Metaphysical Conversations and Phenomenological Essays 9783110763065, 9783110763096, 9783110763157

Citation preview

Hedwig Conrad-Martius Metaphysical Conversations and Phenomenological Essays

Women Philosophers Heritage Collection

Introduction, Translation and Original Text Edited by Ruth Edith Hagengruber In Cooperation with Antonio Calcagno, Priyanka Jha, Rodney Parker

Volume 1

Hedwig Conrad-Martius

Metaphysical Conversations and Phenomenological Essays Edited, Translated, and with an Introduction by Christina M. Gschwandtner

These works have originally been published in the German language: Hedwig Conrad-Martius, “Phänomenologie und Spekulation” (pp. 370–384) and “Die transzendentale und die ontologische Phänomenologie” (pp. 393–402) in Schriften zur Philosophie, vol. 3, ed. Eberhard Avé-Lallemant, Munich: Kösel 1965. Hedwig Conrad-Martius, Metaphysische Gespräche. Halle: Max Niemeyer 1921. Original works published with permission.

ISBN 978-3-11-076306-5 e-ISBN (PDF) 978-3-11-076309-6 e-ISBN (EPUB) 978-3-11-076315-7 ISSN 2510-9227

Library of Congress Control Number: 2023939081 Bibliographic information published by the Deutsche Nationalbibliothek The Deutsche Nationalbibliothek lists this publication in the Deutsche Nationalbibliografie; detailed bibliographic data are available on the Internet at http://dnb.dnb.de. © 2024 Walter de Gruyter GmbH, Berlin/Boston Cover image: Ruth Edith Hagengruber Printing and binding: CPI books GmbH, Leck www.degruyter.com

Contents Introduction   1  Approach to Phenomenology   Body, Soul, Spirit   8  The Human Being   10  Creation and Evolution   12  Conclusion   15 Bibliography   15 Translator’s Notes 

 4

 17

Phenomenology and Speculation 

 23

Transcendental and Ontological Phenomenology   43 Metaphysical Conversations  Plant and Animal   43 The Soul   53 Concerning the Human   81  The Animal and the Qualifying Source   Demons and Angels, Spirit and Spirits   Evolution—The Human   121

 35

 81  94

German Original Texts Phänomenologie und Spekulation 

 159

Die transzendentale und die ontologische Phänomenologie   181 Metaphysische Gespräche  Pflanze und Tier   181 Die Seele   192 Um den Menschen   221  Vom Tier und der Quall   221  Dämonen und Engel, Geist und Geister   Evolution – Der Mensch   261 Index 

 298

 235

 173

Introduction Metaphysische Gespräche (“Metaphysical Conversations”) is one of the first published works (1921) by Hedwig Conrad-Martius (1888 – 1966), an important early phenomenologist, almost unknown in the English-speaking world. She belonged to what is known as the Göttingen Circle of phenomenology, a group of students gathered around Edmund Husserl and Adolf Reinach, before Husserl’s move to Freiburg (1916) and Reinach’s untimely death at the Yser Front (1917). Core members of this group, including Conrad-Martius and her future husband, Theodor Conrad, had originally studied with Moritz Geiger, Theodor Lipps, and Alexander Pfänder in Munich and were inspired by Husserl’s visit to Munich in 1904 to follow him back to Göttingen; Conrad-Martius joined the group there in 1910. One of her earliest studies won a university philosophy prize (1912), was accepted by Pfänder as a dissertation project, and awarded the doctorate with distinction by the University of Munich. In 1907 the students and young academics founded a “Philosophical Society” (Philosophische Gesellschaft Göttingen) inspired not only by Husserl but also by Reinach and Max Scheler. After Dietrich von Hildebrand’s departure, Hedwig Conrad-Martius served as the convening chair of this society. She clearly held important stature in this group, which is even more remarkable given how few women were present in academia at the time.¹ She also served as an important mentor to younger students like Edith Stein, who joined the Göttingen Circle when she came to study with Husserl in 1913.² Conrad-Martius is the only female figure to whom Herbert Spiegelberg devotes a separate section in his monumental history of the phenomenological movement (albeit only in the revised and expanded edition), although he did not write this section himself but translated a contri Although women had in principle been permitted to obtain academic degrees, in practice they had been barred from pursuing Habilitation projects and thereby effectively barred from gaining professorships. Conrad-Martius repeatedly tried to pursue a Habilitation project, but remained ultimately unsuccessful in this, although some women were beginning to do so after the war. She did finally obtain a teaching position in Munich in 1949 and was conferred an honorary professorship after her retirement in 1955. The biographical and circumstantial information provided here is largely based on Avé-Lallemant’s introduction in Spiegelberg (1982, 212– 222). See also the introduction to the dissertation by James Hart and Rodney Parker’s introduction to the translation of the first two chapters of Metaphysics of the Earthly (Hart 2020, 1– 7, 243 – 250). I am grateful to Rodney Parker for his careful reading of this introduction and his various suggestions that rendered it more accurate and precise in several places.  They did not first meet in Göttingen, because Conrad-Martius had already left when Edith Stein arrived. See her moving tribute to Stein after the latter’s death in her edited collection of Stein’s letters to her (Stein 1960, 61– 83). The text was originally written as an address to the Gesellschaft für christlich-jüdische Zusammenarbeit. https://doi.org/10.1515/9783110763096-001

2

Introduction

bution by Eberhard Avé-Lallemant, who was one of Conrad-Martius’ most significant and devoted students and who also collected her unpublished lectures and briefer texts shortly before her death, publishing them in three volumes (Conrad-Martius 1963, 1964, 1965).³ Who was this remarkable woman, so important to the early development of phenomenology and yet virtually unknown in the English-speaking world? Hedwig Martius was born into a prominent medical family in northern Germany. She originally intended to study literature, but quickly switched to philosophy. She married Theodor Conrad, a fellow phenomenologist, in 1912. When she was unable to habilitate and secure a professorship, the Conrads moved to an apple farm in Bergzabern, so that they would have sufficient income for Conrad-Martius to keep writing. Here many of the phenomenological friends they had made during their time in Göttingen would come for a few weeks over the summer to pick apples and talk phenomenology, including Stein and Jean Héring, a Lutheran professor at the University of Strasbourg who wrote the first monograph on phenomenology in French, Phénoménologie et philosophie religieuse (1925) and introduced his young friend Emmanuel Lévinas to phenomenology, sending him across the border to Freiburg to attend Husserl’s final and Heidegger’s inaugural lectures there between 1928 and 1929.⁴ Conrad-Martius’ writings, especially the Metaphysical Conversations, are among the most important and most frequently cited sources in Héring’s Phénoménologie et philosophie religieuse. Her Realontologie, dedicated to Husserl for his 60th birthday, was published in the Jahrbuch für Philosophie und phänomenologische Forschung in 1923. During World War II, Conrad-Martius was forbidden to publish by the Nazi regime, although she continued to write and prepare talks.⁵ At this time, she worked on a book on creation, a topic dear to her heart, as is evident already in the much earlier Metaphysical Conversations. ⁶ Many of these ideas entered into later lectures and shorter texts, although a full book on the topic was never published. Her books on being (Das Sein), on time (Die Zeit), and on space (Der Raum) were similarly all composed in the 1930s, but not published until the

 Two important essays from volume 3 of the collected works are included in the present translation.  For an account of this “Bergzabern Circle,” see Feldes (2015).  Rodney Parker notes in his introduction to the appendix in Hart’s Hedwig Conrad-Martius’ Ontological Phenomenology that her maternal grandfather, Emil Gustav Leonhard (born Emanuel Levysohn), was Jewish (Hart 2020, 246).  Although her book on creation was never published, she did develop her ideas in several essays and in her Metaphysics of the Earthly, which was left unfinished upon her death. The first two chapters of this work are translated by Rodney Parker in an appendix to Hart’s Hedwig ConradMartius’ Ontological Phenomenology.

