandergesetzt hat – denn Heidegger hat sie zweifelsohne missverstanden – noch bloß deswegen, weil die Schrift irgendwelchen Einfluss auf Eckhart ausgeübt hätte. Man müsste vor allem eine kritische Edition des 󰀁󰀀󰀅. Thomas von Erfurt, De modis significandi, ed. M. Fernández García (󰀁󰀉󰀁󰀀), c. 󰀂󰀁 n. 󰀉󰀆,󰀉󰀃󰀃 (󰀁󰀈a): ,Modus vero indeterminatae apprehensionis oritur a proprietate, seu modo essendi materiae primae. Materia enim prima in se, extra indeterminata est, respectu cuiuslibet formae naturalis, quae inest de se, ita quod nec includit nec excludit formam, nec determinationem formae. Ab ista ergo proprietate materiae primae, quae est proprietas de se indeterminata, determinabilis tamen per formam, sumitur modus significandi essentialis generalissimus Pronominis; non quod Pronomen materiam primam significet tantum, sed ex modo essendi reperto in materia prima, intellectus movetur ad considerandum aliquam essentiam sic indeterminatam, et ad imponendum sibi vocem sub modo significandi per modum indeterminati‘. 󰀁󰀀󰀆. Es ließe sich sogar die Frage stellen, ob Meister Eckhart seinerseits nicht wiederum auf diese Reaktion des Thomas von Erfurt reagiert hat, wenn er nämlich in seinem EcclesiasticusKommentar, In Eccl., n. 󰀄󰀂 (LW II 󰀂󰀇󰀀,󰀈-󰀂󰀇󰀂,󰀇) Folgendes schreibt: ,Notandum quod esuries et sitis proprie est desiderium, appetitus et potentia naturalis ad actum. Unde omne desiderium, appetitus et potentia, quae sunt ad aliquod finitum, non semper esuriunt nec semper sitiunt; sed adepto termino edunt et bibunt et nequaquam amodo sitiunt et esuriunt. Sic enim adepta perfecte forma ignis finem habet calor formam consequens. Iuxta quod Ioh. 󰀁󰀆 dicitur: „petite, ut gaudium vestrum plenum sit“. In his autem, quorum terminus est infinitus, e converso se habet. Talia enim semper edunt et semper esuriunt, et ardentius esuriunt et avidius quo plus edunt. Verbi gratia: materia prima infinita est ad omnes formas generabiles infinitas. Propter quod, licet nunquam sit sine forma et sic semper edat, semper tamen aliam et aliam formam appetit et esurit, quia nullam invenit in qua sint omnes. Propter quod R a b b i M oy s es l. III c. 󰀉 ipsam materiam dicit a Salomone Prov. 󰀅 describi sub metaphora mulieris adulterae quae virum habet et semper alterum appetit. Item videmus quod pars quaelibet orbis caelestis, quia potentiam habet et per consequens sitim et desiderium ad quodlibet et omne ubi, propter hoc semper est ubi alicubi et semper appetit et sitit omnia. Et haec est una causa vera motus perpetui illius corporis per naturam. E converso levia corpora et gravia, quia sunt ad unum terminum sursum vel deorsum, propter hoc illo adepto edunt, quiescunt, non sitiunt amplius proprie loquendo. Propter quod amodo non moventur, non quaerunt nec sitiunt amplius nec esuriunt‘.

󰀂󰀃󰀆

A NDRÉS Q UERO -S ÁNCHEZ

Traktats erstellen – was gar nicht so leicht sein wird, da 󰀃󰀉 Handschriften erhalten geblieben sind󰀁󰀀󰀇 – sowie der ebenso vorhandenen anonymen Kommentare zu demselben. Auch seine übrigen, handschriftlich überlieferten Werke wären kritisch zu edieren.󰀁󰀀󰀈 Man müsste darüber hinaus untersuchen – am besten durch die Analyse der handschriftlichen Überlieferung –, wo und wofür der Traktat studiert wurde, insbesondere, ob er nicht vielleicht als Handbuch im Rahmen des philosophischen S t u d i u m s gebraucht und wohl sogar vom Autor selbst so konzipiert wurde. Man müsste das Verhältnis des Thomas von Erfurt überhaupt zum Averroismus sowie dessen Rolle um 󰀁󰀃󰀀󰀀 in Erfurt und anderen Universitäten wie Prag und Krakau – an welchen Thomas‘ Traktat ja eine starke Wirkung ausübte – untersuchen. All diese sind sicherlich wichtige Aufgaben, welche die zukünftige Forschung zu erledigen haben wird. Und wir wollen uns schon jetzt darauf freuen.

󰀁󰀀󰀇. Siehe die Auflistung bei D. Gabler, Die semantischen und syntaktischen Funktionen (󰀁󰀉󰀈󰀇), 󰀁󰀅󰀃-󰀄. 󰀁󰀀󰀈. Überblick bei Chr. Lehmann, ,Thomas von Erfurt‘ (󰀂󰀀󰀀󰀂), 󰀅󰀇.

Thomas of Erfurt Commentary on Porphyry’s ›Isagoge‹ (Commentum in Isagogas Porphirii): Three Selected Passages (EDITED BY ANDRÉS QUERO-SÁNCHEZ)

I. Introduction Three manuscripts of Thomas of Erfurt’s Commentary on Porphyry’s ›Isagoge‹ are extant, namely the following ones: o

E

o

M

o

L

Erfurt/Gotha, University and Research Library (Universitäts- und Forschungsbibliothek), Department of Erfurt, Codex Amplonianus 󰀄° 󰀂󰀆󰀆, fol. 󰀁-󰀇. Munich, Bavarian State Library (Bayerische Staatsbibliothek), Clm. 󰀄󰀃󰀇󰀈, 󰀄°, fol. 󰀁r-󰀂󰀈v. Leipzig, Library of the University (Universitätsbibliothek), Ms. 󰀁󰀃󰀅󰀆, fol. 󰀁-󰀈.

The manuscript of Leipzig (L) contains a reportatio of the school-lectures of Thomas of Erfurt, done by some anonymous student, more precisely: a copy of such a reportatio (β-Version), whereas both the manuscripts of Munich (M) and the one of Erfurt (E) present a more elaborated version of the work, which was surely prepared for publication by the author himself (α-Version).󰀁 With regard to this α-version, I am using M as ›reference manuscript‹ (Leithandschrift). In those cases though, when M 󰀁. On both a description of all these manuscripts and a discussion of the relationship existing between them see Quero Sánchez, Heideggers Missverständnis (󰀂󰀀󰀁󰀉), Appendix in this volume, 󰀂󰀆󰀇󰀉. See also id., ‘Meister Eckhart’s Commentaries on Genesis and his Treatise On Being, What is, and Nothing’, Revista española de Filosofía Medieval 󰀂󰀃 (󰀂󰀀󰀁󰀆), 󰀂󰀅󰀉-󰀉󰀀, 󰀂󰀈󰀀-󰀁.

󰀂󰀃󰀈

A NDRÉS Q UERO -S ÁNCHEZ

clearly contains an error, I correct it by writing – in italics – the form that we find in E. With regard to the β-version, I am presenting a meaningful text by introducing an important number of conjunctures (using Old English Text as character font). This β-version is therefore a merely ›reconstructed‹ one which might never have existed in even this form. Of course, since all the introduced conjunctures are marked as such, I am also publishing the original text as we actually find it in L. Abbrevations add. cf. coni. del. dub. exp. homoiotel. illeg. in marg. inv. l. om. sup. lin. xxx xxx

addidit confer coniecit delevi dubitanter expurgat homoioteleuton illegibilis in margine invertit legendum omisit supra lineam expurgat delevi

Ø

editor’s conjecture by eliminating an expression in the manuscript L

Thomas de Erfordia

Commentum in Isagogas Porphirii (Commentum in Porphyrii Isagogen – Expositio Porphyrii – Glosa bona super Porphyrium – Dicta super Porphyrium)

Commentary on Porphyry’s ›Isagoge‹

Edited by Andrés Quero-Sánchez

I (Text of the α-version [manuscripts E and M]). (This passage is not included in the β-version that we find in manuscript L)

󰀂󰀄󰀀 1 2

A NDRÉS Q UERO -S ÁNCHEZ

//M 3v////E 1va// Sexto notandum quod Porphyrius in hoc libro intendit determinare de quinque universalibus, ut igitur appareat de quo universali velit hic determinare et unde causetur

18

universale de quo hic intendit determinare //M 4r// et de sufficientia illorum quinque universalium. Sciendum ergo quod multiplex est universale. Quoddam est universale secundum causalitatem, cuius causalitas se extendit super omnia vel ad plura; ad omnia, et sic prima causa est universale – et tale universale consideratur a metaphysico –; ad plura, et sic solum est universale respectu generabilium et corruptibilium – et tale universale consideratur a naturali. Secundo sumitur universale pro propositione disposita signo universali, et tale universale est principium sciendi omnes syllogismos, et consideratur a logico, primo Posteriorum. Tertio modo universale nihil aliud est quam adaequatio praedicati cum subiecto, ita quod nihil subiecti sit extra rationem praedicati et nihil praedicati extra rationem subiecti, ut in hac propositione: ›Homo est risibilis‹ – et tale universale considerat ipse Commentator, primo Posteriorum. Quarto sumitur universale secundum praedicationem – et de tali determinat Porphyrius in hoc libro. Et sic patet primum. Tunc videndum est secundo unde causetur illud universale secundum praedicationem. Notandum ergo quod illud universale habet esse per intellectum et in intellectu. Nihil autem est in intellectu nisi praefuerit in fantasia. Sed quidquid est in fantasia praefuit in sensu, quia

19

»fantasia est motus factus a sensu secundum actum«, ut dicitur 2 De anima. Accipiatur modo

20

aliquod sensibile singulare, scilicet Sortes. Sensus ergo cognoscit Sortem ut est sic vel sic figuratus, et sic vel sic coloratus, sub tantis vel tantis dimensionibus, vel de tali parentela vel de tali loco, et sic de aliis conditionibus quae consequuntur individuum.

3 4 5 6 7 8 9 10 11 12 13 14 15 16 17

21 22

1 Sexto] item E 1 intendit determinare] inv. E 2 velit hic] inv. E 3 quo] isto E 3 intendit (E)] om. M 5 est universale (ii)] inv. E 6 super] ad E 6 sic] add. est (exp.) M 9 Secundo] add. modo E 10 et] add. sic E 11-12 subiecti sit] inv. E 13 ipse Commentator (E)] Declarator (dub.) M 14 Porphyrius] add. et Philosophus E 15 sic] ita E 16 videndum est] inv. E 17 intellectu] tali E 17 est] om. E 18 praefuerit] prius fuerit – et add. in sensu (exp.) E 18 Sed] et secundum E 18 praefuit] prius fuit E 19 Accipiatur (coni.)] recipiatur E, M 20 Sortes] Fridericus E 20 Sortem] Fridericum E 21 et sic] om. E 21 sub] om. E 22 sic] ita E

10 Primo Posteriorum] Cf. Aristoteles, Analytica posteriora, I,4; 73a,21-74a,3, translatio Latina Guillelmo de Luna interprete (Recensio recognita), ed. Minio-Paluello / Dod, pp. 289,14-290,27. 13 Primo Posteriorum] Cf. Averroes, Commentum medium super libro praedicamentorum Aristotelis, I,2, translatio Latina Guillelmo de Luna interprete, ed. Hissette, p. 6,39-44 (n. 7): Eorum que sunt, quedam predicantur de subiecto et non sunt in subiecto, scilicet que denotant de omni de quo predicantur substantiam et quidditatem eius, et non denotant omnino aliquid extra substantiam eius; et hec est substantia universalis, ut animal est homo, quoniam cum predicantur de aliquo notificant denotant substantiam et quidditatem eius, non aliquid extra quidditatem. 19 ut dicitur 2 De anima] Cf. Aristoteles, De anima, III,4; 429a,1s., translatio Latina Guillelmo de Moerbeke interprete, ed. Leonina, p. 197b,6s.: fantasia utique erit motus a sensu secundum actum facto. Cf. Les auctoritates Aristotelis, ed. Hamesse, p. 183,49s. (Auctoritates II libri De anima Aristotelis, 111): Phantasia est motus factus a sensu secundum actum secundum quem animalia multa agunt et patiuntur.

C OMMENTARY

1 2

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀄󰀁

Ponatur tunc quod Sortes recedat a sensu, tunc fantasia, cum sit virtus organica, apprehendit ipsum sub istis conditionibus materialibus et individuantibus. In tali ergo fantasmate organica

10

duo sunt, scilicet natura humana et conditiones individuantes. Constat autem quod talis natura humana essentialiter differt ab istis conditionibus individuantibus, ideo intellectus agens supervenit et abstrahit naturam humanam ab his conditionibus accidentibus reponendo eam in intellectu possibili. Talis autem natura sic abstracta adhuc non est actu universalis, quia in universali secundum actum est duo considerare, scilicet intentionem universalitatis et naturam subiectam intentioni. Intentio autem universalitatis, cum non sit pure figmentum, habet ortum ab aliqua proprietate reali. Ex hoc arguo: Cuius non est considerare vel cognoscere proprietates rerum, eius non est agere completam rationem universalis. Sed intellectus agentis non est

11

cognoscere proprietates rerum, quia ipse nihil cognoscit eorum quae non sunt hac abstractione,

12

quia dicit Commentator quod »intellectus agens non est intellectus qui cognoscat, sed quia efficit

13

intellectum possibilem ut cognoscere possit«; ergo intellectus agentis non est agere completam rationem universalis, ita quod cognoscat ipsum, sed facit bene quod intellectus possibilis possit ipsum cognoscere. Et ita patet quod natura rei, ex eo quod solum est abstracta, non est actu

3 4 5 6 7 8 9

14 15 16 17 18 19 20

universalis, sed est actu immaterialis et actu obiectum intellectus possibilis, quia omne immateriale de se est actu intelligibile. Patet etiam, cum ab- //E 1vb// -strahere sit propria operatio intellectus agentis, quod per operationem eius aliquid fit actu intelligibile, sed non fit actu universale. Reliquitur ergo quod universale, quantum ad eius rationem completam, fiat ab intellectu possibili.

1 tunc quod Sortes] inv. (quod Sortes tunc) E 1 recedat] recedit E 1 fantasia] a fantasia E 2 ipsum] eum E 2 fantasmate] fantasia E 2 organica] add. Sortis E 3 individuantes] accidentales E 3 autem (E)] ergo M 4 istis (E)] illis M 5 his] istis E 6 Talis autem] universale pro E 6 adhuc] add. haec E 8 intentioni] om. E 9 arguo] arguitur E 9 vel cognoscere] om. E 10-11 agentis non est cognoscere proprietates rerum] agens rerum proprietates non cognoscit E 11 quia ipse nihil cognoscit eorum quae non sunt hac abstractione] om. E – abstractione (coni.)] om. M 12 dicit Commentator] inv. E 12 qui (coni.)] quod E, M 13 intellectum possibilem ut] ut possibilis E 13-15 intellectus agentis non est agere completam rationem universalis, ita quod cognoscat ipsum, sed facit bene quod intellectus possibilis possit ipsum cognoscere] etc. E 15 ex] om. E 16 est] om. E 16 immaterialis et] in material vel E 16 obiectum] om. E 17 intelligibile] add. sed non fit actu universale (exp.) E 19 Reliquitur] relinquitur E 20 completam] completum E 20 fiat] fit E

12-13 dicit Commentator] Cf. Averroes, Commentarium magnum in Aristotelis De anima, ed. Crawford, In librum Tertium, comm. 18, p. 439,71-82: Et fuit necesse attribuere has duas actiones anime in nobis, scilicet recipere intellectum et facere eum, quamvis agens et recipiens sint substantie eterne, propter hoc quia hee due actiones reducte sunt ad nostram voluntatem, scilicet abstrahere intellecta et intelligere ea. Abstrahere enim nichil est aliud quam facere intentiones ymaginatas intellectas in actu postquam erant in potentia; intelligere enim nichil aliud est quam recipere has intentiones. Cum enim invenimus idem transferri in suo esse de ordine in ordinem, scilicet intentiones ymaginatas, diximus quod necesse est ut hoc sit a causa agenti et recipienti. Recipiens igitur est materialis, et agens est efficiens. Cf. Les auctoritates Aristotelis, ed. Hamesse, p. 190,21s. (Auctoritates III libri Aristotelis De anima – Commentator, 191): Operatio intellectus possibilis est intelligere, sed operatio intellectus agentis est abstrahere, intelligere facere.

󰀂󰀄󰀂 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18

A NDRÉS Q UERO -S ÁNCHEZ

Et hoc sic patet: Quia de ratione universalis completam sunt et unitas et communitas. Nunc autem natura rei non est una nec communis nisi per solam operationem intellectus possibilis. Ipsa enim est una ut consideratur abstracta, communis autem ut ad plura supposita comparata; ergo natura rei est actu universalis per solam operationem intellectus possibilis. Et ita patet quod universale est actu per respectum ad supposita plura, quod contingit per intellectum possibilem. Hoc idem patet auctoritate Philosophi, 1° Posteriorum, qui definiens universale dicit quod »universale est unum in multis et de multis dicitur«. Sed illae praepositiones, ›de‹ vel ›in‹, important respectum et habitudinem; ergo universale est formaliter universale per respectum et habitudinem ad supposita. Hoc idem patet per Porphyrium, qui definit universalia per respectum ad supposita. Dicit quod »genus est quod praedicatur de pluribus, etc.«, et ita de aliis. Item. Hoc idem patet ex interpretatione vocabuli. Dicitur enim ›uni-versale‹, id est, ›unum ad multa versum‹. Et quia illae respectus et habitudo ad supposita non competit naturae nisi per intellectum possibilem, patet quod universale actu et formaliter non est nisi per intellectum possibilem. Et ita patet quod universale dispositione causatur ab intellectu agente, completam autem rationem ab intellectu possibili.

1 sic] om. E 1 Quia] om. E 1 universalis] om. E 1 sunt et] om. E 1 Et hoc sic patet: Quia de ratione universalis completam sunt et unitas et communitas] Et hoc patet de ratione completam unitas et comunitas E 5 patet] om. E 5 est actu] inv. E 5 supposita plura] inv. E 5 contingit] convenit E 7 idem patet] patet ergo E 7 qui (E)] quia M 8 in multis et de multis] inv. (de multis et in multis) E 8 dicitur] om. E 8 praepositiones] proprietates E 8 vel] et E 9 est formaliter] inv. E 9 universale (ii)] add. et E 11 Hoc idem patet per Porphyrium, qui definit universalia per respectum ad supposita] om. (homoiotel). E 12 quod genus est] ergo E 13 interpretatione] impositione E 13 enim] om. E 13 id est] quia E – add. ad (exp.) M 14 illae] ipsae E 15-16 patet quod universale actu et formaliter non est nisi per intellectum possibilem] om. (homoiotel.) E 17 autem (E)] om. M 18 rationem (coni.)] om. E, M 18 ab intellectu possibili] a possibili E

7-8 auctoritate Philosophi, 1° Posteriorum] Cf. Aristoteles, Analytica posteriora, I,11; 77a,5-9, translatio Latina Guillelmo de Moerbeke interprete (Recensio recognita), ed. Minio-Paluello / Dod, p. 296,32-5: Species quidem igitur esse aut unum aliquid extra multa non necesse est, si demonstratio erit, esse tamen unum de multis verum dicere necesse est; non enim erit universale, nisi hoc sit; si vero universale non sit, medium non erit quare nec demonstratio. Oportet itaque aliquid unum et idem in pluribus esse non equivocum. 11-12 patet per Porphyrium] Cf. Porphyrius, Isagoge, translatio Latina Boethio interprete, ed. by Minio-Paluello, p. 7,9-16: Ab his ergo quae de uno solo praedicantur differunt genera eo quod de pluribus adsignata praedicentur, ab his autem quae de pluribus: ab speciebus quidem quoniam species, etsi de pluribus praedicantur, sed non de differentibus specie, sed numero [...]; a proprio vero differt genus quoniam proprium quidem de una sola specie, cuius est proprium, praedicatur et de his quae sub una specie sunt individuis [...], genus autem non de una specie praedicatur sed de pluribus et differentibus; a differentia vero et ab his quae communiter sunt accidentibus differt genus quoniam, etsi de pluribus et differentibus specie praedicantur differentiae et communiter accidentia, sed non in eo quod quid sit praedicantur sed in eo quod quale quid sit.

Thomas de Erfordia

Commentum in Isagogas Porphirii (Commentum in Porphyrii Isagogen – Expositio Porphyrii – Glosa bona super Porphyrium – Dicta super Porphyrium)

Commentary on Porphyry’s ›Isagoge‹

Edited by Andrés Quero-Sánchez, II

󰀂󰀄󰀄

A NDRÉS Q UERO -S ÁNCHEZ

Į-version (E/M) //M 10r// //E 3va// 1

»Species quidem«.

2

Determinato de genere importante totam essentiam speciei sub intellectu confuso et indeterminato et sub ratione partis materialis hic exsequitur de specie importante totam rei substantiam sub intellectu finito et determinato et sub ratione totius compositi.

3 4

5 6 7

Et duo facit. Primo ponit duas acceptiones specieL: una est vulgaris, alia logica. Secundo prosequitur de specie logica, ibi: »Assignant ergo«. Prima in duas. Primo ponit significationem speciei vulgaris, secundo significationem speciei logicae, ibi: »Dicitur autem«.

10

Primo dicit quod »species« uno modo »dicitur de forma uniuscuiusque«, a qua quidem specie unusquisque dicitur speciosus et formosus, »secundum quam«, scilicet significationem speciei, »dictum est: ›Species Priami digna est imperio‹«, quia dicebant eum fuisse regem propter suum

11

decorem et speciositatem.

8 9

1 quidem] om. E 3 et] om. E 3-4 rei substantiam] inv. E 5 duas] om. E 5 speciei] om. et add. quarum E 6 prosequitur de specie logica] inv. (de specie logica prosequitur) E 6 ergo] om. E 6 ponit] facit (exp.) ponit E 7 vulgaris] vulgarem E 10 dicebant] dicebat E 10 fuisse regem] esse regem fuisse E

3 hic exsequitur de specie] Cf. Porphyrius, Isagoge, ed. Minio-Paluello, pp. 8,17-14,14. 6 ibi: »Assignant ergo«] Cf. Porphyrius, Isagoge, ed. Minio-Paluello, p. 9,3s 7 ibi: »Dicitur autem«] Cf. Porphyrius, Isagoge, ed. Minio-Paluello, p. 8,19. 8 Primo dicit] Cf. Porphyrius, Isagoge, ed. Minio-Paluello, p. 8,17-9: De specie. – Species autem dicitur quidem et de uniuscuiusque forma secundum quam dictum est ›primum [sic! l. Priami] quidem species digna imperio‹.

C OMMENTARY

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀄󰀅

ȕ-version (L) //L 3rb// »Species autem est«.

1 2

Postquam auctor in parte praecedenti determinavit de uno universali quod infinitam et

3

indeterminatam naturam et confusam importat, in ista parte auctor determinat de secundo

4 5

universali quod naturam certam et determinatam importat. Vel aliter: Postquam auctor determinavit de genere quod habet se tamquam pars speciei,

6

in ista parte auctor determinat de specie quae habet se per modum totius compositi respectu generis.

7

Genus autem et differentia habent se tamquam partes respectu speciei. Sed species est quoddam totum, unde est compositum respectu generis et differentiae, quia intellectum speciei causatur et

8 9 10 11 12 13 14

constituitur ex intellectu essentiali generis et differentiae. Et dividitur pars in duas. Primo enim pertractat significationes specie, unam vulgarem et unam logicam; in secunda parte auctor exsequitur de significatione speciei definiendo eam; secunda ibi: »Assignant ergo«. Adhuc prima in duas, secundum quod pertractat duas significationes speciei, unam vulgarem et aliam logicam; secunda ibi: »Dicitur autem species«. Secunda indivisa.

(Vide infra, p. 250)

3 ista (coni.)] illa L 8 differentiae (coni.)] speciei L

6 quae (coni.)] quod L 12 Assignant (coni.)] assignat L

6 compositi (coni.)] positi L 14 Secunda (coni.)] prima L

󰀂󰀄󰀆 1 2 3 4

5 6 7 8

9

A NDRÉS Q UERO -S ÁNCHEZ

Notandum primo quod dubitaret forte aliquis de ordine illius capituli ad sequens capitulum. Videtur enim quod prius deberet determinare de differentia tamquam de principiori, tum quia constituens prius est constituto – differentia autem adveniens generi constituit speciem –,

tum quia simplex prius est composito – differentia autem simplex est respectu speciei, quia differentia significat //M 10v// sub ratione partis, species autem sub ratione totius (intellectus enim speciei compositus est ex intellectu generis et differentiae). Secundo notandum circa hoc quod dicit quod »species« uno modo »dicitur forma«.

Sciendum quod duplex est forma. Quaedam est forma quae dat esse, a qua aliquis dicitur

10

formatus, et de illa non dicitur ›species‹.

11

Alia est forma a qua aliquis dicitur ›formosus‹, et de illa dicitur ›species‹. Talis autem forma

12

non est aliud quam elegans, id est, decora et ornata membrorum dispositio, vel – quod idem est

13

– decor et speciositas corporis.

14

Unde olim dictum est de Priamo quod »species Priami digna est imperio«. Decentia enim et formositas corporis signum est bonae dispositionis mentis.

15

1 primo] om. E 1 illius] huius et add. ad (exp.) E 1 sequens] consequens E 2 principiori] priori E 3 prius est] inv. E 5 prius est] est prius est (exp.) E 9 a qua] aliqua ut E 11 est forma] species (exp.) est E 11 dicitur (ii)] om. E 12 elegans, id est] elegantia est E 12 decora (coni.)] decoris M; decentia E 12 quod idem est] inv. (idem est quod) E 13 speciositas] formositas vel speciositas E 14 de Priamo] om. E 15 signum est] inv. E

16

C OMMENTARY

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀄󰀇

1

Aliquis dubitaret de ordine speciei ad differentiam. Et videtur quod differentia prior sit in

2

ordine. Omne enim constituens prius est constituto. Sed differentia constituit speciem; ergo etc.

3

Maior patet: Quia illud naturaliter prius est alio quod constituit ipsum, sicut si parietes et

4

tectum oportet constituere domum, oportet quod sint prius. Minor declaratur sic: Differentia

5

constituit speciem, quia intellectum speciei est compositus ex intellectu generis et differentiae tamquam ex partibus, et sic differentia est prior. Sed de prioribus prior debet esse speculatio.

6 7

Ad idem: Simplex Ø naturaliter praecedit suum compositum. Sed differentia respectu

8

speciei est simplex, species autem respectu differentiae est compositum; ergo etc. Maior et

9 10

minor patent. Primo ergo praemittit unam acceptionem speciei vulgarem. Dicit quod »species« in prima

11

significatione »dicit formam uniuscuiusque rei, secundum quam speciem Ø dictum est de

12

Priamo: ›Species Priami digna est imperio‹«.

13

Unde notandum quod duplex est forma. Una est forma substantialis, et ista dicitur illud a quo

14

aliquid informatum est simpliciter, ut est forma substantialis speciei, quae habet res per naturam

15

informantem quoad esse simpliciter, quia dat sibi esse simpliciter. Anima enim est forma substantialis

16 17

hominis, quia ab anima homo informatur quoad esse homo simpliciter. Forma accidentalis est illud a quo aliquid non est informatum simpliciter, sed dicitur ab

18

illo ›formosum‹ et ›pulchrum‹. Et ista forma accidentalis non dat esse simpliciter, sed dat esse

19

secundum quid et tale Ø. Et hoc modo accipitur in proposito et definitur: Forma est elegans

20

membrorum corporis dispositio, id est, decora et bona. Et sic forma est formositas et pulchritudo causata ex elegante dispositione membrorum. Et hoc modo dicitur »species Priami«, id est, pulchritudo et formositas Priami, »digna est

21 22 23 24 25

imperio«, id est, regere. Unde illi qui habent bonam et elegantem dispositionem membrorum, illi etiam habent bonam dispositionem mentis; et bona dispositio elegans membrorum corporis arguit bonam dispositionem mentis et attestatur bonam dispositionem mentis.

2 enim (coni.)] om. L 3 si] sup. lin. L 3 parietes (coni.)] partes L 7 Ø (coni.)] est L 11 Ø (coni.)] forma L 13 Una est forma (coni.)] om. L 13 ista (coni)] illa L 13 illud (coni.)] om. L 14 informatum est (coni.)] formandum L 14 res (coni.)] se L 15 informantem quoad esse (coni.)] informantis speciem L 15 enim (coni.)] om. L 17 illud (coni.)] om. L 18 ista (coni.)] illa L 19 Ø (coni.)] est forma L 22 Priami (coni.)] prima L

󰀂󰀄󰀈 1 2 3 4 5 6 7

A NDRÉS Q UERO -S ÁNCHEZ

Unde 1° Ethicorum: »Non omnino felix est, qui specie turpissimus est«. Et in 2° De anima dicitur quod »actus activorum sunt in patiente disposito«. Et in Thimaeo Plato dicit quod »secundum merita materiae dantur formae«. Et convenienter dicitur: »Qualis est in corpore, talis in anima est«. Unde bona dispositio corporis attestatur bonam dispositionem mentis. Et »bene dispositi mente naturaliter sunt aliorum rectores«, ut dicit Philosophus, 1° Politicorum. Unde etiam homines convenienter obediunt formoso principi ex decentia corporis exterioris bonitatem mentis interius praesumentes.

1 in] om. E 2 dicitur (E)] om. M 2 in Thimaeo Plato] inv. (Plato in Thimaeo) E 2 dicit] qui dixit E 3 est] es E 4 in anima est] es in mente E 4 Et] sed E 5 dispositi mente] disposito menti E 5 rectores] add. et duci E 5 ut dicit Philosophus] secundum Philosophum E 6 exterioris] exteriori E

1 Unde 1° Ethicorum] Cf. Aristoteles, Ethica ad Nicomachum, I,9; 1099b,3s., translatio Latina Roberto Lincolniensi Episcopo interprete (Recensio recognita, Guillelmo de Moerbeke interprete), ed. Gauthier, p. 387,5: Non omnino enim felix qui specie turpissimus, vel ignobilis, vel solitarius et sine prole. Cf. Les auctoritates Aristotelis, ed. Hamesse, p. 234,4 (Auctoritates super primum librum Ethicorum Aristotelis, 19): Non omnino felix est qui specie turpissimus est et sine prole. 1-2 in 2° De anima] Cf. Aristoteles, De anima, II,2; 414a,11s., translatio Latina Guillelmo de Moerbeke interprete, ed. Leonina, p. 82b,7s. [= Sentencia libri secundi de anima, cap. 4]): uidetur enim in patiente et disposito actiuorum inesse actus. Cf. Les auctoritates Aristotelis, ed. Hamesse, p. 179,1 (Auctoritates secundi libri De anima Aristotelis, 55): Actus activorum sunt in patiente praedisposito. 2-3 in Thimaeo] Cf. Plato, Timaeus, 41c3-d3, translatio Latina Calcidio interprete, ed. Waszink, p. 36,3-13: Quapropter, ut et mortalia sint et uniuersa res non indigeat perfectione sed sit tota atque uniuersa uere, iubeo aggrediamini secundum naturam mortalium generum institutionem. Imitantes ergo meam iuxta effectum uestrum sollertiam ita instituite atque extricate mortalia ut, quibus consortium diuinitatis et appellationis parilitas competit, diuina praeditum firmitate fingatis; erit uero tale quod uobis obsequi iustitiamque colere prospexeritis. Huius ego uniuersi generis sementem faciam uobisque tradam; uos cetera exequi par est, ita ut immortalem caelestemque naturam mortali textu extrinsecus ambiatis iubeatisque nasci cibumque prouideatis et incrementa detis ac post dissolutionem id faenus quod credideratis facta secessione animi et corporis recipiatis. On this subject see Quero-Sánchez, Über das Dasein (2013) [nota 6], pp. 559-602 (›Die von außen gegebenen Formen werden nach den Verdiensten der Materie [secundum merita materiae] gegeben: Alberts Korrektur am platonischen Idealismus im Sinne der aristotelischen Lehre der Anfänglichkeit der Form in der Materie [inchoatio formae in materia]‹). 5 ut dicit Philosophus, 1° Politicorum] Cf. Aristoteles, Politica, I,2; 1252a31s., translatio Latina Guillelmo de Moerbeke interprete (Translatio nova), ed. Susemihl, p. 3,9-11: quod quidem enim potest mente praevidere, principans natura et dominans natura. Cf. Les auctoritates Aristotelis, ed. Hamesse, p. 252,4s. (Auctoritates super primum librum Politicorum Aristotelis, 1): Homines ratione et intellectu vigentes naturaliter aliorum domini sunt et rectores.

C OMMENTARY

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀄󰀉

1

Et illud dicit Aristoteles in libro Ethicorum: »Omnis ille non est felix qui est turpissimus

2

in forma«. Et etiam in 3° De anima: »Actus activorum sunt in patiente disposito«. Et etiam

3 4

Plato dicit in Thimaeo: »Forma agit secundum materiam dispositam«. Et ita, cum formositas et elegantia membrorum et bona dispositio corporis attestatur bonam dispositionem mentis et

5

intellectus, et quia Aristoteles dicit: »Vigentes in intellectu et ratione aliorum duci sunt et

6

rectores; et qui in his deficiunt aliorum sunt servi et ministri«, et Ø cum formositas attestatur

7

bonam dispositionem mentis, ideo dictum fuit de Priamo: »Species Priami digna est imperio«, id

8

est, formositas et pulchritudo Priami digna est imperio, id est, regere.

1 felix (coni.)] infelix L 6 Ø (coni.)] quia L

4 et bona (coni.)] om. L 7 species (coni.)] sub forma L

4 corporis (coni.)] arguit et L

󰀂󰀅󰀀

A NDRÉS Q UERO -S ÁNCHEZ

1 2

Tertio notandum quod licet in Grammatica quaedam sit species derivativa et quaedam primitiva,

3

tamen, quia nullam habet convenientiam cum specie hic intenta, ideo Porphyrius significationem earum praetermittens ponit solum illam significationem speciei quae convenientiam habet cum specie hic intenta. Et hoc patet quia sicut forma vel dispositio de qua dicitur species hic primo modo determinate aliquid informat et disponit quod de se erat informatum et indispositum, indifferens ad quamlibet formam et dispositionem, sic species hic intenta importat quandam naturam determinate et finite, quam genus importat indeterminate et infinite.

4 5 6 7 8 9

(Vide supra, p. 245)

1-2 derivativa et quaedam primitiva] primitiva, quaedam derivativa E 3 tamen, quia] quae tamen E 4 praetermittens ponit] hic praemittit ponens E 4 solum] solam E 4 illam] istam E

C OMMENTARY

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀅󰀁

2

Sed aliquis dubitaret, cum adhuc sint plures acceptiones speciei – ut species in Grammatica est modus significandi rem sub esse priori vel posteriori, et illae duae sunt

3

primitiva et derivativa –, quare auctor de illis non facit mentionem.

4

8

Ad hoc est dicendum quod auctor solum ponit unam acceptionem – speciem vulgarem – , quae habet convenientiam cum significatione speciei logicae, et alias non proponit quae non habent convenientiam cum specie logica. Est autem similitudo istarum, quia sicut species logica importat naturam determinatam et specialem quae importatur hoc nomine confuse et indeterminate et sub indifferentia ad determinatam specificationem per differentias, sic etiam

9

species vulgaris, quae est formositas, importat determinatam qualitatem per quam subiectum

10

disponitur quod prius fuit informatum et indifferens ad qualecumque dispositionem aliam. Et sic

11

apparet similitudo.

1

5 6 7

12

Littera: Ita determinato de genere auctor prosequitur: Species in prima significatione dicitur

13

forma prout a forma aliquid dicitur esse formosum, et »dicitur forma«, inquam, »uniuscuiusque rei, secundum quam speciem dictum est de Priamo: ›Species Priami‹«, id est, formositas Priami, »digna est imperio«, id est, regere.