Introduction

3

1950s. She also contributed work on the nature of light and colors, hints of which can already be detected in Metaphysical Conversations and were also already explored in her other early text, Realontologie and in her 1929 essay “Farben” [Colors]. Conrad-Martius finally gained access to a lectureship in philosophy at the University of Munich in 1949, where she taught until her retirement. Most of her published works appeared during the late 1940s and early 1950s. Like others of her circle, she was critical of Husserl’s idealist turn, which she perceived as an abandonment of an ontological phenomenology and a capitulation to the prevailing neo-Kantianism of the day. Her work became increasingly more oriented toward metaphysical questions about the fundamental principles undergirding all of reality, including a significant interest in natural science, an area in which she had read extensively during the 1930s and 1940s. She considered this direction of reflection an important task of phenomenological thinking, a third phenomenological approach, distinguished from Husserl’s “idealist” phenomenology and Heidegger’s “existentialist” one, and maybe most faithful to Husserl’s early focus on the Wesen or nature/being of things. Aside from Realontologie, Metaphysical Conversations is probably her most explicitly phenomenological work; despite its title, it is conceived as a phenomenological conversation about “metaphysical” issues, such as the nature of soul, body, and spirit, a topic that preoccupied her for most of her philosophical career.⁷ Important later texts on these topics also include her lectures Bios und Psyche (Conrad-Martius 1949) and the briefer work Die Geistseele des Menschen [“The Human Spirit-Soul”] (Conrad-Martius 1960). The present volume also includes two especially illuminating later essays, in which Conrad-Martius outlines her conception of phenomenology and her criticisms of Husserl and Heidegger, both in regard to the directions in which they took phenomenology and what she regards as their abandonment of the question of the being of beings and the “really real” (wirkliche Wirklichkeit). “Phenomenology and Speculation” was originally delivered as a lecture at the University of Göttingen on November 7, 1956 upon the invitation of the theology department and two months later also to the Augsburg Philosophical Society on January 17, 1957.⁸

 The second part of the text is identical to her earlier article “Von der Seele” (Conrad-Martius 1917, 106 – 136).  “Phänomenologie und Spekulation” was first published in a Festschrift (Conrad-Martius 1957a, 116 – 128) and later reprinted in Schriften zur Philosophie (Conrad-Martius 1965, 370 – 384). A first English translation by William J. Kramer was published in Philosophy Today (Conrad-Martius 1959b, 43 – 51). The translation included here does not depend on this earlier translation, of which I was unaware at the time.

4

Introduction

It outlines the three approaches to phenomenology, insists that ontological phenomenology is genuine phenomenology, and shows what contribution it can make to the natural sciences. “Transcendental and Ontological Phenomenology” carries this argument further via a more careful distinction of the ontological approach from Husserl’s later transcendental turn, while arguing that it continues to be faithful to Husserl’s impetus and inspiration.⁹ The present introduction will provide some analysis of these essays and especially Metaphysical Conversations in order to highlight (1) Conrad-Martius’ approach to phenomenology, (2) her insights about the nature of body, soul, and spirit, (3) her conception of the human being, and (4) her early attempts to marry an evolutionary worldview with a notion of creation, something she would elaborate more fully in subsequent publications.

1 Approach to Phenomenology Although they are later texts, the two essays “Phenomenology and Speculation” and “Transcendental and Ontological Phenomenology” provide an excellent introduction to how Conrad-Martius conceives of phenomenology in general and her own contributions to phenomenology specifically. As already mentioned, she distinguishes three approaches to phenomenology: Husserl’s late “transcendental-idealist” phenomenology, carried on by Ludwig Landgrebe and Eugen Fink, which she acknowledges to represent most faithfully Husserl’s own fully formulated conceptions, Heidegger’s “existentialist” phenomenology, which she had already criticized in a 1933 review of Being and Time (Conrad-Martius 1963, 185 – 193), and a third approach represented by the members of the Göttingen school, which she presents as most faithful to Husserl’s early insights, especially those articulated in the original version of the Logical Investigations. The most important phenomenological tool employed by this third (or really first) approach is the Wesensschau, often translated as an “intuition of essences” but for these thinkers more a systematic and thoughtful investigation into the nature of things, a consideration of what makes a being the sort or kind of being it is, thereby distinguishing it from other beings or things, while providing insight about its ontic nature. She distinguishes this phenomenological attitude from an empirical approach that would simply collect data about things. A phenomenological approach, instead, selects particularly paradig-

 “Die transzendentale und die ontologische Phänomenologie” was first published in a volume of Phaenomenologica (Conrad-Martius 1959a, 175 – 184) and later reprinted in Schriften zur Philosophie (Conrad-Martius 1965, 393 – 402).

1 Approach to Phenomenology

5

matic or representative cases that are then analyzed carefully to understand their nature as fully as possible. In the Conversations, this phenomenological search for the essential is modeled on a Socratic dialogue with Montanus serving as the wise guide and Psilander as the skeptical student, the two joining together to search for further insight in mutual collaboration.¹⁰ Such analysis of the nature of the phenomenon need not rely on perception. While empirical insight about a specific plant or animal is best gained through close observation and experiment, no amount of empirical data will ever reveal the underlying principles or arrive at the nature of things. Often distinctions are drawn between what might be true “factually” and what is the case “in principle.” These two kinds of insight are revealed through wholly different attitudes of seeing. She stresses repeatedly—with the teacher often chiding the student interlocutor in the dialogues for forgetting or ignoring this—that the true philosopher can “see” and even “encounter” anything in thought, whether it empirically “exists” or not, whether it is visibly “present” or not: “You are still a bad philosopher, Psilander. Don’t you think that a philosopher can ‘encounter’ any being between heaven and hell if he or she really wants to encounter it? Obviously not in the meadows, in the woods, or in the heavens themselves, but surely in the marvelously inexhaustible ‘realm of intuition’?” (54). Thus, insight or knowledge about the nature of anything (Wesenserkenntnis) can be attained through careful analysis in this mental “seeing” or intuition and through genuine acquaintance (Bekanntschaft), which she calls “direct.” Such work can investigate and reveal the ontological presuppositions that undergird natural science, but are left entirely unexamined by scientists themselves. This constitutes real labor: one must “work out” or “uncover” the true Wesen of things by peeling back layers and digging deeply into the ways they really are and manifest. She will often have the teacher Montanus make remarks like “we have a characteristic aspect, but not the thing itself ” (103) or encouraging the student to use his “penetrating glance for the essential” (134) as what alone is truly at stake. She sometimes refers to this as an “objective” or “theoretical” attitude, which she considers the genuinely “philosophical” one. Insight into the nature of a thing or being is gained through imaginative variation in which one tries to ascertain what belongs essentially to the phenomenon and what can be “taken away” without harm, without turning it into something else or destroying its nature. Thus, “clear intuition” allows us to pinpoint the boundary that distinguishes one nature from another by varying their various attrib Unfortunately, despite diligent sleuthing, I was unable to uncover any special significance to the two names of the interlocutors. There is a second-century Christian prophet, later condemned as a heretic, called Montanus, but it does not seem likely that she would have modeled the wise teacher of the dialogues on this figure.