14 15

3 quare (coni.)] quia L 8 differentias (coni.)] indifferentias L 10 quod (coni.)] et L 10 fuit informatum (coni.)] infuit formatum L 12 auctor (coni.)] autem L 12 prosequitur (coni.)] dub. L

Thomas de Erfordia

Commentum in Isagogas Porphirii (Commentum in Porphyrii Isagogen – Expositio Porphyrii – Glosa bona super Porphyrium – Dicta super Porphyrium)

Commentary on Porphyry’s ›Isagoge‹

Edited by Andrés Quero-Sánchez, III

󰀂󰀅󰀄

A NDRÉS Q UERO -S ÁNCHEZ

Į-version (E/M) //M 4v// //E 1vb// 1

»Mox de generibus et speciebus«.

2

Postquam auctor ostendit de quibus in hoc libro velit determinare, hic ostendit a quibus in hoc libro velit se abstinere. Et primo facit hoc, secundo assignat causam dicti, ibi: »Altissimum enim«.

3 4

5 6 7 8 9 10 11 12 13 14 15 16 17 18 19

Primo dicit quod »mox«, id est, in praesenti libro, »recusabo dicere«, id est, determinare, »illud«, id est, illas difficiles quaestiones de generibus et speciebus et aliis similiter, »sive« (pro ›utrum‹) »subsistant«, id est, sint res subsistentes in rerum natura praeter operationem intellectus (sicut voluit Plato), »sive sint posita in intellectibus solis nudis purisque«, ut quidam aliquando posuerunt. Voluerunt enim quod universalia tantum essent in intellectu, ita quod nihil responderet eis ex parte rei. Haec est prima quaestio. Secunda quaestio est: Dato quod sint in rerum natura subsistentia, utrum sint »subsistentia corporalia an incorporalia«, id est, utrum sint res subsistentes corporales vel incorporales. Tertia quaestio est: Utrum illa universalia sint »separata a sensibilibus«, id est, a sensibus, vel sint in eis ponenda. Et non solum »recusabo dicere« et determinare de his tribus quaestionibus, sed etiam »recusabo dicere constantia circa ea«, id est, difficultates incidentes circa huiusmodi quaestiones. Istas difficultates tangit Porphyrius ut intellectus auditorum excitetur circa cognitionem universalium et ne etiam credatur ignorare eas.

1 et speciebus] etc. E 2 a] de E 3 velit se] inv. E 4 Et] om. E 6 id est] sup. lin. M 8 solis (E)] solum M 8 nudis purisque] puris nudis quia E 9 aliquando] alii E 10 responderet] corresponderet E 11 in rerum natura subsistentia] inv. (subsistentia in rerum natura) E 12 corporalia (E)] corporea M 12 an] sive E 12 incorporalia (E)] incorporea M 12 res] om. E 12 subsistentes corporales vel incorporales] inv. (corporales vel incorporales subsistentes) E 13 illa] om. E 15 recusabo dicere] dicere recusabo dicere [bis!] E 16 constantia] constantiam E 16 circa (ii)] de E

2 hic ostendit] Cf. Porphyrius, Isagoge, ed. Minio-Paluello, p. 5,10-17. 4 ibi: »Altissimum enim«] Cf. Porphyrius, Isagoge, ed. Minio-Paluello, p. 5,14. 5 Primo dicit quod] Cf. Porphyrius, Isagoge, ed. Minio-Paluello, p. 5,10-14: Mox de generibus et speciebus illud quidem sive subsistunt sive in solis nudis purisque intellectibus posita sunt sive subsistentia corporalia sunt an incorporalia, et utrum separata an in sensibilibus et circa ea constantia, dicere recusabo.

C OMMENTARY

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀅󰀅

ȕ-version (L) //L 1va// »Mox de generibus«.

1 2

Sicut supra dictum fuit quod Porphyrius ostendit de quo in isto libro velit determinare – quia de

3

quinque universalibus –, in ista parte proemialiter ostendit a quibus se velit abstinere.

4

Et dividitur in duas. Primo agit a quibus se velit abstinere, secundo assignat causam huius, ibi: »Altissimum«.

5 6

Prima indivisa. Stat autem intentio in hoc quod dicit »mox«, id est, in praesenti libro,

7

»recusabo me«, id est, negabo me, »determinare illud«, id est, difficiles quaestiones de generibus et speciebus et de aliis, »sive universalia subsistant«, id est, habeant subsistentiam extra intellectum ut in rebus extra, »sive sint in intelligentibus puris vel solis vel nudis«. Haec est una difficilis quaestio a qua se vult auctor abstinere.

8 9 10

13

Et dato quod universalia habeant subsistentiam extra, »utrum tunc sint subsistentia corporalia vel incorporalia«. Sed alia quaestio difficilis est »utrum sint separata a sensibilibus«, id est, a sensibus, ut

14

voluerunt Stoici, »vel sint in sensibilibus«, id est, coinuncta particularibus secundum esse, ut

15

vult veritas. Et illa est tertia quaestio difficilis. Ab istis quaestionibus difficilibus Porphyrius in suo libro vult abstinere, cum iste liber sit introductorius et traditus pueris. Etiam ulterius: Ego »recusabo dicere«, id est, determinare, »constantia circa ea«, circa difficiles quaestiones, quia volo illa abicere a meo libro propter pueros.

11 12

16 17 18 19

2 isto (coni.)] illo L 6 dicit (coni.)] om. L

3 ista (coni.)] illa L 6 autem intentio (coni.)] ante intentionem L 13 alia (coni.)] aliqua L 14 vel sint (coni.)] et sunt L

󰀂󰀅󰀆

A NDRÉS Q UERO -S ÁNCHEZ

(Vide infra, p. 259)

C OMMENTARY

1 2

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀅󰀇

»Altissimum«. Assignat causam quare velit abstinere ab istis. Et est causa quia huiusmodi difficiles quaestiones pertractare est altissimum negotium, quia pertinet ad metaphysicam, quae

6

longum tractatum de eis facit et est egens maioris inquisitionis quam sit logica; quasi dicat: maior scientia quam sit logica debet pertractare istas difficiles quaestiones et inquirere. Unde nota quod Porphyrius fecit mentionem de istis difficilibus quaestionibus propter hoc, ut sciamus eas non ignorasse, vel propter hoc, ut ipse excitet auditores ad amorem harum

7

quaestionum. Unde nota quod propter hoc Porphyrius tangit has difficiles quaestiones et non

8

solvit eas. Sed ut tamen omnino non maneant indissolutae istae quaestiones et omnino lateant nos, aliqua sunt determinanda de dissolutione harum quaestionum. Est autem prima quaestio difficilis utrum universalia sint subsistentia ut in rebus extra vel universalia sint ponenda in intelligentibus. Et dato quod in intelligentibus, utrum in

3 4 5

9 10 11 12 13 14 15

intelligentibus solis vel nudis vel puris. Sed ad solutionem istius quaestionis est notandum quod universale nominat mihi duo: uno modo dicit mihi intentionem secundam universalitatis fundatam supra rem in comparatione ad sua //L 1vb// supposita; alio modo dicit mihi universale rem subiectam intentioni isti.

17

Et hoc confirmatur per regulam quae datur in Grammatica: quod omnis terminus concretus Ø dicit mihi duo, scilicet puram qualitatem, scilicet albedinem, et rem subiectam

18

albedini. Utroque modo propositio potest verificari, tam prout stat sub pura qualitate quam prout

19 20

stat sub re subiecta. Unde quando dico: ›Album est disgregativum visus‹, tunc illa propositio vera est de albo prout nominat albedinem puram, et non est vera pro re subiecta. Similiter ista

21

propositio: ›Album currit‹ est vera pro re subiecta et non pro qualitate.

22

26

Et ita intelligendum est de unoquoque praedicamento in termino concreto quod nominat mihi duo. Sed universale est terminus concretus, quia universalitas est eius abstractum, sicut album est concretum et albedo eius abstractum; ergo etiam nominat mihi duo: intentionem et rem subiectam intentioni. Et utroque modo potest verificari propositio. Unde illa propositio: ›Universale est in singularibus‹ dicitur esse vera pro re subiecta et est falsa pro intentione, sed

27

ista propositio: ›Universale rei est in singularibus‹ est vera de intentione et falsa pro re subiecta.

16

23 24 25

6 excitet auditores (coni.)] incidat quaestiones L 7 quod (coni.)] om. L 11 in (coni.)] om. L 13 uno (coni.)] unum L 18 Utroque] corr. ex utrobique L 21 currit (coni.)] ostenditur L

7 tangit (coni.)] movet L 17 Ø (coni.)] et L

󰀂󰀅󰀈 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24

A NDRÉS Q UERO -S ÁNCHEZ

Ad evidentiam istarum quaestionum notandum est quid significetur per hos tres intellectus, scilicet per intellectum solum, nudum et purum. Sciendum quod intellectus //M 5r// solus est cui nihil ex parte rei correspondet, ut intellectus alicuius figmenti, ut chimerae vel hircocervi, et sic de aliis. Per oppositum autem intellectus non solus est cui aliquid ex parte rei correspondet, ut intellectus lapidis vel ligni, etc. Intellectus nudus est qui speciebus et formis intelligibilibus non est vestitus, ut intellectus pueri in prima sui creatione, qui est sicut tabula rasa in qua nihil est depictum. Per oppositum intellectus non nudus est qui aliquibus formis et speciebus intelligibilibus est vestitus. Intellectus purus est qui ab omni fantasmate est denudatus et nulli organo corporeo est alligatus, ut intellectus divinus. Per oppositum intellectus impurus est qui ex fantasmatibus intelligit et organo corporeo est alligatus, ut intellectus humanus, de quo dicitur 3° De anima quod »intelligentem quemcumque necesse est fantasmata speculari«. Secundo notandum quod universale duo significat, scilicet intentionem universalitatis ab ipso intellectu causatam et rem vel naturam isti intentioni subiectam. Illa autem distinctio sumit ortum ab illa regula: quod omne nomen concretum accidentis sive realis sive intentionalis duo significat, scilicet formam accidentalem et naturam sibi subiectam, ut ›album‹ significat formam albedinis – quia dicimus: ›Album disgregat visum‹ – et naturam subiectam albedini – quia dicimus: ›Album currit‹. Sic etiam, cum universale sit nomen concretum accidentis intentionalis – quia universalitas est eius abstractum –, ideo uno modo significat formam vel intentionem universalitatis, alio modo rem vel naturam huic intentioni subiectam. Sic etiam distinguendum est de unoquoque universali in speciali, scilicet de genere et specie et de aliis. Quod scitur ex hoc: quia ex parte utriusque formari possunt aliquae propositiones verae. Dicimus enim quod species praedicatur de individuis – hoc est verum ex parte rei –; dicimus etiam quod individuum non est species – hoc est verum ex parte intentionis.

1 istarum (E)] illarum M 2 scilicet per] om. E 2 et] om. E 3 Sciendum] add. ergo E 4 vel] om. E 4 Per] om. E 5 aliquid] om. E 5 vel] et E 7 sicut] tamquam E 7 depictum] add. vel scriptum ut dicitur 3 De anima E 7 Per] om. E 9 fantasmate] facilitate (dub.) E 9 denudatus] depuratus E 9 corporeo] add. in marg. E 9 est (E)] om. M 10 impurus] non purus E 11 et (E)] om. M 11 est (E)] om. M 11 alligatus] add. ____ (illeg.) solus purus fantasmata nudus sunt tabulae rasae quibus est scriptum nihil intra E 13 Secundo] om. E 13 significat] nominat E 14 ipso] om. E 14 et (E)] vel M 14 rem vel] om. E 14-15 Illa autem distinctio sumit ortum] ita quod distinctio fuit orta E 15 nomen] om. E 16 naturam] materiam E 17 albedinis] albi et E 19 est eius] inv. E 19 abstractum (E)] absolutum M 24 etiam (E)] enim M

11-12 dicitur 3°De anima] Cf. Aristoteles, De anima, III,8; 432a,7-9, translatio Latina Guillelmo de Moerbeke interprete, ed. Leonina, p. 235b,5-7 [= Sentencia libri tertii de anima, cap. 7]): Et ob hoc neque non senciens nichil, nichil utique addiscet neque intelliget, set cum speculetur, necesse simul fantasma aliquod speculari. Cf. ibid., III,7; 431,16s. (ibid., p. 229a,15s. [= Sentencia libri tertii de anima, cap. 6]): propter quod nequaquam sine fantasmate intelligit anima. Cf. Les auctoritates Aristotelis, ed. Hamesse, p. 188,9 (Auctoritates III libri Aristotelis De anima, 167): Necesse est quemcumque intelligentem phantasmata speculari.

C OMMENTARY

1 2 3 4 5 6 7 8

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀅󰀉

Tunc ulterius est notandum quod ille intellectus est solus vel dicitur ›solus‹ cui nihil correspondet ex parte rei vel extra, sicut intellectus figmentorum. Unde intellectui figmentorum nihil correspondet extra intellectum, et ideo dicitur ›solus‹, quia nihil respicit extra. Sed intellectus nudus dicitur ille qui non est vestitus speciebus intelligibilibus, sicut intellectus pueri in prima sui creatione est tamquam tabula rasa, in qua nihil est depictum. Sic etiam intellectus dicitur esse nudus qui caret speciebus intelligibilibus et nihil cognoscit in actu. Sed intellectus purus est qui depuratus ab omnibus fantasmatibus et organo corporali non est alligatus. Et talis intellectus est Dei, quia cognoscit absque organo corporali.

(vide supra, p. 256)

8 Dei] add. Dei (exp.) L

󰀂󰀆󰀀

A NDRÉS Q UERO -S ÁNCHEZ

1

His praenotatis, quando primo quaeritur //E 2ra// utrum universalia subsistant in rerum

2

natura praeter operationem intellectus vel sint in intellectu, si quaestio quaerit ut universale

3

nominat rem subiectam intentioni universalitatis, dicendum quod subsistunt in re extra, quia quod dicit totam essentiam alicuius est in eo, quia essentia non separatur ab eo cuius est essentia. Sed universale sic acceptum dicit totam essentiam rei extra, ut Sortes est animal vel Sortes est homo; ergo universale ut sic subsistit in re extra.

4 5 6

1 utrum] om. E 1 subsistant] subsistentia E 2 intellectu] add. solum E 2 quaestio quaerit] quaerat quaestio de universali E 2 ut] utrum E 2 universale (coni.)] om. E, M 3 subsistunt] subsistit E 5-6 animal vel Sortes est homo] inv. (homovel [sup. lin.] Sortes est animal) E 6 ut] om. E

C OMMENTARY

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀆󰀁

1

Modo his visis possumus respondere ad quaestionem quae est utrum universalia sint

2

subsistentia in re extra intellectum. Dico quod universale dupliciter accipitur, ut iam pertractum

3

est. Si enim accipitur pro re subiecta intentioni, tunc dico quod illud habet subsistentiam extra intellectum. Et hoc probatur, quia quidquid ponitur de singularibus et de rebus quae sunt extra

4

7

intellectum praedicatione dicente: ›Hoc est huiusmodi‹, hoc etiam habet subsistentiam extra intellectum. Sed universale pro re subiecta ponitur de singularibus et de rebus quae sunt extra intellectum; ergo et ipsum habet subsistentiam extra intellectum. Maior patet, quia quidquid de

8

rebus extra intellectum praedicatur ut de particularibus praedicatione dicente: ›Hoc est huiusmodi‹, hoc est

9

extra intellectum et non praedicatur nisi cum ipso de quo praedicatur sit idem essentialiter. Quia

10

quidquid ponitur de alio praedicatione dicente: ›Hoc est huiusmodi‹, hoc etiam habet esse in eo, quia nihil praedicatur de alio nisi sit in eo et habeat esse in eo. Sed universale pro re subiecta praedicatur de rebus extra intellectum ut de singularibus et particularibus praedicatione dicente: ›Hoc est hoc‹ – ut ›Sortes est homo‹, vel: ›Hic lapis est lapis‹ et sic de aliis –, et per consequens habet esse in eis, et cum sint subsistentia extra intellectum et etiam habet extra subsistentiam, cum praedicatur de illis, et per consequens habet esse in eis.

5 6

11 12 13 14 15

1 possumus (coni.)] possimus L 4 et (coni.)] om. L 8 intellectum praedicatur (coni.)] om. L 8 praedicatione dicente ›hoc est huiusmodi‹] om. L 9 non praedicatur nisi (coni.)] om. L 9 de quo praedicatur (coni.)] om. L

16

󰀂󰀆󰀂 1 2 3 4 5 6 7 8 9 10

A NDRÉS Q UERO -S ÁNCHEZ

Si autem quaestio quaerat de universali ut nominat intentionem secundam, dicendum est quod est in intellectu, quia quod est operatum ab intellectu speculativo »manet in intellectu, quia eius operatio non transit in rem«, secundum Philosophum, 9° Metaphysicae. Sed universale pro intentione est huiusmodi, quia secundum Themistium, 3° De anima, »universalia sunt quidem conceptus quos anima in se congregat et thesaurizat et colligit«; ergo universale ut sic est in intellectu. Sed de hoc quod Porphyrius quaerit utrum universalia sint in intellectu solo nudo puro, dicendum quod non in intellectu solo, quia intellectui solo nihil correspondet in re extra, sed universalibus correspondet in re extra quaedam apparientia sive proprietates reales, scilicet aptitudo vel respectus ad plura supposita.

1 quaestio quaerat] inv. E 1 est] om. E 2 est (i)] om. E 2-3 manet in intellectu, quia eius operatio non transit in rem, secundum Philosophum, 9° Metaphysicae] eius operatio non transit in materiam extra secundum Philosophum in 9° Metaphysicae illud est in intellectu E 4 3°] super 3° E 5 quidem] quaedam E 5 congregat et] om. E 5 ergo] om. E 7 nudo] numero (del.) nudo M 8 non] add. sunt E 8 intellectui] in intellectu E 9 proprietates reales] proprietas realis E 10 aptitudo] habitudo E

2-3 secundum Philosophum, 9° Metaphysicae] Cf. Aristoteles, Metaphysica, IX,8; 1050a30-b1, translatio Latina Guillelmo de Moerbeke interprete, ed. Vuillemin-Diem, pp. 189,303-190,308: Quorumcumque ergo aliquid alterum est quod fit preter usum, horum actus in facto est, ut edificatio in edificato et contextio in contexto; similiter autem et in aliis, et totaliter motus in eo quod mouetur. Quorum uero non est aliud aliquod opus preter actionem, in ipsis existit actio, ut uisio in uidente et speculatio in speculante et uita in anima (quare et felicitas; uita namque qualis quedam est). Cf. Les auctoritates Aristotelis, ed. Hamesse, p. 134,8-11 (Auctoritates IX libri Metaphysicae, 226): Duplex est actio: quaedam est transiens in materiam extra ut aedificatio et illa dicitur factio vel operatio factiva, quaedam est imminens sive intra manens in operante et est visio vel intellectio et illa dicitur actio activa. Cf. Thomas de Aquino, In libros Metaphysicorum, IX, lect. 8, ed. Cathala / Spiazzi, p. 448a,1-18 (n. 1865): Sed, quando non est aliquod opus operatum praeter actionem potentiae, tunc actio existit in agente et ut perfectio eius, et non transit in aliquid exterius perficiendum; sicut visio est in vidente ut perfectio eius, et speculatio in speculante, et vita in anima, ut per vitam intelligamus opera vitae. Unde manifestum est, quod etiam felicitas in tali operatione consistit, quae est in operante, non quae transit in rem exteriorem, cum felicitas sit bonum felicis, et perfectio eius. Est enim aliqua vita felicis, scilicet vita perfecta eius. Unde sicut vita est in vivente, ita felicitas in felice. Et sic patet quod felicitas non consistit nec in aedificando, nec in aliqua huiusmodi actione, quae in exterius transeat, sed in intelligendo et volendo. 4-5 secundum Themistium, 3° De anima] Cf. Themistius, In De anima, translatio Latina Guillelmo de Moerbeke interprete, III,5, ed. Verbeke, p. 130,93s.: conceptus enim scibilia sunt quae universalia, quae quidem ipsa colligit et seipsa thesaurizat.

11

C OMMENTARY

1 2

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀆󰀃

Sed si universale accipitur pro intentione secunda universalitatis, tunc dico quod non habeat subsistentiam extra intellectum, sed esse habet in intellectu.

3

Sed quando tu quaeris utrum sint in intelligentibus solis vel nudis vel puris, dico quod in

4

nullo illorum, sed in eorum oppositis, ut in intelligentibus non solis et non nudis et non puris.

5

Et huius ratio est quia intellectus solus est qui nullam rem respicit extra vel rei nihil correspondet

6

extra intellectum, ut intellectus aliquorum figmentorum, quia figmentis nihil correspondet extra

7

intellectum. Sed quia intentionibus secundis universalitatis correspondet aliquid extra

8

intellectum, ut respectus vel habitudo ad sua supposita – aliter enim essent figmenta –, ideo ipsa

9

sunt in intelligentibus non solis. Est autem intellectus non solus, qui respicit et cui correspondet aliqua proprietas vel aliquid huius extra intellectum; ideo etc. Cum enim tunc universali pro intentione secunda aliquid correspondeat extra intellectum, ut respectus vel habitudo rei, ergo ipsa sunt in intellectu non solo.

10 11 12

3 quaeris (coni.)] dicis L 8 ideo (coni.)] sed L

5 rem (coni.)] om. L

6 ut intellectus aliquorum (coni.)] et pro (dub) intelligit L

󰀂󰀆󰀄 1 2

3 4 5 6 7

A NDRÉS Q UERO -S ÁNCHEZ

Item. Universalia non sunt in intellectu nudo, quia supposito quod universalia sint in intellectu, iam intellectus non est nudus, sed speciebus intelligibilibus vestitus.

Item. Universalia non sunt in intellectu puro sive divino, quia universale logicum non est aliud quam conceptus rei in habitudine et respectu ad sua supposita, et ab illo respectu et habitudine ad sua supposita absolvi non potest. Talem autem habitudinem et respectum non est ponere in intellectu divino ut in intellectu Dei, quia Deus intelligit per suam essentiam; ideo etc.

2 intelligibilibus (E)] add. est M 4 illo] isto E 5 sua] om. E

3-4 non est aliud (E)] om. M 6 ideo] ergo E

4 et (i)] vel E

C OMMENTARY

1 2

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀆󰀅

Sed universalia non sunt in intelligentibus nudis, cum intellectus nudus non est vestitus speciebus intelligibilibus, ut est intellectus pueri in prima sui creatione. Cum intellectus in quo

7

sint intentiones sit vestitus ipsis intentionibus universalibus quae sunt species intelligibiles, et ergo ipsa non sunt in intellectu nudo, sed non nudo, cum intellectus non nudus sit vestitus et informatus speciebus intelligibilibus. Nec etiam sunt universalia in intellectu puro, sed in suo opposito, scilicet in intellectu non puro. Quia intellectus purus est qui est depuratus ab omni fantasmata et organo corporali non

8

est alligatus. Ø Talis intellectus est primae causae, quia omnia cognoscit absque fantasmata et

9 10

non est alligatus organo corporali. Sed ita non sunt in intellectu non puro, quia ille intellectus est humanus, quia ille intellectus intelligit vel cognoscit universalia praeexsistente fantasmata

11

et hac virtute intus agentis, qui abstrahit ab hoc vel ab alio rem conceptam per fantasmatam,

12

quia intellectus humanus nihil intelligit nisi per fantasmata intelligat, quia nihil est in intellectu

13

nisi prius fuerit in fantasmata, quia necesse est omnem intelligentem fantasmata speculari. Unde

14

nihil aliud est quam quidam intellectus procedens a sensibus. Et ita universalia sunt in intellectu

15

non puro, quia alligatur organo corporali. Unde non est intelligendum quod anima habeat

16

proprium organum, sed habet organum corporale pro obiecto. Et sic prima quaestio est soluta.

3 4 5 6

17

8 Ø (coni.)] quia L

11 ab (coni.)] ad L

12 nisi (coni.)] om. L

14 quidam (coni.)] quod L

Thomas von Erfurt Kommentar zu Porphyrios’ ›Isagoge‹ (Commentum in Isagogas Porphirii): Edition und deutsche Übersetzung des einleitenden Teils (VON ANDRÉS QUERO-SÁNCHEZ)

Einleitung Vom Kommentar des Thomas von Erfurt zum Isagoge des Porphyrios sind allein drei Handschriften bekannt, welche zwei verschiedene Fassungen – ich nenne sie α-Fassung bzw. β-Fassung – des Werkes überliefern: – α-Fassung. Zwei bekannte Handschriften: o E Erfurt, Amploniana CA 󰀄° 󰀂󰀆󰀆, fol. 󰀁-󰀇. Beschreibung: Pergament, 󰀄󰀆 Blätter. Mitte des 󰀁󰀄. Jahrhunderts. Ein Papier-Zettel aus dem 󰀁󰀅. Jahrhundert enthält ein Inhaltsverzeichnis, in dem die uns beschäftigende Schrift Glosa bona super Porphirium genannt wird.󰀁 o M München, Bayerische Staatsbibliothek, Clm. 󰀄󰀃󰀇󰀈, 󰀄°, fol. 󰀁r-󰀂󰀈v. Beschreibung. Papier, 󰀁󰀀󰀆 Blätter. Auf fol. 󰀁r heißt es (von zeitgenössischer Hand, wohl vom Schreiber selbst, notiert): Commentum Magistri Thomae in Isagogas Porphirii. Commentum Magistri Thomae in Praedicamenta Aristotelis. Eine spätere Hand fügt unten noch hinzu: ... in Erfordia apud Scotos quandoque regentis. Auf fol. 󰀆󰀆v lesen wir als Explicit des Kategorien-Kommentars und damit des ganzen Thomas-Teils noch Folgendes: Explicit 󰀁. Vgl. Wilhelm Schum, Beschreibendes Verzeichnis der Amplonianischen Handschriften-Sammlung zu Erfurt (Berlin, 󰀁󰀈󰀈󰀇), 󰀅󰀁󰀁.

󰀂󰀆󰀈

A NDRÉS Q UERO -S ÁNCHEZ

expositio bona et utilis super librum Praedicamentorum Aristotelis edita a magistro Thoma – scripta a Petro anno Domini 󰀁󰀃󰀄󰀃 in Nürnberg, anno suae aetatis 󰀂󰀀 – et eiusdem dicta super Porphyrium etc. Puntschuch. Obwohl die Beschreibung von Karl Halm, Georg von Laubmann und Wilhelm Meyer von einem Codex aus dem 󰀁󰀅. Jahrhundert spricht,󰀂 ist der Thomas-Teil also zweifelsohne früheren Datums (󰀁󰀃󰀄󰀃). – β-Fassung. Einzig bekannte Handschrift: o L Leipzig, Universitätsbibliothek, Ms. 󰀁󰀃󰀅󰀆, fol. 󰀁-󰀈. Beschreibung: Pergament, 󰀆󰀀 Blätter (󰀃󰀅 × 󰀂󰀆). Die Handschrift enthält zwei Teile. Der uns interessierende erste Teil (fol. 󰀁r-󰀂󰀈v) ist im 󰀂. Drittel oder 󰀃. Viertel des 󰀁󰀄. Jahrhunderts entstanden. Zum Schluss des Isagoge-Kommentars des Thomas von Erfurt, auf fol. 󰀈r, heißt es jedoch (allerdings von einer späteren Hand nachgetragen): anno Domini 󰀁󰀄󰀇󰀆. Provenienz: Aus der Philosophischen Fakultät der Universität Leipzig; bereits 󰀁󰀄󰀈󰀀 im Bestand der Fakultät nachweisbar. Mit der Bibliothek der Philosophischen Fakultät 󰀁󰀆󰀈󰀃 in den Bestand der Universitätsbibliothek Leipzig (Bibliotheca Paulina) überführt.󰀃 Die α-Fassung war sicherlich vom Autor selbst für die Veröffentlichung vorbereitet. Sie lässt sich mit Hilfe der zwei erhalten gebliebenen Handschriften (E und M) sehr gut herstellen. Die Unterschiede zwischen E und M sind nicht gravierend. Beide Textzeugen dürften, wie es scheint, um die Mitte des 󰀁󰀄. Jahrhunderts entstanden sein.󰀄 Ich habe mich für M als Leithandschrift entschieden, da E einige wenige Auslassungen aufweist. Die E-Varianten führe ich im Apparat vollständig aus. Weiche ich im Text von M ab, so wird dies durch Kursivierung gekennzeichnet. Die M-Lesart wird dann im Apparat angeführt. Die (wenigen) nötigen Konjukturen werden durch eine besondere Schriftart (Old English Text) gekennzeichnet. 󰀂. Vgl. Karl Halm, Georg von Laubmann und Wilhelm Meyer, Catalogus codicum latinorum Bibliothecae Regiae Monacensis, Ed. altera emendatior, Bd. 󰀁,󰀂: Codices num. 󰀂󰀅󰀀󰀁-󰀅󰀂󰀅󰀀 Compl. (München, 󰀁󰀈󰀉󰀄), 󰀁󰀈󰀂: ‚[Clm.] 󰀄󰀃󰀇󰀈 (Aug[sburg] S. Ulr[ich und Afra] 󰀇󰀈) 󰀄°. S. XV. 󰀁󰀀󰀆 fol.‘. 󰀃. Vgl. Katrin Sturm, ‚Kurzbeschreibung zu Ms 󰀁󰀃󰀅󰀆, erstellt im Rahmen des DFG-Pilotprojekts Bestandslistenerfassung und Digitalisierung von Handschriften der UB Leipzig aus dem Bestandssegment ohne publizierten Nachweis‘, online verfügbar unter: http://www.manuscripta-mediaevalia.de/dokumente/ html/obj󰀃󰀁󰀅󰀇󰀇󰀆󰀇󰀇. 󰀄. Siehe oben, 󰀂󰀆󰀈.

C OMMENTARY

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀆󰀉

Parallel wird die Handschrift L transkribiert als der einzig erhalten gebliebene Textzeuge der β-Fassung, welche sicherlich im Zusammenhang mit der Vorlesungstätigkeit des Thomas von Erfurt zu betrachten ist und wohl – wobei dies noch näher zu untersuchen sein wird – v o r der zur Publikation vorbereiteten α-Fassung entstanden ist. Geht L auf Vorlesungsnachschriften zurück? Oder geht sie auf das Vorlesungsmanuskript des Thomas von Erfurt selbst zurück? Die erste Hypothese scheint mir wahrscheinlicher zu sein. Der Text enthält jedenfalls viele Auslassungen und Fehler, von denen einige gravierend sind.󰀅 Durch den Vergleich mit der α-Fassung kann man allerdings – mit Hilfe von nicht wenigen Konjukturen, die wiederum durch eine besondere Schriftart (Old English Text) gekennzeichnet werden – einen gut lesbaren Text herstellen. Im Apparat werden dann die Konjukturen begründet sowie die offensichtlich fehlerhafte L-Lesart angegeben. Abkürzungen add. cf. cf. loc. infra coni. corr. corr. ex dub. in marg. in marg. inf. in marg. sup. inv. l. om. rec. sup. lin. L󰀁 L󰀂

addidit confer confer locum infra coniecit correxit correxit ex dubitanter in margine in margine inferiore in margine superiore invertit lege omisit recensio supra lineam (eine vom L-Schreiber verschiedene Hand in L) (eine sowohl von L-Schreiber als auch von der L󰀁-Hand verschiedene Hand in L)

󰀅. Siehe z.B. unten, 󰀂󰀈󰀅,󰀄-󰀅: Et dicitur a ‚moechor‘, ‚moecharis‘, quod est ‚adulteror‘,‚adulteraris‘ (l. ‚adultero‘, adulteras‘).

Thomas de Erfordia

Commentum in Isagogas Porphirii (Commentum in Porphyrii Isagogen – Expositio Porphyrii – Glosa bona super Porphyrium – Dicta super Porphyrium)

Kommentar zu Porphyrios’ ›Isagoge‹

Edition und deutsche Übersetzung des einleitenden Teils (Einteilung der Wissenschaften) von Andrés Quero-Sánchez, Erfurt

󰀂󰀇󰀂

A NDRÉS Q UERO -S ÁNCHEZ

0DJLVWHU7KRPDV>GH(UIRUGLD@ &RPPHQWXPLQ,VDJRJDV3RUSKLULL Commentum in Porphyrii Isagogen – Expositio Porphyrii± Glosa bona super Porphyrium±Dicta super Porphyrium   ɲ)DVVXQJ(0     0U (UD ,QFLSLW ([SRVLWLR 3RUSK\ULL &DSLWXOR GH PRYHQWH LQQXLW 3KLORVRSKXV ƒ De anima TXRG ªXQXPTXRGTXHQDWXUDOLWHUGHEHWUHJLDEHR TXRGVXSUHPXPHVWLQLSVR©  (W LOOXG SULPR SDWHW LQ VSKDHULV FDHOHVWLEXV LQWHU TXDV VSKDHUD VXSHULRU PRYHWHWUHJLWLQIHULRUHV

              

0DJLVWHU7KRPDV>YRQ(UIXUW@ Kommentar zu PorphyriosҲ›Isagoge‹  'HXWVFKHhEHUVHW]XQJGHUɲ)DVVXQJ>(0@   (V IlQJW >KLHUPLW@ GHU .RPPHQWDU ]X 3RUSK\ULRV‫ތ‬Isagoge ,P .DSLWHO EHU GDV %HZHJHQGH LP GULWWHQ%XFKÜber die SeeleVDJW$ULVWRWHOHV GDVV ªHLQ MHGHV 'LQJ QDWUOLFKHUZHLVH YRQ GHP ZDV LQ LKP GDV +|FKVWH LVW JHOHLWHW ZHUGHQVROO© 'DV LVW GHXWOLFK ± HUVWHQV ± EHL GHQ KLPPOLVFKHQ6SKlUHQGHU)DOOEHLGHQHQGLH K|FKVWH GLH LKU XQWHUVWHKHQGHQ EHZHJW XQG OHLWHW

     Porphyrii@RP(Assit principio sancta Maria meoDGGLQPDUJVXS ( primo patet@LQY( sphaeris@rebus( superior@GXE(    ƒ De anima@ 9JO $ULVWRWHOHV De anima ,,, D ODW hEHUV YRQ :LOKHOP YRQ 0RHUEHNH LQ 7KRPDVYRQ$TXLQSentencia libri De animaLQOpera omniaHG/HRQLQD %G5RP3DULV E Vincit autem aliquando et mouet deliberationem, aliquando autem mouet se ipsum, sicut sphera, appetitus appetitum, cum in continentia fuerit. Natura autem semper que sursum principalior est et mouet, ut tribus lationibus iam mouentur 9JO $OEHUWXV 0DJQXV De anima HG YRQ &OHPHQV 6WURLFN LQ Opera omnia HG &RORQLHQVLV %G0QVWHU Et secundum naturae ordinem motus superioris motoris semper est principalior, et quando motus egreditur ab illo, tunc sunt opera ordinata. Quando autem vincit inferior, tunc egreditur opus perversus 9JO LELG  LELG  9JO 7KRPDV YRQ $TXLQ Sentencia libri De animaHG/HRQLQD Deinde cum dicit: Vincit autem, ostendit quomodo deliberatio rationis uincatur ab appetitu inferiori. Et dicit quod [aliquando] appetitus inferior, qui est sine deliberatione, uincit deliberationem et remouet hominem ab eo quod deliberauit, aliquando autem e conuerso appetitus mouet appetitum, scilicet superior qui est rationis deliberantis eum qui est fantasie sensibilis, sicut in corporibus celestibus spera superior mouet inferiorem, quod accidit cum aliquis continens fuerit: continentis enim est per deliberationem rationis uincere impetum passionis. Et iste est naturalis ordo ut appetitus superior moueat inferiorem, ita quod inferior moueatur tribus motibus localibus >@et similiter appetitus inferior, etsi aliquid de motu proprio retineat mouetur tamen naturali ordine motu appetitus superioris et motu rationis deliberantis. Si autem e conuersoaccidat quod appetitus superior transmoueatur ab inferiori, est preter ordinem naturalem; unde et hoc facit peccatum in moribus, sicut monstra sunt peccata in natura