6

Introduction

utes and seeing which are crucial to the identity or definition of a thing or being. For example, the idea of weight cannot be taken away from a stone; it belongs to it by its very nature. Drawing such distinctions carefully helps us ascertain when a difference consists only in degrees or when it is a difference in quality or fundamental constitution of something. In this respect, a particularly revealing or paradigmatic example or a limit-case might show more than accumulating many trivial or even more obvious cases. Montanus calls it an attitude focused on “the theoretical distinction of types via especially vivid examples” (46). Interestingly, at one point she also refuses explicitly what Heidegger will later say, namely that our existence as human gives us a privileged perspective on our being because it is closer to us and more immediately available: “It is strange, my friend, but I assure you: the fact that we know ourselves from the inside, adds far less to our ability to uncover our nature’s fundamental structure of being than one usually thinks” (81). Neither “nearness” nor “simplicity” is a guarantee of easier grasping. To accomplish this investigation into the nature of things, the Metaphysical Conversations has recourse to some quite unusual figures, such as examining the nature of fairies, nymphs, and other creatures drawn from folk tales to work out the nature or definition of spirit. The teacher insists that no claim is made about their existence at all, but the focus lies instead on their “objective idea” or the “structure” of their being, regardless of whether they exist in fact or not—a kind of thought experiment. She also sometimes draws on insights from theological or mystical thinkers, especially the early modern mystic Jakob Böhme (1575 – 1624) and the colorful self-taught Catholic theologian industrialist and mining engineer Franz von Baader (1765 – 1841), stressing repeatedly that no claims are being made about the empirical existence of angels, demons, or the divine or about the historical occurrence of a fall or an “integral” pre-lapsarian human being. When Psilander objects to the introduction of theological ideas, Monantus stresses: “Even though we are not philosophers of religion, there is little that is more instructive than looking at the essential relationships that underlie these perspectives. Nowhere are the true limits of being preserved in purer fashion than here; that is why one can learn so very much from them” (70). Psilander suggests at a later point that even fairytales might “harbor truths that actual existence denies” (148). For Conrad-Martius, such “theological” and “fairytale” or folklore imagery can inspire or contribute to a phenomenological investigation, because what is a persistent part of the human psyche and cultural heritage cannot be logically contradictory to the nature of things. That is to say, if the notion of an “integral” human being is thinkable—which it is because theologians have indeed thought it over centuries—it cannot contradict what the human is as such, what characterizes human nature in its particular kind. Belief in such crea-

1 Approach to Phenomenology

7

tures or in specific theological claims is not necessary for drawing significant insights from them or employing them for philosophical reflection. Another important dimension of this method, already mentioned repeatedly in the conversations but made even clearer in the essay on speculation, is the idea that imagery or metaphor we employ unthinkingly in diverse fields or disciplines may reveal important truths about the nature of things. In the conversations, she has Montanus point out that “if the image can be applied to the matter at hand, then it signifies something” (103). In the essay she employs the notions of force and light to show that if these terms designate something “real” in physics, they have similar reality in other respects and are not simply metaphors transferred from one realm to another. To speak of the “light” of reason or of the understanding says something meaningful that is no less metaphorical than to speak of waves or particles of light in the physical realm. Thus, she consistently tries to hold together physical and psychical in a way that does not permit artificial separations between them, an approach that also defines her work on the relationship between body, soul, and spirit. Although much of the work is about becoming clear about the distinctions between them in terms of their particular nature and function, these investigations at the same time always seek to show a fundamental continuity and to affirm intimate relationships that challenge the splits between mind and matter or body and soul so characteristic of modern philosophy from Descartes to Kant. One of her phenomenological tasks is precisely to overcome these dichotomies via a penetration to the true nature of things, which are much more integrally connected. Finally, the interlocutors frequently distinguish a philosophical or phenomenological investigation or insight from a psychological or anthropological one. Phenomenology is about depiction and analysis, not about “positing” things or even explaining them in the sense of giving causal or developmental reasons. Montanus repeatedly questions Psilander on this issue, making sure that their joined analysis or a particular insight is not understood in a “psychological” sense or as mere statement about empirical data rather than the nature of things. For example, he stresses: “But we would not want to connect genetic or developmental points of view with this formulation” (89). Or he inquires of Psilander at a different point: “But you understand that this is meant as a constitution in regard to its nature, not as an action or a genesis” (123). Similar comments are made repeatedly, always rejecting the developmental interpretation in favor of an “ontic” or “fundamental” approach or attitude. The “ontic” lies on a lower or deeper level than the psychological or anthropological. This ontic basis cannot simply be dismissed or “stripped off ”; “it just is” (74). That is to say, “the ontic basic condition and manner of each creature gives a thoroughly particular imprint to all of its expressions, manifestations, and experiences in a fundamental sense” (75). Investigating this

8

Introduction

ontic condition is one of Conrad-Martius’ most consistent preoccupations, maybe even the distinguishing characteristic of her work. Phenomenological or metaphysical methods or approaches are simply employed as needed in the service of this overarching goal.

2 Body, Soul, Spirit The concrete topic under investigation in the Metaphysical Conversations, as in many others of her texts, is the nature of the soul (Seele), its relation to body (Leib) and spirit (Geist), and the nature of the human more generally. The interlocutors begin, as Conrad-Martius will continue to do in later lectures and treatises, with the distinctions between plants and animals, then proceeding to that between animals and humans. These distinctions were, in fact, under attack at the time with research in biology suggesting that plants might have sensory capacities and that early life forms in particular might not allow for clear distinctions between plants and animals but serve as transition forms between them. ConradMartius resolutely rejects such blurring of boundaries and early on even considers distinctions between species to be inviolable, something she later retracts, admitting that the research clearly shows that transitions between species are possible (e. g., Conrad-Martius 1949, 67). Throughout her work, from early to later texts, plants are defined by their shape or figure in terms of their bodies, animals by their activity and possession of a soul, and humans by their freedom of spirit, which they possess in addition to body and soul. This schema becomes increasingly more complex, however, because she also distinguishes between “lower” and “higher” animals whose “souls” are quite different. In addition, she will later speak of the human “spirit-soul” (Geistseele des Menschen). Already in Metaphysical Conversations she distinguishes between several connotations of body, soul, and spirit. A soul can be attributed in metaphorical fashion to some plants; a spirit lies over a landscape or speaks through a painting or symphony; there can be a bodily kind of soul and soulful kind of spirit and so forth. This obviously complicates the picture considerably and introduces various nuances that are explored in the dialogues through phenomenological variation and thought experiments. Fundamentally, the body is the dwelling or clothing of any living being: “the being clothes itself with the body, envelops itself in it, encircles, encloses, seals itself up in itself ” (144). Yet bodies are inhabited differently, depending on whether such a being also has a soul and/or spirit. Without a soul there can be no living center in a being, from which its actions can be directed or guided in any form (even if just in reaction to instinct or external stimuli). This is the case for plants and to some extent even for lower animals. Although these may have a soul, they

2 Body, Soul, Spirit

9

do not yet have a true “soul space” that creates such a place for the soul to deepen into their core. It is worth noting in this context that she employs spatial imagery very heavily throughout her work. One of the interlocutors points to this fact and qualifies it briefly by suggesting that “the spatialized expressions in this depiction are mere imagery” (141). (This may well be questioned, given that there is never just “mere imagery” for Conrad-Martius, but imagery is always meaningful and telling!) The plant is fully enclosed in its body, unable to separate from it in any fashion, defined as the “figured” (or formed or shaped) being as such (Gestaltswesen katexochen). That is to say, plants are defined by the shapes and forms of their bodies and without any relation to the body but entirely wrapped up with it. The plant remains in a sense external to itself, cannot enter itself, own itself, or descend into itself. It does not “have” itself in the way in which animals or humans do. The animal, conversely, is able to have a relationship with its body, because it has a soul that allows it to direct its body. The animal owns or possesses its body, is free from it in some way, and thus able to direct it, something impossible to the plant. The soul is characterized by a deepening and movement to the interior. Having a soul allows a being to enter into its core and to operate from this interior space. The soul “radiates into the body” (58) or serves as its mirror. She describes the soul as “the true center or real middle of the totality of the configured and constructed I” (59). The soul is thus not, as Aristotle and the Scholastics thought, the “form” of the body, but instead its inner center. The soul in its proper sense “is not what determines or forms, but what is co-determined, co-figured, co-formed” (67). The soul allows a being to sink into or descend into itself, to focus on itself in the innermost core of its being. It gives weight and solidity to the being and a measure of personhood. In sum: “The animal has a personal body, but not a personal soul; for it is master over this body, because it has its standpoint no longer in it but in its soul; yet it is not master over the soul, precisely because it has its standpoint in it” (140). Animals and spirits thus only have a measure of personhood—and in a different sense—because animals lack a spirit and spirits lack a soul. Animals cannot rise up from themselves; spirits cannot sink into themselves. While animals are full; spirits are hollow. (Humans, in contrast, are able to experience an inner nakedness or nudity.) Animals are fundamentally or quintessentially “beings of action” (Aktionswesen katexochen); their soul enables the directing of movement and initiating of activity. The spirit, in contrast to the soul, is characterized by an elevating, upward and outward, movement. The spatial imagery is again strong: at one point the discussants speak of the body in terms of width, the soul in terms of depth, and the spirit in terms of height. Another important distinction between soul and spirit is the association of weight with the soul and lightness with the spirit. In this regard,

10

Introduction

Conrad-Martius also plays on the etymology of spirit as breath. The spirit allows a standpoint that is not merely separate in some way from the body (as the soul also is), but also separate from the soul. By means of the spirit, humans can stand “outside” their bodies and souls in some form. Through its spirit, a being “pours itself out, is wholly given out of and from itself, outside itself, free from itself and from the secured and delimited burden of its own self ” (144). It is important that Geist is spirit, not “mind” as it is often translated in philosophical texts. While the mind is an aspect of spirit, for Conrad-Martius the term is much broader and does not refer merely to mental processes, which, indeed, can already be present in some animals in rudimentary fashion. Nor is soul reducible to appetite and emotion. (And it definitely does not designate some sort of “spiritual” essence as it has increasingly come to mean in popular parlance.) The essence of spirit is not thought but freedom. Yet Geist refers not just to a human faculty, but also to other spiritfigures. The Metaphysical Conversations includes extensive discussions of other than human spirits: elemental spirits, spirits of nature, demons, angels, and so forth.¹¹ These are considered precisely in order to distinguish and grasp the nature of spirit as such—and ultimately to gain a better understanding of the nature of the human. Elemental spirits (such as fairies or wood sprites) are substantivized forms of the spirit operative in the respective sphere of nature. Unlike humans, they are completed absorbed into the particular sphere of spirit from which they are determined and cannot ultimately separate from it. This helps the interlocutors understand the nature of the human more fully.

3 The Human Being Human nature is the main topic of the Metaphysical Conversations, although the conversation partners arrive at this topic only after tracing the most circuitous routes through plants, animals, nymphs, fairies, demons, and angels. Humans have body (Leib), soul (Seele), and spirit (Geist). Conrad-Martius is clear that this is a “having” (Habe). In several contexts, she will later stress against Heidegger that it is wrong to say that we “are” our body or soul; we have a body and soul and spirit, but are not identical with it. (Stein concurs with this and stresses it in her own review of Heidegger’s Being and Time.) The “having” of body, soul,  Interestingly, she argues that spirits have a deep hunger for embodiment and thus try to occupy bodies. There is no reason to believe that J. R. R. Tolkien or J. K. Rowling read Conrad-Martius, but this is precisely how Tolkien depicts the dark lord (Sauron) in the Lord of the Rings and how Rowling describes Voldemort—hungering for embodiment and able to exist and exert power only by occupying the bodies of others.

3 The Human Being

11

and spirit is indeed a kind of owning—as we have seen, already animals own their bodies via their soul. This prepares her later distinction between sichhaft and ichhaft—the ways in which animals and humans “have” themselves (or own themselves) differently (worked out most fully in Bios und Psyche). It also means that the human is not reducible to either body or soul or spirit, but has a self or I that is in relation to them, but not identical to any particular part. Humans are able to relate to their bodies (via their soul) and to their souls (via their spirits), in some fashion enabled to stand out outside them. They can strip off (at least metaphorically) the clothing of their bodies. While plants are defined by their figure or shape and animals by their capacity for activity, humans are fundamentally beings of freedom (Freiheitswesen katexochen). Despite Conrad-Martius’ insistence that humans “have” body, soul, and spirit, rather than being identified with one of them, she does not think of the human as merely a composition or compilation of parts or portions. Rather, the human is a self who is fashioned out of a single root and is expressed in body, soul, and spirit, wholly, albeit differently in each. She suggests a distinction between the I and consciousness (or spirit) that she thinks is not being maintained even by contemporary phenomenology, which on the one hand assimilates the self to the mind and on the other hand turns the body into an external appendage not as essentially part of the I as mind, soul, or consciousness: “According to the prevailing view the soul or even the spirit (or ‘consciousness’) always seems to collapse into the I as such, while the body only seems attached to the I in some external fashion, so that it seems to require a sort of transposition to see body, soul and spirit as belonging equally to the I or to see them as particular areas of configuration of the one and only I” (59). The I thus “is itself, but possesses soul, spirit, and body” by working itself out into them, permeating them, operating them, deepening into body and soul, but also rising up out of them via the spirit. For humans to live and operate in the world they must be able to have this relationship with their own being, rather than being entirely absorbed into it (as she thinks animals are who are directed only by instinct and stimulus). That is, “only because humans as such are placed or set into themselves or into their own center, can they at the same time appear as if elevated into it or raised above themselves” (72). Any creative expression, whether mental, emotional, or physical, allows the human being to exercise its freedom and to rise above mere instinct. This does not mean that body or soul have been left behind: “The soul remains necessarily continually in the ‘underground,’ as the final basis of one’s ownmost being and one’s accomplishing oneself in this selfhood, from which one can always merely go forth, yet which one can never fully take up or take out into one’s necessarily peripherally unfolding existence” (79). The soul is what binds us to existence; we “are in a sense ‘written into’ existence with it” (79). Unlike animals, hu-

12

Introduction

mans can stand over against their “qualifying source”—on which more in a moment—and be elevated above their own interiority. The distinction between humans and animals is not just a matter of degree: “The real difference is not that humans as such are immersed in themselves to a ‘greater’ extent, that they are rooted more ‘deeply’ in their own being, but that they are immersed in themselves at all, that they are at all poured into their own being, so to say. What is particular is not the degree of ‘self-rootedness’ but its pure fact” (68). The soul allows us to experience something deeply, while the spirit permits us to gain perspective on it or to relate to it. Ultimately, for Conrad-Martius, “the human stands in the center of all being” (82), in the sense of the Platonic and patristic notion of the microcosm.¹² This does not, of course, prevent her from digging deeply into the nature of other beings or other aspects of the cosmos.