C OMMENTARY

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀇󰀃

ɴ)DVVXQJ/  

ϭ Ϯ ϯ ϰ

ϱ ϲ ϳ

/UD       &RPPHQWXPLQ3RUSK\ULLIsagogen  3KLORVRSKXVGLFLWƒDe animaFDSLWXORGHPRYHQWHª8QXPTXRGTXHGHEHWUHJLDEHR TXRGVXSUHPXPHVWLQHR©/LFHWHQLPLVWDSURSRVLWLRSHUVHVLWPDQLIHVWDSRWHVWWDPHQGHFODUDUL DOLTXDOLWHU3ULPRHQLPGHFODUDWXUDVSKDHULVFDHOHVWLEXVVHFXQGRDVSKDHULVHOHPHQWDULEXV   3ULPR HQLP GHFODUDWXU D VSKDHULV FDHOHVWLEXV 4XLD YLGHPXV VHPSHU TXRG VSKDHUD FDHOHVWLVLQIHULRUUHJLWXUHWJXEHUQDWXUDVXSHULRULVSKDHUDHWVHPSHUVXSHULRUVSKDHUDFDHOHVWLV UHJLWLQIHULRUHPVSKDHUDPHWGHVFHQGHQGRGRQHFDGXOWLPDP                     Commentum in Porphyrii Isagogen@LQPDUJVXS/ 

󰀂󰀇󰀄

A NDRÉS Q UERO -S ÁNCHEZ

(WVSKDHUDHHWLDPHOHPHQWDUHVTXDH VXQW LQILPDH PRYHQWXU HW UHJXQWXU D VSKDHULV FDHOHVWLEXV WHVWH 3KLORVRSKR SULPR Meteororum XEL GLFLW TXRG ªiste mundus LQIHULRU FRQWLJXXV HVW VSKDHULV FDHOHVWLEXV XW RPQLV YLUWXV MQ][ LQGH JXEHUQHWXUHWUHJDWXU©

          

8QG DXFK LP )DOO GHU GLH :HOW GHU (OHPHQWHEHWUHIIHQGHQ6SKlUHQYHUKlOWHVVLFK VRGDVVGLHMHQLJHQGLHJDQ]XQWHQVWHKHQYRQ GHQKLPPOLFKHQ6SKlUHQEHZHJWXQGJHOHLWHW ZHUGHQ 'DYRQ JLEW $ULVWRWHOHV LP HUVWHQ %XFKGHUMeteora=HXJQLVZHQQHU>QlPOLFK@ VDJWGDVVªGLHVHXQWHQVWHKHQGH:HOWPLWGHQ KLPPOLVFKHQ 6SKlUHQ ]XVDPPHQKlQJW VR >QlPOLFK@ GDVV MHJOLFKH GLH (OHPHQWH EHWUHIIHQGH .UDIW YRQ GRUW DXV UHJLHUW XQG JHOHLWHWZLUG©

                      moventur@movetur(  teste@testante( iste mundus( @ille motus0 est@RP(  eiusFRQL @eorum(0     Philosopho, primo Meteororum@ 9JO $ULVWRWHOHV Meteorologica Meteora  ,  D ODWHLQLVFKH hEHUVHW]XQJYRQ:LOKHOPYRQ0RHUEHNDHGYRQ*XGUXQ9XLOOHPLQ'LHP%UVVHO $ULVWRWHOHV/DWLQXV  Est autem ex necessitate continuus iste superioribus lationibus, ut omnis ipsius virtus gubernetur inde9JOAuctoritates Aristotelis et aliorum philosophorumHGYRQ-DFTXHOLQH+DPHVVHAuctoritates Aristotelis: Un florilège médiéval. Étude historique et édition critique/RXYDLQ3DULV MeteoraQTotus mundus sensibilis contiguus est lationibus superioribus caeli sensibilis ut inde tota ejus virtus gubernetur

C OMMENTARY

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

LQIHULRUHPHWLWDGHVFHQGHQGRGRQHFDGXOWLPDPVSKDHUDP  

ϯ

󰀂󰀇󰀅

6HFXQGRHQLPYLGHPXVTXRGVHPSHUVSKDHUDMTMUMV\IZQ[VXSHULRUUHJLWVSKDHUDPMTMUMV\IZMU

ϭ Ϯ

ON

  (WLWDDSSDUHWTXRGXQXPTXRGTXHLQIHUQLXVGHEHWUHJLDVXSHULRUHTXRGHVWLQHR                                elementarisFRQL @elementalis/&IĂ5HFEt sphaerae etiam elementares elementaremFRQL @elementalem/&IĂ5HFEt sphaerae etiam elementares

󰀂󰀇󰀆

A NDRÉS Q UERO -S ÁNCHEZ



+RF HWLDP LGHP SDWHW VHFXQGR LQ  TXROLEHWDOLRUHJLPLQHEHQHRUGLQDWRXWLQ  UHJLPLQHFLYLWDWLVGRPXVHWDOLLVKXLXVPRGL    

'DVVHOEH ZLUG ± ]ZHLWHQV ± DXV GHU %HWUDFKWXQJ MHJOLFKHU DQGHUHQ ZRKO JHRUGQHWHQ5HJLHUXQJVEHUHLFKHGHXWOLFKHWZD GHU 5HJLHUXQJ GHU 6WDGW GHV SULYDWHQ +DXVKDOWVXQGlKQOLFKHU%HUHLFKH

                               etiam idem@LQY(  civitatis@DGGin regimine(

patet secundo@LQY(  regimineGXE0 @regere(  aliis huiusmodi@ in aliis(

C OMMENTARY

ϭ Ϯ ϯ ϰ ϱ ϲ ϳ ϴ ϵ ϭϬ ϭϭ ϭϮ

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀇󰀇

6LPLOLWHUHWLDPLVWDSURSRVLWLRSRWHVWGHFODUDULH[UHJLPLQHFLYLOL4XLDVLUHJLPHQFLYLOH HVWGHELWXPHWRUGLQDWXPWXQFVHPSHULQIHULRUHVDSSHWXQWUHJLDVXSHULRULEXVVLFXWRPQHVTXL VXQWLQGRPRGHEHQWUHJLDEDOLTXRVXSUHPRLOOLXVGRPXVTXRGHVWSDWHUIDPLOLDVVLYHUHFWRU GRPXV 4XLD SDWHU IDPLOLDV H[LVWHQV WDPTXDP VXSUHPXP UHJLW IDPLOLDP HW DOLD TXDH VXQW LQ GRPR 6LPLOLWHU LQ UHJLPLQH FLYLWDWLV VHPSHU HVW DOLTXLG VXSUHPXP TXRG UHJLW HW SURYLGHW RPQLEXVFLYLEXVVLFXWTXDHVXQWLQFLYLWDWH 6LFLJLWXUDSSDUHWSURSRVLWLRGHFODUDWD 5HVXPRHUJRTXRGXQXPTXRGTXHGHEHWUHJLDVXSUHPRTXRGHVWLQHR +RFHWLDPSDWHWH[LQWHQWLRQH3KLORVRSKLSULPRMeteororum,ELHQLPGLFLWTXRGªLQIHULRU PXQGXVHVWFRQWLJXXVODWLRUVXSHULRUL©LGHVWªFRUSRULFDHOHVWL©LGHVWYLUWXVLQGHVXPLWXUTXD JXEHUQDWXU 5HVXPRHUJRTXRGXQXPTXRGTXHGHEHWUHJLHWJXEHUQDULDVXSUHPRTXRGHVWLQHR

󰀂󰀇󰀈

A NDRÉS Q UERO -S ÁNCHEZ

+DHFDXWHPVXSUHPDYLUWXVLQKRPLQH  HVW UDWLR [Q^M LQWHOOHFWXV HUJR RSRUWHW XW   KRPRDUDWLRQHHWLQWHOOHFWXUHJDWXU  8QGH ƒ Ethicorum GLFLWXU TXRG ªTXHPDGPRGXPRSRUWHWSXHUXPVHFXQGXP SUDHFHSWXP SDHGDJRJL YLYHUH VLF HUJR RSRUWHWFRQFXSLVFLELOHUDWLRQLFRQIRUPDUH© (W H[ KRF HVW TXRG TXLGDP KRPLQHV GLFXQWXU EUXWDOHV YHO EHVWLDOHV TXLD QRQ UHJXQW VH VHFXQGXP UDWLRQHP HW LQWHOOHFWXP &RQWUD TXRV &RPPHQWDWRU LQYHKLWXU±GLFLWª9DHYRELVTXLLQVRUWHP EHVWLDUXP HVWLV GHSXWDWL LOOXG TXRG HVW GLYLQXP LQ YRELV GHUHOLQTXHQWHV VFLOLFHW LQWHOOHFWXP©

               

'LHVHVK|FKVWH9HUP|JHQLVWQXQ LP 0HQVFKHQGLH9HUQXQIWRGHUGHU,QWHOOHNW(V JHK|UWVLFKDOVRGDVVGHU0HQVFKVHLQ/HEHQ LP6LQQHGHU9HUQXQIWXQGGHV,QWHOOHNWVIKUW 'DKHU ZLUG LP GULWWHQ %XFK GHU Nikomachischen EthikJHVDJWGDVVªVRZLHHV VLFK JHK|UW GDVV GDV .LQG LP 6LQQH GHU $QZHLVXQJGHV/HKUHUVOHEWVRJHK|UWHVVLFK >DXFK@ GDVV GDV 6LQQOLFKH LP 6LQQH GHU 9HUQXQIW JHVWDOWHW ZLUG© 8QG GDUDXV HUNOlUW VLFK GDVV JHZLVVH 0HQVFKHQ DOV ÃXQYHUQQIWLJH 7LHUHµ EH]HLFKQHW ZHUGHQ ZHLO VLH >QlPOLFK@ LKU /HEHQ QLFKW LP 6LQQH GHU9HUQXQIWXQGGHV,QWHOOHNWVIKUHQ6ROFKH 0HQVFKHQ NULWLVLHUW $YHUURHV PLW IROJHQGHQ :RUWHQ ª:HKH HXFK GLH LKU GHVZHJHQ IU XQYHUQQIWLJH 7LHUH ]X KDOWHQ VHLG ZHLO LKU GDVMHQLJH ZDV LQ HXFK J|WWOLFK LVW QlPOLFK GHQ,QWHOOHNWYHUQDFKOlVVLJW©

  siveFRQL @RP(0&I/Et licet homo habeat multas potentias et virtutes, tamen supremum in homine est intellectus sive ratio   Haecautem suprema virtus in homine est ratio et intellectus, ergo oportet ut homo a ratione et intellectu regatur@RP(   ergo@RP(  conformare@consonare( estis deputati@computati estis( illud quod est divinum in vobis@ illud divinum quod in vobis est (   3° Ethicorum@9JO$ULVWRWHOHVEthica Nicomachea,,,EODWHLQLVFKHhEHUVHW]XQJYRQ5REHUW*URVVHWHVWH HGYRQ5HQp$QWKRLQH*DXWKLHU/HLGHQ%UVVHO Aristoteles Latinus>Recensio pura@ Quemadmodum enim puerum oportet secundum preceptum pedagogi vivere, sic et concupiscibile consonare recioni Recensio recognitaHG 5$*DXWKLHU>/HLGHQ%UVVHO@>Aristoteles Latinus@  Commentator invehitur@9JO%RHWKLXVYRQ'DFLHQDe summo bonoHGYRQ1**UHHQ3HGHUVHQLQOpera%G Opuscula.RSHQKDJHQ Contra quos exclamat Philosophus dicens: ‚Vae vobis homines qui computati estis in numero bestiarum ei quod in vobis divinum est non intendentes!‘. Divinum autem in homine vocat intellectum%RHWKLXVµ 4XHOOHLVWZRKO$OEHUWGHU*UR‰HYJO$OEHUWXV0DJQXVPoliticaHGYRQ$XJXVWH%RUJQHWLQOpera omnia%G3DULV   E Et Averroes: ‚Væ vobis hominibus qui computati estis in numerum bestiarum, et laboratis servitute reciproca, ut ex vobis nascatur liber‘LGEthicaHGYRQ$XJXVWH%RUJQHWLQOpera omnia%G3DULV D Unde optime dixit Averroes philosophus: ‚Væ vobis hominibus qui computati estis in numerum bestiarum, et laboratis servitute reciproca, ut ex vobis nascatur liber‘ 6LHKH DXFK LG Metaphysica HG YRQ %HUQKDUG *H\HU LQ Opera omnia HGLWLR &RORQLHQVLV %G0QVWHU Haec enim est etiam causa, quod fere totus mundus scientiis utilium deditus est, eo quod omnes lucris et pauci intendant his quae sunt per se causa sciendi, quae tamen sola humana sunt, secundum quod homo tantum est intellectus, sicut in ethicis est determinatum. Propter quod etiam dicit Avenzoreth fere omnes homines, exceptis paucis honorandis viris, esse computandos in numerum bestiarum‘LELGPropter quod quidam sacerdotum Arabiae fertur dixisse: ‚Vae vobis homines, qui computati estis in numerum bestiarum et laboratis servitute reciproca, ut ex vobis nascatur liber‘LGSuper EthicaHGYRQ:LOKHOP.EHOLQOpera omnia(GLWLR&RORQLHQVLV %G0QVWHU  Praeterea, Avemoret dicit:‚Vae vobis, homines, qui computati estis in numero bestiarum, mutua servitute laborantes, ut ex vobis nascatur liber‘ 9JO 7KRPDV 5LFNOLQ Ã9RQ GHQ beatiores philosophi ]XP optimus status hominis =XU (QWUDGLNDOLVLHUXQJGHUUDGLNDOHQ$ULVWRWHOLNHUµLQ-DQ$$HUWVHQXQG$QGUHDV6SHHUHGV Geistesleben im 13. Jahrhundert %HUOLQ1HZMHGRFK@QLFKWGDV >YRQ HLQHU VROFKHQ .UDIW@ *HRUGQHWH XQG *HIKUWH© ± >XQG@ GD GLH 9HUQXQIW GLH OHLWHQGH ,QVWDQ] LP 0HQVFKHQ LVW GHVKDOE JHK|UW HV VLFK GDVV GHU 0HQVFK :LVVHQ HUZLUEW 8QG GDKHU ZLUG GHXWOLFK GDVV GHU 0HQVFK :LVVHQ HUZHUEHQ VROO GDPLW HU VHLQ /HEHQDXIHLQH>ZRKO@JHRUGQHWH:HLVHIKUHQ NDQQ

                            ordo@ordinatio vel ordo(  scientia et sapientia@LQYsapientia et scientia ( regere et ordinare@ordinare et regere aliud(  ideo@ita( homo@hocGXE (   ut scribitur primo Metaphysicae@9JO$ULVWRWHOHVMetaphysica,DODWHLQLVFKHhEHUVHW]XQJYRQ :LOKHOPYRQ0RHUEHNDHGYRQ*XGUXQ9XLOOHPLQ'LHP/HLGHQ1HZKLQJHJHQ@ YRQ GHQ 'LQJHQYHUXUVDFKWZLUG©±HLQJHWHLOW   8QWHU GHQ PHQVFKOLFKHQ :LVVHQVFKDIWHQVLQG>QXQ@HLQLJHQXW]ORVXQG YHUERWHQ ZLH HWZD GLH PDJLVFKHQ :LVVHQVFKDIWHQDQGHUHVLQGDEHUQW]OLFKXQG Q|WLJ

                                autem@RP(  est causa( @sunt causae0     scientiam divinam … a rebus@ 9JO Auctoritates Aristotelis HG - +DPHVVH   Metaphysica XII CommentatorQScientia dei causat res, sed nostra scientia causata est a rebus,QGHU+DQGVFKULIW /EHUXIWVLFK7KRPDVYRQ(UIXUWDXVGUFNOLFKDXI$YHUURHVMetaphysik;,,=XGLHVHU6WHOOHEHPHUNW+DPHVVH DOOHUGLQJVlocus non inventus

C OMMENTARY

ϭ Ϯ ϯ ϰ

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀈󰀃

6HGXWYLGHDPXVTXDHVFLHQWLDVLWLQWHOOHFWXLDGUHJLPHQQHFHVVDULD±TXLDTXDHGDPHVW QHFHVVDULDPDJLVTXDHGDPQHFHVVDULDPLQXV±LGHRDGGLYLVLRQHPVFLHQWLDHDFFHGDPXV 'LYLGLWXU DXWHP VFLHQWLD SULPD VXL GLYLVLRQH LQ VFLHQWLDP GLYLQDP HW LQ VFLHQWLDP KXPDQDP4XDUXPVXIILFLHQWLDKDEHWXUSHU&RPPHQWDWRUHP;,,ƒMetaphysicaeXELGLFLWTXRG

ϭϬ

ªVDSLHQWLDVLYHVFLHQWLDGLYLQDHVWUHUXPFDXVDVHGVFLHQWLDKXPDQDHVWFDXVDWDDUHEXV©4XLD GLYLQDVFLHQWLDSURGX[LWRPQHLQHVVHTXRGHVWVHGVFLHQWLDKXPDQDHVWFDXVDWDDUHEXVTXLD VHFXQGXP$ULVWRWHOHPLQWHOOHFWXVLQSULPDVXLFUHDWLRQHKDEHWVHDGVLPLOLWXGLQHPWDEXODHUDVDH LQTXDQLKLOHVWGHSLFWXPVHGLQWHOOHFWXVLQSULPDVXLFUHDWLRQHHVWUXGLVHWUHGXFLWXUDGDFWXP HWHIILFLWXUVFLHQVSHUUHVH[WUD 6HG REPLVVD VFLHQWLD GLYLQD ± TXDH QRELV QRQ FRPSHWLW ± XOWHULXV VFLHQWLD KXPDQD

ϭϭ

GLYLGLWXU LQ VFLHQWLDP KXPDQDP PDJLV XWLOHP HW LQ VFLHQWLDP LQXWLOHP HW XZWPQJQ\IU XW LQ

ϭϮ

VFLHQWLDPPDJLFDPTXDHHVWLQXWLOLVHWXZWPQJQ\IXWTXDHHVWGHFRQLXUDWLRQHGDHPRQLRUXPHWGH

ϭϯ

DOLLVWUXSKLV            

ϱ ϲ ϳ ϴ ϵ

             prohibitamFRQL @inhabitam/&IĮ5HFquaedam sunt inutiles et prohibitae prohibitaFRQL @inhabita/&IĮ5HFprohibitae, ut scientiae magicae 

󰀂󰀈󰀄

A NDRÉS Q UERO -S ÁNCHEZ

(WQ[\IM GLYLGXQWXUTXLDTXDHGDPHVW  PHFKDQLFDTXDHRUGLQDWXUDGVXSSOHQGXP GHIHFWXVH[SDUWHFRUSRULVcuiusmodi VXQW DJULFXOWXUD ODQLILFLXP QDYLJDWLR YHQDWLR HW FDHWHUD KXLXVPRGL (W GLFLWXU D  ¾PRHFKRU½ ¾PRHFKDULV½ TXRG HVW ¾DGXOWHUR½¾DGXOWHUDV½LQGH¾PHFKDQLFD½HVW LGHP TXRG DGXOWHUD HW YLOLV TXLD VLFXW FRUSXV HW HD TXDH VXQW FRUSRULV UHVSHFWX DQLPDHVXQWYLOLDVLFVFLHQWDPHFKDQLFDHVW  YLOLVUHVSHFWXVFLHQWLDHOLEHUDOLV

$XFK GLHVH >VF GLH PHQVFKOLFKHQ :LVVHQVFKDIWHQ GLH QW]OLFK XQG Q|WLJ VLQG@ ZHUGHQ HLQJHWHLOW GHQQ ]X LKQHQ JHK|UW >HUVWHQV@GLHWHFKQLVFKH:LVVHQVFKDIWZHOFKH DXI GLH %HIULHGLJXQJ GHU %HGUIQLVVH GHV .|USHUV KLQJHRUGQHW LVW 6ROFKH WHFKQLVFKHQ :LVVHQVFKDIWHQ VLQG GLH /DQGZLUWVFKDIW GDV 6SLQQHQ GLH 6FKLIIIDKUW GLH -DJG XVZ (W\PRORJLVFK KlQJW VLH >VF GLH WHFKQLVFKH :LVVHQVFKDIW scientia mechanica@ PLW GHP 9HUE moechor ]XVDPPHQ ZHOFKHV ¾HKHEUHFKHQ½ ¾YHUIlOVFKHQ½ EHGHXWHW 'DKHU LVW GLH WHFKQLVFKH :LVVHQVFKDIW >mechanica@ GDVVHOEH ZLH GLH HKHEUHFKHQGH YHUIlOVFKWH

 XQG ZHUWORVH :LVVHQVFKDIW GHQQ VR ZLH GHU .|USHU XQG DOOHV ZDV PLW GHP .|USHU ]XVDPPHQKlQJWZHUWORVHUDOVGLH6HHOHLVWVR LVW GLH WHFKQLVFKH :LVVHQVFKDIW ZHUWORVHU DOV GLHIUHLH:LVVHQVFKDIW >=XGHQPHQVFKOLFKHQ:LVVHQVFKDIWHQ 4XDHGDP DXWHP HVW ¾OLEHUDOLV½ TXDH  GLHQW]OLFKXQGQ|WLJVLQGJHK|UW]ZHLWHQV@ VLF GLFLWXU TXLD KRPLQHP D FXULV GLH IUHLH :LVVHQVFKDIW ZHOFKH GHVZHJHQ VR WHUUHQRUXPOLEHUDWHWLQDPRUHPFDHOHVWLXP JHQDQQW ZLUG ZHLO VLH GHQ 0HQVFKHQ YRQ HULJLW GHVVHQ6RUJHQXPLUGLVFKH'LQJHEHIUHLWXQG  ]XU/LHEHKLPPOLVFKHU'LQJHHUKHEW

istaeFRQL @illae(0 cuiusmodi ( @quae huiusmodi0 caetera@RP(  est idem quod@quod est( sic@sicut(

venatio@RP( quia@RP(

sunt@RP(

Quaedam autem … erigit@9JO$OEHUWXV0DJQXVMetaphysicaHG%*H\HU %G LGDe natura et origine animaeHGYRQ%HUQKDUG*H\HULQOperaomniaHGLWLR&RORQLHQVLV %G0QVWHU  9JO0HLVWHU(FNKDUWIn Eccl.Q/:,, Hinc est quarto decimo quod omnis scientia, non sistens nec quiescens nec fructum habens aut quaerens et inveniens in ipso scire, non est liberalis nec sui gratia, sed est mechanica sive adultera, quaerens fructum extra et praeter scire. Talis non habet scientiam et sapientiam sponsam, sed concubinam, non liberam, sed ancillam. Non est amator formae ipsius quae est scire et sapere, sed est adulter sapientiae, amator formae illius, quod per ipsam sapientiam quaerit extra et praeter ipsam et extra sapere. Propter quod talis, etsi possit dici sapiens, non tamen potest nec meretur dici philosophus, id est amator sapientiae, sed potius amator divitiarum, honorum, commoditatum aut huiusmodi, propter quae sapientiam quaerit. Opus tale et eius operarius mercennarius est, servus est, non filius, et opus ipsius mortuum, non proprie meritorium nec divinum, sicut notavi super illo: ‚si filius vos liberaverit, vere liberi estis‘, Ioh. 8LG In Sap.Q/:,, LGIn Ex.Q/:,, =XP7KHPDVLHKH$QGUpV4XHUR 6iQFKH]Über das Dasein. Albertus Magnus und die Metaphysik des Idealismus6WXWWJDUW 

C OMMENTARY

ϭ

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀈󰀅

1[\IREPLVVD±TXLDQLKLOHVWVHGPDJLVLQXWLOLV ±XOWHULXVVFLHQWLDKXPDQDGLYLGLWXULQ

Ϯ

VFLHQWLDPKXPDQDPPHFKDQLFDPHWLQVFLHQWLDPKXPDQDPOLEHUDOHP

ϯ ϱ

(VWDXWHPVFLHQWLDKXPDQDPHFKDQLFDDGLQYHQWDDGVXSSOHPHQWDHWQHFHVVDULDFRUSRULVHW DGWROOHQGXPGHIHFWXPFRUSRULVXWHVWODQLILFLXPQDYLJDWLRIDEULOLVVXWRULDHWF(WGLFLWXUD ¾PRHFKRU½¾PRHFKDULV½TXRGHVW¾IL]T\MZW½¾IL]T\MZI[½TXLDVLFXWDGXOWHUDYLOLVHVWUHVSHFWXGHELWL

ϲ

IUWZQ[ YLULKWVQ]OITQ[VLFHWLDPDUWHVPHFKDQLFDHYLOHVVXQWUHVSHFWXDUWLXPOLEHUDOLXP

ϰ

ϳ

'LFXQWXU DXWHP ¾DUWHV OLEHUDOHV½ D ¾OLEHUR½ ¾OLEHUDV½ TXLD OLEHUDQW DQLPDP D FXULV

ϴ

WHUUHQRUXP HW HULJXQW HDP LQ DPRUHP FDHOHVWLXP 9HO GLFXQWXU D ¾OLEHULV½ TXLD VROXP ILOLL OLEHURUXPHWQRELOLXPDGDUWHVOLEHUDOHVDSSOLFDULVROHEDQW                           

ϵ

 istaFRQL @illa/  ¾adultero½, ¾adulteras½FRQL @¾adulteror½, ¾adulteraris½/&IĮ5HFquod est ¾adultero½, ¾adulteras½ debiti amoris viri coniugalisFRQL @debiti viri legutialis" /



󰀂󰀈󰀆

A NDRÉS Q UERO -S ÁNCHEZ

(W Q[\I GLYLGLWXU SHU SUDFWLFDP HW  VSHFXODWLYDP TXDH GLIIHUXQW SHQHV ILQHV  HDUXP 4XLD SUDFWLFDH VXQW GH UHEXV TXDH  VXQWQRVWUDRSHUD±HWVXQWSURSWHUQRVWUXP  RSHUDUL TXRG SURSWHU KRF DGGR TXLD  TXDHGDP VXQW VFLHQWLDH TXDH VXQW GH LOOLV  TXDH VXQW QRVWUD RSHUDWLR XW RUJDQLFD  VFLHQWLDH VFLOLFHW JUDPPDWLFD ORJLFD  UKHWRULFD  quae tamen QRQ VXQW SURSWHU  RSHUDUL VHG SURSWHU VFLUH LGHR QRQ  SUDFWLFDHVHGVSHFXODWLYDH6FLHQWLDHDXWHP  VSHFXODWLYDH VXQW GH UHEXV D QRELV  VSHFXODELOLEXV HW VXQW SURSWHU QRVWUXP  VFLUH ,VWDP GLIIHUHQWLDP SRQLW $YLFHQQD   SULPRVXDHMetaphysicae             

,QQHUKDOE GHU IUHLHQ :LVVHQVFKDIW XQWHUVFKHLGHW PDQ QXQ ]ZLVFKHQ GHU SUDNWLVFKHQ XQG GHU VSHNXODWLYHQ :LVVHQVFKDIW XQG ]ZDU HQWVSUHFKHQG LKUHQ >YRQHLQDQGHUYHUVFKLHGHQHQ@=LHOHQ'HQQGLH SUDNWLVFKHQ :LVVHQVFKDIWHQ EHWUHIIHQ *HJHQVWlQGH GLH XQVHU :HUN VLQG 8QG VLH ]LHOHQ >GDUEHU KLQDXV DXFK@ DXI XQVHU +DQGHOQZDVLFKMDGHVKDOEKLQ]XIJHZHLOHV >DXFK@ JHZLVVH :LVVHQVFKDIWHQ JLEW GHUHQ *HJHQVWDQG >]ZDU@ GXUFK XQVHU +DQGHOQ HQWVWHKW ZLH HV VLFK MD EHL GHQ +LOIVZLVVHQVFKDIWHQQlPOLFKGHU*UDPPDWLN GHU /RJLN XQG GHU 5KHWRULN YHUKlOW  GLH GHQQRFKQLFKWDXIGDV+DQGHOQ>VHOEVW@]LHOHQ VRQGHUQDXIGLH(UNHQQWQLVXQGGHVKDOEQLFKW SUDNWLVFKH VRQGHUQ >GRFK@ VSHNXODWLYH :LVVHQVFKDIWHQ VLQG  'LH VSHNXODWLYHQ :LVVHQVFKDIWHQ EHWUHIIHQ QXQ YRQ XQV HUNHQQEDUH *HJHQVWlQGH XQG VLH ]LHOHQ DXI XQVHUH(UNHQQWQLV'LHVHQ8QWHUVFKLHGILQGHW PDQ LP HUVWHQ %XFK GHU Metaphysik $YLFHQQDV 

     istaFRQL @illa(0  per@in(  fines earum@LQY( opera@operatio(  et@DGGetiam( quae tamen( @ quia illae0 de@a(  primo suae Metaphysicae@ sui primo Metaphysicae(   Avicenna, primo suae Metaphysicae@9JO$YLFHQQDMetaphysica,HGYRQ6LPRQHYDQ5LHWLiber de scientia divina sive de philosophia prima /RXYDLQ   Avicenna Latinus    Incipiamus ergo, auxiliante Deo, et dicamus quod scientiae philosophicae, sicut iam innuimus in aliis libris, dividuntur in speculativas et activas, et iam innuimus differentiam inter eas. Et diximus quod speculativae sunt illae in quibus quaerit perfici virtus animae speculativa per acquisitionem intelligentiae in effectu, scilicet per adeptionem scientiae imaginativae et creditivae de rebus quae non sunt nostra opera nec nostrae dispositiones. In his ergo finis est certitudo sententiae et opinionis: sententia enim et opinio non sunt ex qualitate nostri operis nec ex qualitate initii nostri operis secundum quod est initium operis. Practicae vero sunt illae in quibus primum quaerit perfici virtus animae speculativa per adeptionem scientiae imaginativae et creditivae de rebus quae sunt nostra opera, ad hoc ut secundario proveniat perfectio virtutis practicae in moribus



C OMMENTARY

ϭ Ϯ

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀈󰀇

2EPLVVDVFLHQWLDPHFKDQLFD±TXDHQRQHVWSUDHVHQWLVFRQVLGHUDWLRQLV±XOWHULXVVFLHQWLD OLEHUDOLVGLYLGLWXULQVFLHQWLDPSUDFWLFDPHWVSHFXODWLYDP4XDUXPLQNNMZMV\QIU$YLFHQQDDVVLJQDW

ϲ

LQ SULPR VXDH Metaphysicae 'LFLW DXWHP ª6FLHQWLD SUDFWLFD HVW GH QRVWULV RSHUDWLRQLEXV HW RSHUDWDDQRELVHWSURSWHUQRVWUXPRSHUDUL©6HGOLFHWDOLDHVFLHQWLDHOLEHUDOHVVLQWGHQRVWULV RSHUDWLRQLEXV±XWVFLHQWLDHDGPLQLFXODWLYDHVLYHRUJDQLFDHTXDHVXQWGHHQWHUDWLRQLVTXDH RSHUDWD[]V\DQRELV±FXP\IUMV QRQVXQWSURSWHUQRVWUXPRSHUDUL±TXLDLVWDVVFLHQWLDVRUJDQLFDV

ϳ

QRQVFLPXVXWSHULSVDVRSHUHPXUHWILDPXV[IVK\QVHGXW[XMK]TMU]ZVHGSUDFWLFDVVFLPXVXWSHU

ϴ

LSVDVRSHUHPXU HW ILDPXV VDQFWL± QLMW [KQMV\QIM ILUQVQK]TI\Q^IM [Q^M WZOIVQKIM VWV []V\ XZIK\QKIM [ML

ϵ

[XMK]TI\Q^IM

ϯ ϰ ϱ

     

ϭϬ ϭϭ ϭϮ

  $OLDP GLIIHUHQWLDP DVVLJQDW LQ TXLQWR Metaphysicae 4XRG ªLOODH VFLHQWLDH SHU ILQHV GLIIHUXQWTXLDSUDFWLFDVFLHQWLDHVWSURSWHURSHUDWLRQHP©LGHVW¾SURSWHUQRVWUXPRSHUDUL½VHG OLEHUDOLVHVWSURSWHUQRVWUXPRSHUDULHUJRHWF               practicam et speculativam@7H[WXVɲ5HFHQVLRQLVLQPDUJLQIDGG/  differentiamFRQL @differentiarum/&Iɲ5HFIstam differentiam ponit Avicenna suntFRQL @est/  tamenFRQL @RP/&Iɲ5HF( quae tamen non sunt propter operari sanctiFRQL @RP/&IORFLQIUD/ sed practicas scimus ut per ipsas operemur et fiamus sancti speculemurFRQL @speculatur/&Iɲ5HFScientiae autem speculativae sunt de rebus a nobis speculabilibus, et sunt propter nostrum scire deo scientiae adminiculativae sive organicae non sunt practicae, sed speculativaeFRQL @RP/&Iɲ5HF ideo non practicae, sed speculativae 

󰀂󰀈󰀈

A NDRÉS Q UERO -S ÁNCHEZ

6FLHQWLD DXWHP SUDFWLFD YHO PRUDOLV FXPVLWGHRSHUDWLRQLEXVKRPLQLVDGVHYHO DG DOLD diversificatur VHFXQGXP GLYHUVRV PRGRV YLYHQGL HW FRQVLGHUDQGL 7ULSOH[ DXWHP HVW PRGXV YLYHQGL HW FRQVLGHUDQGL 3ULPXV FRQVLVWLW LQ UHJHQGR FLYLWDWHV HW UHJQD HW GH WDOL HVW VFLHQWLD PRUDOLV TXDH GLFLWXU ¾SROLWLFD½ GLFWD D ¾SROLV½ TXRG HVW ¾SOXULWDV½ HW ¾\FRV½ ¾VFLHQWLD½ TXDVL ¾VFLHQWLD GH UDWLRQH SOXULXP½ 6HFXQGXV PRGXV YLYHQGL HW FRQVLGHUDQGL HVW FXP SURSULD IDPLOLD HW WDOLV HVW VFLHQWLD TXDH GLFLWXU ¾\FRQRPLFD½ DE ¾\FRQRV½ JUDHFH TXRG HVW ¾GLVSHQVDUH½ ODWLQH XQGH ¾\FRQRPLFD½ LG HVW ¾GLVSHQVDWRULD½ TXLD GRFHW UHJHUH SURSULDP IDPLOLDP LQ GRPR 7HUWLXV HVW PRGXV YLYHQGL DOLFXLXV VHFXQGXP VH HW DG VH LSVXP M\ SURSWHU

            

,QQHUKDOE GHU SUDNWLVFKHQ RGHU GLH 6LWWHQ EHWUHIIHQGHQ:LVVHQVFKDIWZHUGHQ>QRFK@GDVLHGDV +DQGHOQ GHV 0HQVFKHQ HQWZHGHU EH]JOLFK VHLQHU VHOEVWRGHUEH]JOLFKDQGHUHUEHWULIIWYHUVFKLHGHQH :LVVHQVFKDIWHQ HQWVSUHFKHQG GHQ YHUVFKLHGHQHQ /HEHQVXQG%HWUDFKWXQJVZHLVHQXQWHUVFKLHGHQ(V JLEW QlPOLFK GUHL YHUVFKLHGHQH /HEHQV XQG %HWUDFKWXQJVZHLVHQ'LHHUVWHEHWULIIWGLH5HJLHUXQJ GHU 6WlGWH XQG 6WDDWHQ XQG PLW GLHVHU EHVFKlIWLJW VLFKGLHGLH6LWWHQEHWUHIIHQGH:LVVHQVFKDIWQDPHQV ¾3ROLWLN½GLHHW\PRORJLVFKPLWGHP:RUWpolis±GDV ¾9LHOKHLW½ EHGHXWHW ± XQG ycos ¾:LVVHQVFKDIW½ ]XVDPPHQKlQJW DOV ZUGH PDQ GDGXUFK VDJHQ