4 Creation and Evolution In this early text, Conrad-Martius draws on medieval and mystical conceptions of a “qualifying source” (Quall) in each being that makes it what it is, marrying the phenomenological search for the “Wesen” or nature of things with this notion of distinctive nature. The interlocutors of the conversations tentatively attribute such a source even to inanimate beings, such as gold or other elements, although this is worked out less fully. She employs two terms for this, both drawn from Böhme, but influenced by older conceptions: Quall and katexochen. (These terms are used less heavily in her later work, although they still appear on occasion. She will also sometimes in later texts employ the Latin qualia.) Each being stands in its own Quall, the “logos” or “word” that speaks (or defines) its specific nature. This Quall or qualifying source is not only what generates something but what defines its nature or being, what makes it this thing and not another, what it is as such or quintessentially, katexochen. Although the qualifying source makes each thing—including primary elements—what it is, it becomes increasingly more

 One should point out, though, that she is generally quite critical of Plato or what she perceives as Platonizing tendencies in philosophy or theology. For example, in one instance she criticizes Aquinas for still being too Platonic (Conrad-Martius 1963, 247), in another she objects to Plato’s notion of the preexistence of souls (Conrad-Martius 1963, 157), in another context she claims that she is trying to avoid both a naturalistic, evolutionist, vital approach and a scholastic, Platonizing one (Conrad-Martius 1921, 187). She also argues extensively against what she considers the paleontologist Edgar Dacqué’s mythical, Platonizing, and incoherent account of stone-age existence (ConradMartius 1965, 163 – 183). At the same time, the strong influence of Jakob Böhme on her work certainly imbues it with some Platonic tendencies.

4 Creation and Evolution

13

fully integrated into the very being of the thing in “higher” beings. That is to say, it is a purely passive distinctiveness in the case of basic elements, but can become actively appropriated by animals or humans and thus unfolded far more fully. These conceptions (or maybe convictions) are partly the reason why she initially refuses any transitions between species. Montanus puts this quite strongly: “You are aware that this attempt is completely absurd philosophically in the cases that concern constitutive formal limits of being. Even if there are always beings that precede the differentiation of animal and plant, even if it may be possible for these to mix de facto in particular ways—the radical opposition that, as I said before, depends on the ontically formal, cannot be touched even tangentially” (90). That is to say, she interprets earlier forms as not yet animal or plant, rather than transition forms between them that would challenge the fundamental ontological distinctions between plants and animals or even between different species of plants or animals. Yet, Conrad-Martius is no religious fundamentalist peddling some sort of creationism, despite her profound belief in a creator. She is deeply read in the natural science literature of her time and disputes aspects of it with an informed and nuanced perspective of the most recent research in biology, geology, chemistry, and physics. Indeed, she published several books on the ontic foundations of biology, on the nature and origin of the cosmos (Conrad-Martius 1938), on the constitution of nature (Conrad-Martius 1944), and on the metaphysical principles underlying the natural sciences (Conrad-Martius 1948). Her objections in these texts are most explicitly against the social Darwinism employed to justify a racist and atheist account of human descent (see also Conrad-Martius 1955). Even in the much earlier Conversations, she does not reject the notion of evolution, but only the idea of random chance elevated into a creative principle, which she judges incoherent, as absolute agency is attributed to individual beings in independent fashion. In the latter part of the Metaphysical Conversations she tentatively explores a way to combine the notion of creation with the idea of chance and random variation, drawing on the patristic notion of the “logos” of creatures, i. e., the fundamental or distinctive principle that stands over and above or maybe behind their natures without determining them concretely in any specific detail, an idea she also sees confirmed by Johann Wolfgang von Goethe’s notion of a primordial plant (Urpflanze) in his Metamorphosis of Plants and diverse botanical studies. She will continue to develop these ideas in much more detail in her subsequent work. In the Metaphysical Conversations, Conrad-Martius already suggests that the notion of the logos or “word” of things means that a kind of guiding or blessing power stands over the processes of nature, but that nature is free to explore possibilities in a variety of ways that are randomly selected, with some “luckier” or more successful than others. One might say in this way that the creature creates

14

Introduction

its habitat as much as the habitat determines the species (as many biologists of her day would have said and a position represented by Psilander in the dialogues). While the divine might undergird and enable this process, the process itself—or, rather, the beings involved in it—is free to proceed on its own and to explore a variety of possibilities. God does not micro-manage, but merely “blesses” the most successful attempts.¹³ In each realm (vegetable or animal), the many species seek to develop to higher forms—ranging from very primitive or basic to highly complex—on a huge variety of trajectories of which some are far more successful than others. Montanus describes this as “the configuring logos that, almost as pulling them or standing above them, allows them to become what they are supposed to become” (152). The dialogues draw a distinction between a notion of prime matter that has particular pathways already potentially mapped out within it that only need to be actualized and a more generic unshaped matter that can develop into many directions at once but with none presupposed in any direct or even indirect fashion. It is the latter position Conrad-Martius affirms and sees as a way of bringing together a notion of creation with the scientific insights of evolutionary biology. In this way, Conrad-Martius can maintain that life and the cosmos have meaning, not a meaning that is providentially placed into things and only needs to be discovered, but a creative meaning. In this respect, she tries to find a path between random, irrational, atheistic chance on the one hand and creative evolution in a vitalist sense on the other, whether that of Henri Bergson or Pierre Teilhard de Chardin. This was a task that occupied her for decades. The Metaphysical Conversations are significant in showing her first attempts to work out these insights and to reveal perhaps more fully than later texts what philosophical and theological presuppositions or commitments undergird them. By putting them into the mouth of two interlocutors she is able to hold in tension a more theologically committed perspective with a more skeptical atheistic or at least agnostic voice. They keep each other on a philosophical path by drawing on some theological insights or sources but always returning to the phenomenological commitment to penetrate to the “nature” of the phenomenon by exploring it as carefully and openmindedly as possible.

 Success does seem to be measured, however, by how close a particular species comes to the guiding divine idea, where the natures of plants or animals reach their fullest unfolding and “purest manifestation.” It is worth remembering that this is a very early text and that she develops her notions about the sciences much more fully subsequently, including being open to revision of her ideas when they do not match the scientific evidence, while always insisting that much empirical science leaves unexamined the ontological presuppositions that undergird their work.

Bibliography

15

5 Conclusion More than a hundred years have passed since the original publication of Metaphysische Gespräche. Despite Conrad-Martius’ stature in the early phenomenological movement, none of her work aside from a brief essay or two is translated into English. Yet, hers is an original voice that not only deserves to be heard for its own sake but may well also serve as an important reminder that it is possible to undertake phenomenological research without being hostile either to the natural sciences or to religious and mystical perspectives. “Continental” philosophy in the English-speaking world has often been highly critical of the natural sciences or at least ignored them, but seldom committed itself to substantive phenomenological work on the bodies of plants, animals, or the natural environment. Conversely, when religion or theology are engaged phenomenologically, this tends to happen in marginalized ghettos, not usually in conversation with the broader discipline. A serious commitment to both at the same time, and on phenomenological grounds, is almost unthinkable. Perhaps fuller engagement with the phenomenological work of this unique philosopher can help us overcome some of these false dichotomies and baseless hostilities, turning our gaze again upon the “matters themselves” as they present themselves to us in their very nature—in the sense of both Wesen and Natur.

Bibliography Conrad-Martius, Hedwig. 1917. “Von der Seele.” Summa 1 (2): 106 – 136. Conrad-Martius, Hedwig. 1921. Metaphysische Gespräche. Halle: Max Niemeyer. Conrad-Martius, Hedwig. 1923. “Realontologie.” Jahrbuch für Philosophie und phänomenologische Forschung 6: 159 – 333. Conrad-Martius, Hedwig. 1929. “Farben.” Husserl-Festschrift. Halle: Max Niemeyer. Conrad-Martius, Hedwig. 1938. Ursprung und Aufbau des lebendigen Kosmos. Salzburg: Müller. Conrad-Martius, Hedwig. 1944. Selbstaufbau der Natur. Hamburg: Claassen & Goverts. Conrad-Martius, Hedwig. 1948. Naturwissenschaftlich-metaphysische Perspektiven. Heidelberg: Kerle. Conrad-Martius, Hedwig. 1949. Bios und Psyche. Hamburg: Claassen & Goverts. Conrad-Martius, Hedwig. 1954. Die Zeit. Munich: Kösel. Conrad-Martius, Hedwig. 1955. Utopien der Menschenzüchtung. Munich: Kösel. Conrad-Martius, Hedwig. 1957a. “Phänomenologie und Spekulation.” In M. J. Langeveld (ed.) Rencontre/Encounter/Begegnung: Festschrift für F. J. J. Buytendijk, 116 – 128. Utrecht/Antwerpen: Spectrum. Conrad-Martius, Hedwig. 1957b. Das Sein. Munich: Kösel. Conrad-Martius, Hedwig. 1958. Der Raum. Munich: Kösel. Conrad-Martius, Hedwig. 1959a. “Die transzendentale und die ontologische Phänomenologie.” In Jacques Taminiaux, Herman Van Breda (eds.) Edmund Husserl, 1859 – 1959 (Phaenomenologica 4), 175 – 184. The Hague: Martinus Nijhoff.

16

Introduction

Conrad-Martius, Hedwig. 1959b. “Phenomenology and Speculation,” trans. William J. Kramer. Philosophy Today 3(1): 43 – 51. Conrad-Martius, Hedwig. 1960. Geistseele des Menschen. Munich: Kösel. Conrad-Martius, Hedwig. 1963. Schriften zur Philosophie. Vol. 1, ed. Eberhard Avé-Lallemant. Munich: Kösel. Conrad-Martius, Hedwig. 1964. Schriften zur Philosophie. Vol. 2, ed. Eberhard Avé-Lallemant. Munich: Kösel. Conrad-Martius, Hedwig. 1965. Schriften zur Philosophie. Vol. 3, ed. Eberhard Avé-Lallemant. Munich: Kösel. Feldes, Joachim. 2015. Das Phänomenologenheim: Der Bergzaberner Kreis im Kontext der frühen phänomenologischen Bewegung. Nordhausen: Traugott Bautz. Hart, James. 2020. Hedwig Conrad-Martius’ Ontological Phenomenology, ed. Rodney Parker. Cham: Springer. Spiegelberg, Herbert. 1982. The Phenomenological Movement: A Historical Introduction. 3rd revised and enlarged edition. The Hague: Martinus Nijhoff. Stein, Edith. 1960. Briefe an Hedwig Conrad-Martius, ed. Hedwig Conrad-Martius. Munich: Kösel.

Translator’s Notes Certain terms in Conrad-Martius’ work are particularly difficult to render into English and thus require some comment. First, the term Wesen is absolutely crucial to her work, as is true of many early phenomenologists. It means something like the “nature” or “essence” of something, what makes it the kind of thing it is rather than something else. It is employed to translate the Greek term ousia and actually reproduces even the Greek sense of ousia as property or dwelling (the German anwesen as verb means to be present but Anwesen as noun means a large estate, farm, or property), but can also refer simply to an individual being or entity. In translations of Husserl’s texts, it is usually rendered as “essence,” but this translation is misleading for Conrad-Martius (and maybe even for Husserl). She often uses Wesen in the sense of an individual being or figure, where “essence” would be simply wrong and distort the sense entirely. Even when she does employ it for the nature of something, this is not some sort of mysterious core that lies at the heart of something or encapsulates it in a concept. The translation “essence” always already implies a kind of idealism. Given how critical she was of Husserl’s “idealist” turn, it seemed to do her work an injustice to translate Wesen by “essence,” and it is hence rendered by “nature” or “being,” depending on context. When she employs Natur (nature) or Sein (being) in the same sentence, it is made clear which term is translated in what way. In Metaphysical Conversations, wesen is also employed as a verb, as is true for body, soul, and spirit. There are no equivalent verbs for any of these four terms in English. (While “to spirit” something or someone away exists in English, it means something wholly different.) The “worst” sentence in that regard is the pithy statement: “Was leibt und geisted, west,” which means something like “what acts in body and spirit, lives” (or dwells). The translation has attempted to convey some of the active sense of the content in those cases without rendering the English incoherent. As is common in German, she frequently employs compound terms, so not just Wesen (or wesen), but wesentlich, wesenhaft, wesenlos, Wesenshaftigkeit, Wesenheit, Wesung, Wesenslehre, Wesensforschung, Wesenserkenntnis, Wesenswissenschaft, Wesensgrenze, Wesensbeziehung, Wesensort, Gestaltswesenheit, Unwesen, Wesenswurzel, Wesensmerkmal, Wesenszusammenhang, Wesensrichtung, Wesensartung, Wesensmoment, Wesensblick, Wesensschau, Wesensverkehrung, wesensverschieden. She employs not just Sein (being) or sein (to be), but seinsmäßig, seinsgemäß, Seiendes, Seiendsein, Seinsabwertung, Seinssinn, Seinsbedeutung, Seinsform (and, of course, Dasein, existential, existentiell, ontisch, ontologisch, etc.). Similarly for Leib (body) and leiben, verleiben, leiblich, leibhaftig, leibgemäß, Leibung, Leiblichkeit, Leibhaftigkeit, Leiblosigkeit, leiblos, einverleiben, ausleiben, Stoffleibung; Seele https://doi.org/10.1515/9783110763096-002

18

Translator’s Notes

(soul) and seelisch, beseelt, seelen, Beseelung, Beseeltheit, selig, beseligt, Seelenlosigkeit, Geistseele, Seelenregung, seelenblind, innerseelisch; Geist (spirit) and geistig, geisten, Geistigkeit, vergeisten, geistgeboren, Geisthaftigkeit, sich geistig darleben, Geisteswort, begeistigt. It is basically impossible to find distinct but still comprehensible equivalents for all of these terms in English, so sometimes the same English word has been used for a couple expressions and the German provided in brackets, sometimes a phrase is used to translate one compound German term (such as “vital force of life” for Lebenstriebkraft). The choices made for these philosophically significant, frequent, or ambiguous terms are listed below. I have tried to be as consistent as possible for all important terms, so that the same German word is always translated by the same English term (except for Wesen, as just noted). It should be noted that the use of the English “body” in the translation is almost always a translation of the German Leib; the other German word for body (Körper), connoting the physical body and possible to employ for both animate and inanimate bodies, is used far less frequently in these texts and is marked clearly when it appears. Some contemporary strains of phenomenology have begun to translate Leib (lived or organic body) into English as “flesh,” following the French translation chair, originating with Ricœur’s and Merleau-Ponty’s readings of Husserl (Gabrielle Pfeiffer and Emmanuel Lévinas still employ corps organique in their 1929 translation of the Cartesian Meditations into French). “Flesh” does not convey the sense of the term Leib in Conrad-Martius where it is employed not just for human bodies, but also for animal and plant bodies (although more properly in the case of animals and humans than in that of plants because they lack a soul that could make of their Leib a home or dwelling place). Geist, as already noted, has to be “spirit” (not “mind”), not only because it goes far beyond the mental for Conrad-Martius, but also because she includes an extensive discussion of Geister, i. e., spirits. Neither “soul” nor “spirit” involves some sort of “spiritual” or religious dimension in the human; “geistig” or “geisten” is not “spiritual” or “spiritualizing” (she will employ “spirituell” when she wants to speak of something connected to spirituality; German can also employ geistlich in distinction from geistig, although that use does not appear in the present text). I have also tried to avoid certain other English conventions that seem to involve some distortion, such as not translating Sache by “thing,” but instead by “matter” or “issue” (zu den Sachen selbst is not an invitation to return to a focus on objects, but instead a clarion call to attend to what matters most) and not rendering Gegebenheit as “givenness” (with all its potential “gifting” connotations). Wissenschaft is a much broader term than “science” and certainly does not designate only the natural sciences, but involves everything truly scholarly, academic, or rigorous, regardless of subject matter. Other translation difficulties for individual