ZROOHQ ¾GLH HLQH 9LHOKHLW >YRQ 0HQVFKHQ@ EHWUHIIHQGH:LVVHQVFKDIW½(LQH]ZHLWH/HEHQVXQG  %HWUDFKWXQJVZHLVH EHWULIIW GLH HLJHQH )DPLOLH XQG  GDPLW EHVFKlIWLJW VLFK GLH gNRQRPLN ZHOFKH HW\PRORJLVFK PLW GHP JULHFKLVFKHQ :RUW yconos  ]XVDPPHQKlQJW GDV DXI /DWHLQLVFK ¾GDV+DXV  YHUZDOWHQ½ dispensare  EHGHXWHW 'DKHU EHGHXWHW  ¾gNRQRPLN½ ¾GLH GLH 9HUZDOWXQJ GHV +DXVHV ERQXPSURSULXPGHTXRPRGRYLYHQGLHVW  EHWUHIIHQGH :LVVHQVFKDIW½ GD VLH >QlPOLFK@ OHKUW PRQDVWLFD HW GLFLWXU D ¾PRQRV½ TXRG HVW  ZLH PDQ GLH HLJHQH )DPLOLH LP +DXV OHLWHW (LQH ¾XQXP½HW¾\FRV½¾VFLHQWLD½TXDVL¾VFLHQWLD  GULWWH /HEHQVZHLVH JHKW >QXQ@ GDV 9HUKlOWQLV YRQ MHPDQGHP>QLFKW]XDQGHUHQ@VRQGHUQ]XVLFKVHOEVW  GHUHJLPLQHXQLXV½ XQGDQVLFKVHOEVWVRZLHLP+LQEOLFNDXIGDVHLJHQH   *XWVHLQDQXQGPLWGLHVHU/HEHQVZHLVHEHVFKlIWLJW   VLFK GLH 0RQDVWLN ZHOFKH HW\PRORJLVFK PLW GHP

 





:RUW monos GDV ¾HLQV½ EHGHXWHW XQG ycos ¾:LVVHQVFKDIW½ ]XVDPPHQKlQJW DOV ZUGH PDQ GDGXUFK VDJHQ ZROOHQ ¾GLH GLH /HLWXQJ HLQHV HLQ]LJHQ>0HQVFKHQ@EHWUHIIHQGH:LVVHQVFKDIW½

          vel@et( alia@aliqua(  diversificatur( @dicitur0  est@est" (  ab@dicta ab(id est@RP(  est@RP (  etFRQL @est(0 est@RP(  et dicitur@dicta(  scientia@RP(

C OMMENTARY

ϭ Ϯ

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀈󰀉

4XLDVFLHQWLDSUDFWLFDHVWGHPRGRYLYHQGLVLYHGHPRGRKXPDQR6HGTXLDWULSOH[HVW PRGXVYLYHQGLLGHRµKDHFVFLHQWLDGLYLGLWXULQ\ZM[[KQMV\QI[(VVHHQLPXQLXVPRGXVYLYHQGLHVW

ϰ

DOLFXLXVKRPLQLVDSXGVHLSVXPHWDEVROXWHQRQDSXGDOLRV(WGHLOORPRGRYLYHQGLWUDGLWDHVW VFLHQWLDTXDHGLFLWXUVFLHQWLDGHUHJLPLQHXQLXVKRPLQLVTXDHLQKQ\]Z¾PRQDVWLFD½(WGHLOODDJLWXU

ϱ

LQ GHFHP OLEULV Ethicorum HW LQ TXRGDP OLEHOOR $ULVWRWHOLV TXL GLFLWXU Liber de monastica

ϲ

scientia(WGLFLWXUD¾PRQRV½TXRGHVW¾XQXP½HW¾\FRV½¾VFLHQWLD½TXDVL¾VFLHQWLDGHUHJLPLQH XQLXVKRPLQLV½HWSHUWLQHWIL FODXVWUDOHV

ϯ

ϳ

ϭϭ

$OLXV HVW PRGXVYLYHQGL KXPDQXVDGDOLRV(W KRF HVWGXSOH[ 9HODGDOLRV TXLVXQW LQ GRPRYHOTXLVXQWLQFLYLWDWHYHOSURYLQFLD 6LHVWPRGXVYLYHQGLDGHRVTXLVXQWLQGRPRWXQFGHWDOLPRGRGDWXUVFLHQWLDTXDHGLFLWXU ¾\FRQRPLFD½TXDHHVWGHUDWLRQHHRUXPTXDHVXQWLQGRPRHWSHUWLQHWDGUHFWRUHPGRPXVFXLXV

ϭϮ

HVWUHJHUHHWJXEHUQDUHIDPLOLDPVXDPM\VHUYRVHWDQFLOODVHWSHFRUDHWDOLDTXDHVXQWLQGRPR

ϭϯ

TXLDLSVHM[\UHFWRURPQLXPTXDHVXQWLQGRPR(WGLFLWXU|aKWVW[pOZIMKMTXRGHVW¾GLVSHQVDUH½

ϭϰ

HW ¾\FRV½ TXRG HVW ¾VFLHQWLD½ TXDVL ¾VFLHQWLD GH GLVSHQVDWLRQH HW UHJLPLQH GRPXV HW SDWULV IDPLOLDV½

ϴ ϵ ϭϬ

ϭϱ ϭϲ ϭϳ ϭϴ ϭϵ ϮϬ

6LDXWHPHVWPRGXVYLYHQGLDGDOLRVTXDHVXQWLQFLYLWDWHHWSURYLQFLDWXQFGHWDOLPRGR YLYHQGL GDWXU VFLHQWLD TXDH GLFLWXU ¾SROLWLFD½ TXDH HVW GH UHJLPLQH SOXULXP HW SHUWLQHW DG FRPLWHVHWDGUHJHVHWPLOLWHVTXLKDEHQWUHJHUHYLOODVFLYLWDWHVHWSURYLQFLDV(WGLFLWXUD|XWTQ[p TXRGHVW¾SOXULWDV½HW¾\FRV½TXRGHVW¾VFLHQWLD½TXDVL¾VFLHQWLDGHUHJLPLQHSOXULXP½ (WLWDSDWHWGLYLVLRVFLHQWLDHSUDFWLFDHVHFXQGXPPRGRVYLYHQGL             ØFRQL @enim/ tres scientiasFRQL @X/ diciturFRQL @dicit/  adFRQL @RP/&IORFLQIUDet pertinet ad rectorem domus etFRQL @ut/ estL FRQL RP/ ›yconos‹ graeceFRQL. @ ›igromia‹ ab ›igromicos‹ /&Iɲ5HFab ›yconos‹ graece, quod est ›dispensare‹ latine   ›polis‹FRQL @›polos‹ /&Iɲ5HF. dicta a ›polis‹, quod est ›pluritaV½

󰀂󰀉󰀀

A NDRÉS Q UERO -S ÁNCHEZ

6FLHQWLD DXWHP VSHFXODWLYD GLYLGLWXU  LQ SULQFLSDOHP HW DGPLQLFXODWLYDP Speculativa principalis GLYLGLWXU LQ PHWDSK\VLFDP Ø SK\VLFDP HW PDWKHPDWLFDP 

'LHVSHNXODWLYH:LVVHQVFKDIWZLUGQXQ LQ +DXSW XQG +LOIVZLVVHQVFKDIW XQWHUWHLOW 'LH VSHNXODWLYH +DXSWZLVVHQVFKDIW ZLUG LQ 0HWDSK\VLN 3K\VLN XQG 0DWKHPDWLN XQWHUWHLOW

0HWDSK\VLFDHVWGHHQWLEXVDEVWUDFWLV 'LH0HWDSK\VLNEHVFKlIWLJWVLFKPLWGHQ DERPQLPRWXHWPDWHULDVHFXQGXPHVVHHW VRZRKO GHP 6HLQ DOV DXFK GHU FRQVLGHUDWLRQHP (W OLFHW LQ PHWDSK\VLFD %HWUDFKWXQJVZHLVH QDFK YRQ MHJOLFKHU PXOWD FRQVLGHUHQWXU TXDH VXQW FRQLXQFWD 9HUlQGHUXQJ XQG 0DWHULH DEVWUDNWHQ PRWXLHWPDWHULDHWDPHQTXLDSULQFLSDOLWHU  6HLHQGHQ 8QG REZRKO LQ GHU 0HWDSK\VLN VXQW LEL VXEVWDQWLDH VHSDUDWDH LGHR GLFLWXU YLHOH6HLHQGHLQ%HWUDFKWEH]RJHQZHUGHQGLH HVVH GH DEVWUDFWLV HW D PRWX HW D PDWHULD >GRFK@ LP =XVDPPHQKDQJ PLW 9HUlQGHUXQJ VHFXQGXP HVVH HW FRQVLGHUDWLRQHP XQG0DWHULHVWHKHQVDJWPDQGHQQRFK±ZHLO VLPSOLFLWHU KLHU GLH DEVWUDNWHQ 6XEVWDQ]HQ L P   0 L W W H O S X Q N W  G H V  , Q W H U H V V H V  VWHKHQ ± GDVVVLHVLFKPLWGHQVRZRKOGHP6HLQDOVDXFK GHU%HWUDFKWXQJVZHLVHQDFKYRQ9HUlQGHUXQJ XQG 0DWHULH DEVWUDNWHQ 6HLHQGHQ V F K O H F K W K L Q EHVFKlIWLJW

in@DGGscientiam( Speculativa principalis( @Specialiter speculativa0 Ø@et0 ( et L @RP( principaliter@principalius (  sunt@considerantur( secundum esse et considerationem simpliciter@ specie (

C OMMENTARY

ϭ Ϯ ϯ ϰ ϱ ϲ

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀉󰀁

2EPLVVDVFLHQWLDSUDFWLFDXOWHULXVVFLHQWLDVSHFXODWLYDGLYLGLWXULQVFLHQWLDVSULQFLSDOHVHW LQVFLHQWLDVVLYHRUJDQLFDVVLYHDGPLQLFXODWLYDV6FLHQWLDHQLPSULQFLSDOLVGLYLGLWXULQWUHVLQ PHFKDQLFDPQDWXUDOHPHWPDWKHPDWLFDPVHFXQGXPWULSOH[JHQXVHQWLVSULQFLSDOLV 6L HQLP HVW GH HQWH TXRG M[\ DEVWUDFWXP D PDWHULD HW PRWX VHFXQGXP HVVH HW FRQVLGHUDLRQHPVLFHVWPHWDSK\VLFDTXDHHVWGHFDXVDSULPDHWLQWHOOLJHQWLLVTXLDSULYDQWXUDE RPQL PRWX TXLD QRQ PRYHQWXU +XLXVUDWLR HVW TXLDRPQH LOOXGTXRG PRYHWXU PRYHWXU DG

ϵ

DOLTXRGTXRFDUHWTXLDQLKLOPRYHWXUDGLOOXGTXRGKDEHWSULXVVHGDGLOOXGTXRFDUHWTXLDLOOXG GHTXRDOLTXLGFDUHWHVWLPSHUIHFWLRTXLDVLELGHILFLWDOLTXLG6HG'HXVHWLQWHOOLJHQWLDHVXQW SHUIHFWLTXLDQLKLOHLVGHHVWHUJRQRQPRYHQWXUFXPLQHLVQXOOXVVLW GHIHFWXV6LPLOLWHUM[\

ϭϬ

HWLDPDEVWUDFWXPDPDWHULDTXLDXZQUIKI][IM\QV\MTTQOMV\QIMLPPDWHULDOHVVXQW(WKXLXVUDWLRHVW

ϭϭ

TXLDSULPDFDXVDHWLQWHOOLJHQWLDHVXQWSHUSHWXDTXLDQXPTXDPFRHSHUXQWHVVHHWTXLDPDWHULD

ϭϮ

HVWSULQFLSLXPFRUSRULVHUJRWDOLDFDUHQWPDWHULDFXPVLQWLQFRUSRUDOLD                         

ϳ ϴ

estFRQL @RP/&IĮ5HF.: Metaphysica est de entibus abstractis ab omni motu et materia estFRQL @RP/&IĮ5HF.: Metaphysica est de entibus abstractis ab omni motu et materia prima causa et intelligentiaeFRQL @RP/&IORFLQIUDquia prima causa et intelligentiae sunt perpetua

󰀂󰀉󰀂

A NDRÉS Q UERO -S ÁNCHEZ

3K\VLFD DXWHP HVW GH HQWLEXV FRQLXQFWLV PRWXL VHFXQGXP HVVH HW FRQVLGHUDWLRQHP (W OLFHW DEVWUDKDW DE KDF PDWHULD VHQVLELOL HW DE LOOD QRQ WDPHQ D PDWHULD VHQVLELOL VLPSOLFLWHU XW KRPR GHWHUPLQDW VLEL FRPSRVLWLRQHP TXDOLWDWXP VHQVLELOLXPVFLOLFHWFDOLGLHWIULJLGLKXPLGL HW VLFFL QRQ WDPHQ KDQF YHO LOODP GHWHUPLQDWH   0DWKHPDWLFD DXWHP HVW GH HQWLEXV DEVWUDFWLV D PDWHULD VHQVLELOL VHFXQGXP FRQVLGHUDWLRQHP OLFHW VHFXQGXP 0Y HVVH VLQW FRQLXQFWD PDWHULDH VHQVLELOL XW PDJQLWXGROLQHDFLUFXOXVQRQGHWHUPLQDQW VLEL DOLTXDP PDWHULDP VHQVLELOHP EHQH WDOLD SRVVXQW LQWHOOLJL QRQ LQWHOOLJHQGR DOLTXRG VHQVLELOH QHF FDOLGXP QHF IULJLGXP HWF  LGHR GH VXL QDWXUD VXQW DEVWUDFWD  

                     

'LH3K\VLNEHVFKlIWLJWVLFKQXQPLWGHQ VRZRKO GHP 6HLQ DOV DXFK GHU %HWUDFKWXQJVZHLVHQDFKPLW9HUlQGHUXQJXQG 0DWHULH]XVDPPHQKlQJHQGHQ6HLHQGHQ8QG REZRKO VLH YRQ GLHVHU XQG MHQHU NRQNUHWHQ VLQQOLFKHQ0DWHULHDEVWUDKLHUWDEVWUDKLHUWVLH QLFKWYRQVLQQOLFKHU0DWHULHVFKOHFKWKLQ'HU 0HQVFK >HWZD@ ZHLVW >DOV VROFKHU@ HLQH =XVDPPHQVHW]XQJ DXV >JHZLVVHQ@ VLQQOLFKHQ 4XDOLWlWHQ DXI QlPOLFK DXV :DUPHP XQG .DOWHP)HXFKWHPXQG7URFNHPQLFKWMHGRFK DXVGLHVHPRGHUMHQHPNRQNUHW 'LH 0DWKHPDWLN EHVFKlIWLJW VLFK QXQ PLW 6HLHQGHQ GLH GHU %HWUDFKWXQJ QDFK YRQ GHU VLQQOLFKHQ 0DWHULH DEVWUDNW VLQG REZRKO VLHGHP6HLQQDFKPLWGHUVLQQOLFKHQ0DWHULH ]XVDPPHQKlQJHQ 'LH *U|‰H >HWZD@ GLH /LQLHGHU.UHLVKlQJHQ>DOVVROFKH@QLFKWPLW LUJHQGZHOFKHUVLQQOLFKHQ0DWHULH]XVDPPHQ GHQQ VLH N|QQHQ MD JXW HUIDVVW ZHUGHQ RKQH GDVV PDQ GD]X Q|WLJ KDW HWZDV 6LQQOLFKHV ± ZHGHU :DUPHV QRFK .DOWHV XVZ ± ]X HUIDVVHQ ,KUHU 1DWXU QDFK VLQG VLH GHVKDOE DEVWUDNW 

        motui@materiae et motui(   secundum esse et considerationem@ secundum  se et secundum esse et considerationem ( simpliciter@specie(compositionem@certam compositionem( scilicet@DGGaliquaGXE (  et@RP(  vel@et( autem@RP( circulus@DGGnumerus( aliquam@RP( talia@illa(  aliquod@RP( nec calidum nec frigidum, etc@ ut calidum aliquod frigidum,et (

C OMMENTARY

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀉󰀃

ϰ

6L DXWHP VFLHQWLD SULQFLSDOLV HVW GH PRWX HQWLV TXRG HVW FRQLXQWXP PRWXL HW PDWHULDH VHFXQGXP HVVH HW UDWLRQHP WXQF HVW VFLHQWLD QDWXUDOLV TXDH HVW GH HQWLEXV QDWXUDOLEXV FRPSRVLWLVH[PDWHULDHWIRUPDXWGHKRPLQHHWHTXRHWVLFGHDOLLVPDWHULDOLEXVHWPRELOLEXV         6LDXWHPHVWGHHQWHTXRGHVWKWVQ]VK\]U PRWXLHWPDWHULDHVHFXQGXPHVVHHWHVWDEVWUDFWXP

ϱ

VHFXQGXPFRQVLGHUDWLRQHPDPRWXHWPDWHULDVLFHVWVFLHQWLDPDWKHPDWLFDTXDHM[\LMMV\MY]WL

ϲ

VWVM[\VI\]ZITMVMKUM\IXPa[QK]UXWPDJQLWXGRQXPHUXVFLUFXOXVHWVLFGHDOLLVXWSDWHW

ϭ Ϯ ϯ

                        coniunctumFRQL @RP/&IĮ5HF.: Mathematica autem est de entibus abstractis a materia sensibili secundum considerationem, licet secundum esse sint coniuncta materiae sensibili est de ente quod non est naturale nec metaphysicumFRQL @naturale et metaphysicam/

󰀂󰀉󰀄

A NDRÉS Q UERO -S ÁNCHEZ

$GPLQLFXODWLYD VLYH RUJDQLFD GLYLGLWXU LQ JUDPPDWLFDP ORJLFDP UKHWRULFDP TXDH GLFXQWXU ¾DGPLQLFXODWLYDH½ HW ¾RUJDQLFDH½ TXLD DGPLQLFXODQWXU HW FRRSHUDQWXU QRELV LQ DFTXLVLWLRQH DOLDUXP VFLHQWLDUXP HW VXQW TXDVL RUJDQD TXLEXV XWLPXU DOLDV VFLHQWLDV DFTXLUHQGR͘ 

         