Translator’s Notes

19

words in context have been noted when they appear, although I have tried not to clutter the text too much, especially considering that the original German text is also included in the hardcover version. As is true of many German texts, the sentences are often very long and frequently involve multiple subclauses; these have often been broken up into several separate sentences in English. The dialogue style employed for the conversations also very often consists of sentence fragments. Sometimes these have been preserved to convey the oral tone, sometimes verbs or precedents have been supplied to enhance clarity in English where such sentence fragments are employed less commonly and where precedents are less clear due to the lack of gendered pronouns. Interestingly, the interlocutors use the polite form of speech (Sie, not Du) with each other, yet it is evident that this is a genuine conversation between friends or colleagues, so that tenor has been preserved as much as possible (for example, by sometimes using contractions in English that would be employed in conversation but not necessarily in a written text). It has been very difficult to ascertain emphases in the original German, because italics were not yet used and so letters of words were spaced further apart for emphasis. In the earlier pages of the dialogue this spacing is very hard to detect, so some italics involve detective guesswork (I have tried to err on the side of leaving out emphases rather than adding ones that might not be there). Finally, this is a text on the human person. Conrad-Martius always employs the general term Mensch, not the gendered term Mann, which refers only to male beings. (Obviously, all nouns are gendered in German, so the male pronoun is used for der Mensch and the female for die Person, in both cases referring to both men and women.) The English term “man” no longer conveys such generic inclusivity (if it ever did) and even the slightly awkward “human” (or human being) requires a gendered pronoun in English. It seemed less distorting of her meaning to move to the plural in many cases or sometimes to employ phrasing that avoids the use of a pronoun. The German text uses the third person singular throughout, because it is discussing the nature of the human being as such. Crucial German terms in her text that appear frequently and carry specific weight are rendered as follows: Terms related to formation that appear frequently: Ausgestaltung/ausgestalten as fashioning/to fashion, Bestand as stability, darleben as to express or live out, durchwohnen as to permeate, einsenken as to immerse in, Elan as impetus, entfalten as to unfold (occasionally as to develop), erheben as to elevate, Ersunkenheit as submersion, Gestalt/Gestaltung/gestalten/Gestaltswesenheit as figure/configuration/to configure/configured natures, herabsinken as to sink down, hervortauchen as to

20

Translator’s Notes

emerge, hineinsenken as to immerse into, hineinstellen as to place into, niederschlagen as to settle (down) into, schöpfen as to draw (from), Substanzialisierung as substantivation, but Substanziierung as substantiating, übersteigen as surmount, Verinnerlichung as interiorizing, Wirksamkeit as effectuation, zueignen as to arrogate (to), zusammenschlagen as to engulf. Spatial terms: Bereich as area or realm, Bezirk as domain, Gegend as region, Milieu as surroundings, Reich as realm, Sphäre as sphere, Stätte as abode, Stelle as locus, Tiefe as depths, Untiefe as unfathomable deep. Important phenomenological terms: Dasein as existence, eigentlich as really or proper (but not as authentic), Mensch as human (not man), real as actual, reell as real, Sein as being, seinsmäßig as in terms of/according to being, Selbstheit/selbstig/selbstisch/Entselbstung as selfhood/ownmost/selfish or in myself/undoing of the self, respectively; Stimmung as mood, Ur-/ursprünglich/urtümlich/Urzeuger as primordial/original(ly)/primordial/progenitor, wirklich as real/really. Terms mentioned above as presenting special difficulties: – Geist as spirit, geisten as acting in spirit, geistig as of spirit, geistlich as spiritual, Geistwesen as spirit-being, spirituell as spiritual; – Seele as soul, seelen as acting in soul (or occasionally to ensoul), seelisch as of soul (occasionally as ensouled); – Leib as body, leiben as acting in body, Leibhaftigkeit as being there in body, Leiblichkeit as bodiliness, Leibung as embodying, but Körper/körperlich/Körperlichkeit as physical body/corporeal/corporeality; – katexochen as quintessential, Quall as qualifying source; – Wesen as being or nature (depending on context), wesen as to dwell, wesenhaft as in terms of being, Wesenheit as nature of being, Wesensunterschied as difference in being/nature, wesentlich as essential, Wesung as dwelling, wohnen as to live. The two essays “Phenomenology and Speculation” and “Transcendental and Ontological Phenomenology” are translated from their final and definitive versions in the third volume of Conrad-Martius’ collected essays (Schriften zur Philosophie), which were edited by her student Eberhard Avé-Lallemant shortly before her death. She added occasional terms or phrases to these final versions that were not contained in the original publications; these are enclosed in the German in square brackets, but are rendered in the English translation in parentheses to distinguish them from any additions or comments by the translator. (The German original contains no parentheses in either essay.) Furthermore, Avé-Lallemant

Translator’s Notes

21

often added cross-references to her other publications or to other essays within the collected works in the notes of this later edition. These are marked in the German by “[d. H.]” referring to him as editor and have for the most part been eliminated in the translation. (When Conrad-Martius herself refers the reader to one of her other texts, she always does so in a full sentence, referring explicitly to “my” publication. These are obviously retained in the translation.) In sum, within this translation any parenthetical remarks refer to additions made in Conrad-Martius’ lifetime, usually by herself, more rarely by the editor (and only in notes), and approved by her. Any comments in square brackets are explanatory additions by the present translator. My work on this translation is dedicated to Antonio Calcagno who first mentioned Hedwig Conrad-Martius to me and urged me to start reading her work. For all of his labor in making her and other early phenomenologists like Edith Stein and Gerda Walther better known and taken more seriously, but also for his immense help, careful editing, and persistent encouragement on this particular translation, I am deeply grateful.