,QQHUKDOE GHU >VSHNXODWLYHQ@ +LOIV RGHU LQWUXPHQWHOOHQ :LVVHQVFKDIWHQ XQWHUVFKHLGHW PDQ >QXQ@ *UDPPDWLN /RJLN XQG 5KHWRULN GLH GHVKDOE ¾+LOIV XQG LQWUXPHQWHOOH :LVVHQVFKDIWHQ½ JHQDQQW ZHUGHQ ZHLO VLH XQV EHL GHU (UZHUEXQJ DQGHUHU :LVVHQVFKDIWHQ XQWHUVWW]HQ XQG VR]XVDJHQ ,QVWUXPHQWH VLQG GLH ZLU JHEUDXFKHQZHQQZLUDQGHUH:LVVHQVFKDIWHQ HUZHUEHQ

                  sive organica@RP(  utimur@uniamus(  alias scientias acquirendo@ LQYacquirendo alias scientias (



C OMMENTARY

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀉󰀅

ϰ

,VWLV REPLVVLV VFLHQWLD RUJDQLFD VLYH DGPLQLFXODWLYD XOWHULXV GLYLGLWXU LQ WUHV JUDPPDWLFDP UKHWRULFDP HW ORJLFDP 'LFXQWXU DXWHP LOODH VFLHQWLDH ¾DGPLQLFXODWLYDH½ TXLD DGPLQLFXODQWXUQRELVLQDFTXLVLWLRQHSULQFLSLRUXPDOLDUXPVFLHQWLDUXPHWGLFXQWXUÃRUJDQLFDHµ TXLD IDFWDH VXQW ]\ WZOIVI (W VXQW LQVWUXPHQWD HW RUJDQD PHGLDQWLEXV TXLEXV GHYHQLPXV LQ

ϱ

FRJQLWLRQHPDOLDUXPVFLHQWLDUXP

ϭ Ϯ ϯ

                                         ut organaFRQL @ab organis/&Iɲ5HFet sunt quasi organa

󰀂󰀉󰀆

A NDRÉS Q UERO -S ÁNCHEZ



4XRG SDWHW SULPR GH JUDPPDWLFD TXLD XW GLFLWXU VHFXQGR Metaphysicae ªTXRG TXLOLEHW per se ipsum de scientia LQYHQLW PRGLFXP HVW PXOWXP DXWHP DE DOLRDGGLVFLW©6HGDOLTXLVDEDOLRDGGLVFHUH QRQ SRWHVW QLVL SHU VHUPRQHP FRQJUXXP FXLXV FRQVWLWXWLRQHP GRFHW JUDPPDWLFD 8QGHLQSULPRDe sensu et sensatoª6HUPR EHQHDXGLELOLVLQVWUXPHQWXPHVWGRFWULQDH© HUJRHWF 

            

'DV JLOW HUVWHQV IU GLH *UDPPDWLN GHQQ ZLH LP ]ZHLWHQ %XFK GHU Metaphysik JHVDJWZLUGª'DV:LVVHQGDVHLQMHGHUVHOEVW DOOHLQ  HUZLUEW LVW ZHQLJ 9LHOHV OHUQW PDQ DEHU YRQ DQGHUHQ >0HQVFKHQ@© 1XQ NDQQ PDQQLFKWVYRQDQGHUHQ>0HQVFKHQ@OHUQHQHV VHLGHQQPDQWXWHVPLW+LOIHGHUJUDPPDWLVFK ULFKWLJJHIRUPWHQ5HGHGHUHQ6WUXNWXU>HEHQ@ GLH*UDPPDWLNOHKUW'DKHUKHL‰WHVLPHUVWHQ %XFK Über die Wahrnehmung und die Gegenstände der Wahrnehmung ª'LH YHUVWlQGOLFKH 5HGH LVW GDV ,QVWUXPHQW GHU /HKUH©DOVRXVZ

            per se ipsum de scientia( @ de scientia per se 0 addiscit@RP(addiscere@discere( congruum@verum(  doctrinae@RP(   secundo Metaphysicae@9JO$ULVWRWHOHVMetaphysica,,EODWHLQLVFKHhEHUVHW]XQJYRQ:LOKHOP YRQ0RHUEHNDHGYRQ*9XLOOHPLQ'LHP Non solum autem hiis dicere gratiam iustum est quorum aliquis opinionibus communicauerit, sed et hiis qui adhuc superficialiter enuntiauerunt; et enim hii conferunt aliquid, nam habitum nostrum praeexercitati sunt. Nam si Thimotheus non fuisset, multam melodiam non haberemus; si autem non Phrinis, Thimotheus non fuisset. Eodem uero modo et de enuntiantibus ueritatem; a quibusdam enim opiniones quasdam accepimus, sed alii ut hii forent causa fuerunt9JO7KRPDVYRQ$TXLQIn duodecim libros Metaphysicorum Aristotelis expositioHGYRQ05&DWKDODXQG506SLD]]L7XULQ  DQ Secundum signum ponit ibi Ãet secundumµ. // Dicens quod licet id quod unus homo potest immittere vel apponere ad cognitionem veritatis suo studio et ingenio, sit aliquid parvum per comparationem ad totam considerationem veritatis, tamen illud, quod aggregatur ex omnibus Ãcoarticulatisµ, idest exquisitis et collectis, fit aliquid magnum, ut potest apparere in singulis artibus, quae per diversorum studia et ingenia ad mirabile incrementum pervenerunt primo De sensu et sensato@9JO$ULVWRWHOHVDe sensu et sensato,DODWHLQLVFKHhEHUVHW]XQJYRQ :LOKHOPYRQ0RHUEHNDLQ7KRPDVYRQ$TXLQSentencia de sensu et sensatoLQOpera omniaHGLWLR/HRQLQD  %G  5RP3DULV   E Sermo enim audibilis existens causa est discipline, non secundum se set secundum accidens9JOAuctoritates AristotelisHG-+DPHVVH De sensu et sensatoQSermo audibilis existens ex >VLF@ causa disciplinae non per se, sed per accidens, idest in quantum, >VLF@ significat aliquid 

C OMMENTARY

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀉󰀇

Ϯ

4XRGDXWHPLVWDHVFLHQWLDHVLQWDGPLQLFXODWLYDHKRFDSSDUHWVHFXQGXP3KLORVRSKXPLQ VHFXQGR 5M\IXPa[QKIMÃTXRGTXLVXMZ[MQX[]ULM[KQMV\QILQYHQLWPRGLFXPM[\TXRGDXWHPIJITQW

ϯ

DGGLVFLW PXOWXP HVWµ (W LGHR OLFHW JUDPPDWLFD QRQ DGPLQLFXOHWXU QRELV QV VFLHQWLDP

ϰ

DGLQYHQLHQGRWDPHQQRELVDGPLQLFXODWXULQDFTXLUHQGRHWDGGLVFHQGRVFLHQWLDP4XLDRPQLV TXLDFTXLULWVFLHQWLDPDGGLVFHQGRLOOHDFTXLULWHDPSHUGRFWULQDPGRFWRULV6HGWDOLVGRFWULQD

ϭ

ϱ ϲ ϳ ϴ ϵ

QRQSRWHVWILHULVLQHVHUPRQHFRQJUXR4XLDVLFXWVHKDEHWGLDSKDQXPDGOXPHQVLFGLVFLSXOXV DG VFLHQWLDP VHG OXPHQ QRQ /UE SRWHVW LOOXPLQDUL QLVL PHGLDQWH GLDSKDQR VLF HWLDP GLVFLSXOXV VFLHQWLDP DFTXLULUH QRQ SRWHVW QLVL PHGLDQWH VHUPRQH FRQJUXR 7DOHP DXWHP VHUPRQHPLSVDGRFHWJUDPPDWLFD                             MetaphysicaeFRQL @Elenchorum/&Iɲ5HF.secundo Metaphysicae per se ipsum de scientiaFRQL @RP/&Iɲ5HF.quod quilibet per se ipsum de scientia invenit estFRQL @RP/&Iɲ5HF.quod quilibet per se ipsum de scientia invenit, modicum est ab alioFRQL @RP/&Iɲ5HF.multum autem ab alio addiscit inFRQL @ad/&IORFLQIUDnobis adminiculatur in acquirendo et addiscendo scientiam

󰀂󰀉󰀈

A NDRÉS Q UERO -S ÁNCHEZ

,WHP GH ORJLFD SDWHW TXRG VLW DGPLQLFXODWLYD 4XLD XQDTXDHTXH VFLHQWLD XWLWXUDOLTXRPRGRVFLHQGLFXLXVPRGLVXQW GHILQLWLRGLYLVLRHWGHPRQVWUDWLR                                    utitur@videtur(



et@RP(

    

(VLVWRIIHQNXQGLJGDVVDXFKGLH/RJLN HLQH +LOIVZLVVHQVFKDIW LVW 'HQQ MHGH :LVVHQVFKDIW JHEUDXFKW LUJHQG ZHOFKHQ (UNHQQWQLVPRGXV 'HILQLWLRQ 7HLOXQJ XQG 6FKOLH‰HQ

C OMMENTARY

ϭ Ϯ ϯ ϰ ϱ ϲ ϳ ϴ

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀂󰀉󰀉

6LPLOLWHU HWLDP ORJLFD DGPLQLFXODWXU QRELV DFTXLUHQGR VFLHQWLDP 4XLD QXOOD VFLHQWLD SRWHVWVFLULQLVLSHUPRGRV [KQMVLQ VLFXWQXOOXVSRWHVWDHGLILFDUHQLVLSHUPRGRVDHGLILFDQGLQXOOXV SRWHVWPDOOHDUHQLVLSHUPRGRVPDOOHDQGL4XLDQXOODVFLHQWLDHVWTXLQKDEHDWPRGXPVFLHQGL YHO PRGXP GHILQLHQGL YHO GLYLGHQGL YHO DUJXHQGL 8QGH RPQLV VFLHQWLD GRFHW FRJQLWLRQHP FRPSOH[L YHO LQFRPSOH[L 6L LQFRPSOH[L VLF HVW PRGXV GHILQLHQGL YHO GLYLGHQGL TXLD LQFRPSOH[XPFRJQRVFLWXUYHOYLDGHILQLWLYDYHOGLYLVLYDVLFRPSOH[LKRFHVWDUJXPHQWDWLRQH XWTXDQGRDOLTXDPFRQFOXVLRQHPLJQRUDPXVM\SUREDPXVSHUPDJLVQRWXPXWSHUSUDHPLVVDV (WVLFRPQHVUHVVFLWXUYHOPRGRGHILQLHQGLYHOGLYLGHQGLYHODUJXHQGL                              sciendiFRQL @significandi/&IORFLQIUDQuia nulla scientia est quin habeat modum sciendi&IHWLDPɲ 5HFQuia unaquaeque scientia utitur aliquo modo sciendi est@DGGVXSOLQ/  etFRQL @ut/

ϵ

󰀃󰀀󰀀

A NDRÉS Q UERO -S ÁNCHEZ



4XDH VLF GLIIHUXQW 4XLD SHU GHILQLWLRQHP FRJQRVFLWXU DOLTXLG TXDQWXP DG VXL HVVH HW HVVHQWLDP SHU GLYLVLRQHP TXDQWXP DG VXL SRVVH TXRG KDEHW LQ VXLV SDUWLEXVSHUGHPRQVWUDWLRQHPTXDQWXPDG VXDV SURSULHWDWHV HW SDVVLRQHV +RV DXWHP PRGRVVFLHQGLGRFHWORJLFDHUJRHWF

                             cognoscitur aliquid@LQY( suas@sui(



        

'LHVH ZHUGHQ >QXQ@ YRQHLQDQGHU ZLH IROJWXQWHUVFKLHGHQ'XUFK'HILQLWLRQHUNHQQW PDQGDV6HLQXQGGDV:HVHQYRQHWZDVGXUFK 7HLOXQJ HUNHQQW PDQ GDV 9HUP|JHQ GHV 'LQJHV LQ GHVVHQ 7HLOHQ GXUFK 6FKOLH‰HQ HUNHQQW PDQ GLH (LJHQVFKDIWHQ XQG GLH 5HDNWLRQVZHLVHQ GHV 'LQJHV 'LHVH (UNHQQWQLVPRGL EHKDQGHOW GLH /RJLN DOVR XVZ

C OMMENTARY

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀃󰀀󰀁

ϭ

+RF WDPHQ LQNNMZ]V\'HILQLWLR HQLP LQGLFDW LQFRPSOH[D Y]WILHVVH GLYLVLR TXRDG SRVVH

Ϯ

DUJXPHQWDWLR LQGLFDW TXRDG SURSULHWDWHV HW SDVVLRQHV TXLD SURSULHWDWHV HW SDVVLRQHV

ϯ

GHPRQVWUDWLYHSUREDPXVGHVXELHFWR(WLWDµ QXOODVFLHQWLDSRWHVWVFLULQLVLSHUPRGRVVFLHQGL

ϰ

TXRVORJLFD GRFHW 8QGHTXDQGRLQFRPSOH[XP GHEHW VFLULTXRDGHVVHWXQF RSRUWHWGHILQLUL TXLDLMNQVQ\QWRVWHQGLWTXLGVLWHLXVHVVHQWLDHWTXDHGLIIHUHQWLDHLFRPSHWDW(WTWOQKIGRFHWGLYLGLUH

ϱ ϲ ϳ ϴ

HWDUJXHUHHWLGHRORJLFDQHFHVVDULDHVWDGDFTXLVLWLRQHPDOLDUXPVFLHQWLDUXPFXPLSVDVLWGH PRGLVVFLHQGLTXRUXPFRJQLWLRDQLPDSULPRUHTXLULWTXLDORJLFDGLULJLWLQWHOOHFWXPDGHQWLD UDWLRQLV                             differuntFRQL @est differunt/&Iɲ5HFQuae sic different quoadFRQL @ad/&IORFLQIUDdivisio quoad posse, argumentatio indicat quoad proprietates et passiones LELG quando incomplexum debet sciri quoad esse, tunc oportet definiri &I HWLDP ɲ5HF per definitionem cognoscitur aliquid quantum ad sui esse et essentiam, per divisionem quantum ad sui posse >@, per demonstrationem quantum ad suas proprietates et passions ØFRQL @cum/ definitioFRQL @RP/ logicaFRQL @RP/

󰀃󰀀󰀂

A NDRÉS Q UERO -S ÁNCHEZ

,WHP GH UKHWRULFD SDWHW TXRG VLW DGPLQLFXODWLYDDGDOLDVVFLHQWLDV4XLDVLFXW ORJLFDGLULJLWLQWHOOHFWXPLQVSHFXODELOLEXV VLFUKHWRULFDGLULJLWLQWHOOHFWXPLQSUDFWLFLV 8QGH SULPR Rhetoricae GLFLWXU TXRG ªUKHWRULFDHVWH[HFXWLYDORJLFDHHWHVWSDUV HLXV©    2EPLVVLV DXWHP RPQLEXV DOLLV VFLHQWLV GH ORJLFD DG SUDHVHQV LQWHQGLPXV >@

         

(V LVW RIIHQVLFKWOLFK GDVV DXFK GLH 5KHWRULNHLQH:LVVHQVFKDIWLVWGLHXQVEHLGHU $XVEXQJ DQGHUHU :LVVHQVFKDIWHQ LQVWUXPHQWHOO XQWHUVWW]W 'HQQ VR ZLH GLH /RJLN GLH 9HUQXQIW LP *HELHW GHV (UNHQQEDUHQ OHLWHW VR OHLWHW GLH 5KHWRULN GLH 9HUQXQIW LP *HELHW GHV 3UDNWLVFKHQ 'DKHU KHL‰W HV LP HUVWHQ %XFK GHU Rhetorik ª'LH 5KHWRULN VHW]W GLH /RJLN XP XQG LVW HLQ 7HLO GHUVHOEHQ© :LU EHVFKlIWLJHQ XQV QXQ LQ GLHVHU 6FKULIW DOOHLQ PLW GHU /RJLN XQG VHKHQ YRQ DOOHQDQGHUHQ:LVVHQVFKDIWHQDE

                    de@RP(  alias@aliquas(  est@RP( Obmissis autem omnibus aliis scientis@ Omnibus autem scientis obmissis (    9JO $ULVWRWHOHV Rhetorik ,  D ODWHLQLVFKH hEHUVHW]XQJ YRQ :LOKHOP YRQ 0RHUEHND HG YRQ %HUQKDUG 6FKQHLGHU /HLGHQ   Aristoteles Latinus    Rhetorica assecutiva dialectice est; ambe enim de talibus quibusdam sunt que communiter quodammodo omnium est cognoscere et nullius scientie determinate; propter quod et omnes modo quodam participant ambabus; omnes enim usque ad aliquid et exquirere et sustinere sermonem et defendere et accusare conantur9JOAuctoritates AristotelisHG-+DPHVVH  RhetoricaQRhetorica est assecutiva dialecticae

C OMMENTARY

ϭ Ϯ ϯ ϰ ϱ ϲ

ON

P ORPHYRY ’ S ›I SAGOGE ‹ (C OMMENTUM

IN

I SAGOGAS P ORPHIRII )

󰀃󰀀󰀃

6LPLOLWHU UKHWRULFD HVW DGPLQLFXODWLYD DG DFTXLVLWLRQHP DOLDUXP VFLHQWLDUXP 4XLD 3KLORVRSKXVGLFLWSULPRRhetoricaeTXLDVLFXWORJLFDHVWDGPLQLFXODWLYDLQVSHFXODWLRQHVVLF UKHWRULFDLQSUDFWLFLVTXLDUKHWRULFDHVWH[VHFXWLYDGLDOHFWLFDHHWHVWTXDVLSDUVHLXVµ'RFHW HQLP SHUVXDGHQGL PRGXP HW LQIOHFWHQGL LXGLFHP DG PLVHUDWLRQHP SDUWLV SURSULDH HW DG LQGLJQDWLRQHPSDUWLVDGYHUVDH 6HGREPLVVLVRPQLEXVITQQ[[KQMV\QQ[ SUDHVHQVLQWHQWLRYHUVDWXUFLUFDORJLFDP>@>@                                 acquisitionem@FRUULQPDUJH[scientiam / aliis scientiisFRQL @RP/&Iɲ5HFObmissis autem omnibus aliis scientis

PRINTED ON PERMANENT PAPER

• IMPRIME

SUR PAPIER PERMANENT

N.V. PEETERS S.A., WAROTSTRAAT

• GEDRUKT

OP DUURZAAM PAPIER

50, B-3020 HERENT

- ISO 9706