Phenomenology and Speculation {1} One can speak of phenomenology today in a threefold sense. Husserl was a transcendental idealist. For Husserl, the thematic area that is the sole concern of phenomenological research is limited to the givens [Gegebenheiten] of pure consciousness. According to him, only pure consciousness possesses the particular sign of the absolute that science can ensure for phenomenology because, according to Husserl, nulla re indiget ad existendum [no thing needs to exist]. The real world —as real—stands opposite consciousness. Its reality must be bracketed to achieve the pure consciousness-phenomenon of the world. {2} With this fundamental point of departure Husserl’s teaching led transcendental idealism, dominant since Kant, to an unsurpassable apex. Yet, if the reality of the world is bracketed, then in my view the full phenomenon “world” is also disturbed at its core, because the reality of being belongs inseparably to the nature [Wesen] of the world. The theoretical epistemological question whether there is such a true and therefore real world and whether the world observable by the senses, the world in which we live, is, in fact, a real world, is not answered by this bracketing; it is not even broached. Yet, for Husserl, this world of pure consciousness whose reality we must bracket, is no longer just a psychological given—and this was a great secular breakthrough. There were for him two levels of necessary bracketing that lead to phenomenology (Husserl 1913): first, the aforementioned bracketing of the reality of the world, so that only the thematic subject area of pure consciousness remains; and, second, a further “bracketing” that obtains the eidos from the psychological facts. I find neither the concept of “ideation” used for this second case nor that of “bracketing” very helpful. Yet, what Husserl had in mind here was fundamental in a manner that can hardly be sufficiently characterized, namely the step toward genuine phenomenology. This is the step from a mere accidental fact that can appear in a variety of ways, depending on its empirical determination, to the given as such, namely what makes it the sort of thing it is and what can therefore not be separated from it. I will return to this point. {3} Just this for now: Husserl had narrowed the exploratory field of phenomenology to pure consciousness through the first bracketing of reality. Within this narrowing he took the decisive step from the mere fact of a state of affairs [Sache] to its nature [Wesen]. This remains fundamental to this day. But where did this leave the world? Only inside pure consciousness was there true phenomenology. It really did exist there! But the infinite fullness of givens, which due to their reality transcend pure consciousness, was excluded. Yet, the real world presents an inexhaustible array of states of reality [Wirklichkeitsbestände] that should https://doi.org/10.1515/9783110763096-003

24

Phenomenology and Speculation

be questioned as to their reality-founding nature. They alone give to phenomenological research the incredible wealth that it rightfully possesses. {4} We have here briefly delineated a first type of phenomenology, namely Husserl’s transcendental-idealistic phenomenology. Let us move to the second type, which must also be distinguished from the one I have in mind. Heidegger is a student of Husserl. He remains so unmistakably to this day. But he pursued his own philosophical path that guided him far away from transcendental idealism—into a direction that, as is well known, had and continues to have to this day a huge historical impact. There is no talk of pure consciousness in Heidegger. Heidegger retrieved the real world at a singular locus, and precisely with this locus he overcame transcendental idealism. This point is the human person or rather the center of the human person, “Dasein.” {5} I want to cite several sentences from an essay about Heidegger that I published in 1933. They were written in the context of my explanation of how an idealistic philosophy of pure being destroys the world. I added that Heidegger led this destruction in a paradoxical sense to a point from which only peripeteia would be possible or which at this point is already peripeteia. I said back then: “As a true ontologist Heidegger first fully and rightfully posits being. At least [he does so] in relation to the one point that stands at the center of his philosophical interest: the I. One can probably say without exaggeration that in the entire history of philosophy no one has ever grasped or understood the I, as it is most deeply tied into its existence, so directly, in such a ruthlessly non-idealistic sense as Heidegger. … Here being is no longer understood via consciousness and consciousness taken as the final insoluble primordial given, as in all of idealistic philosophy, but conversely the type of being of the res cogitans (the being of the I) is taken as a final manner of existing or of being…”¹ {6} In Heidegger’s Being and Time this “existing” is described as “understanding one’s own being” [sich auf sein eigenes Sein Verstehen] in the sense of “being capable of one’s own being” [sein eigenes Sein Können]. I think this is precisely the deepest sense of “reality” [Wirklichkeit]. In my earlier Realontologie (1923) I had already determined reality [Realität] in analogous fashion. I meant not only, as Heidegger does subsequently, personal being or Dasein, but all real being as such, all

 (Conrad-Martius 1963, 186). [The cross-references to her earlier writings or to the collected works were added by her editor Eberhard Avé-Lallemant when the essays were included in the three volumes of essays he assembled. They are followed in the German text for the most part with “[d. H.]” referring to Avé-Lallemant. Conrad-Martius also added some words or phrases within the running text, which are similarly indicated by square brackets in the German. All of these have been transformed into parentheses in the translation in order to distinguish them from notes added by the translator, which are the only notes or comments to appear in square brackets in this translation.]

Phenomenology and Speculation

25

of reality. I did not intend with this to personalize or psychologize all of reality. Not at all. Rather, there are so many fundamentally different levels of reality, fundamentally different levels of “being capable of one’s own being” as there are fundamentally different types of natural entities: inorganic, vegetative, animal, human personal ones. Yet what makes all these essentially different kinds real [wirklich] beings is precisely this “being capable of one’s own being.” It seems to me as one of the most important philosophical facts that this is possible, even in an impersonal or completely non-psychical manner, in the inorganic or the purely vegetative.² {7} With his determination of the being of the I, of the person, as one who “is capable of its being,” Heidegger obtained the core of its reality. Not consciousness, but “being capable of one’s own being” constitutes the nature of the human person according to Being and Time. But this limitation that is implicitly contained in all of existentialism—as divergent as the approaches always are—this limitation of existence to the person simultaneously strips the entire non- or pre-personal world of its true character of reality. Only the I, only the human has existence [Dasein] or rather is “Dasein.” Everything else is supposedly only “present” [vorhanden]. The degree of ontological devaluation [Seinsabwertung] that lies in this general existential expression of “mere presence”—in contrast to the true personal existing—is clear to everyone who has ever tasted something of the nature of existentialism. The “merely present” is what is grasped objectively as a thing [objektiv-gegenständlich], but it is devoid of any true independent existing. At best, one handles these things, takes care of them, projects them, etc. But their existence, their Dasein? And what of the Dasein of the entire creaturely world, as it is deeply submerged into its own existence? {8} To return to our actual question: Heidegger radically overcame idealism in the personal I. That is clear. The personal I is no longer consciousness, but is existence, self-owning being. The gate seems opened wide for a new, true ontology. It was wide open. Then Heidegger himself slammed it shut again, locked it up, boarded it up (as I said back then), more than would ever have been possible through transcendental idealism, because it had no concept of true reality at all. Heidegger had such a concept as did all of the then-current existentialism. But it does so precisely merely at this one single, namely human-personal point. Many philosophical insights have resulted from this point and true realistic fruits were produced. Not only philosophy but also the study of history, sociology, art, and theology profited from it, each in its own way, as we all know. What was and is being discovered

 See also my later texts (Conrad-Martius 1934, 1944, 1949).

26

Phenomenology and Speculation

there is a realm of new phenomena, rooted in ontic [seinshaft] personal being—a true phenomenology of the human person, of the encounter with other persons.³ {9} Two types of phenomenology stand before us: the transcendental-idealistic and the existentialist. If they were extended into metaphysics, they would not understand each other. They speak different languages. But it does not need to be this way. In both cases, as long as there are true phenomena that are grasped in their eidos, they could be understood by anyone looking for the nature of things. The phenomena discovered in the realm of pure consciousness preserve their place in being [Wesensort] and their validity. The phenomena discovered in the realm of the truly existing person preserve their place in being and their validity. The two realms, with their respective content, do not contradict each other. If they do, they are grasped in the wrong way or what kind of thing they are is over-interpreted. {10} What about the third kind of phenomenology that we mentioned earlier, for pure consciousness and the existing human person are not the only [phenomenological fields of investigation]. There exists not only that which corresponds to the intentionally directed pure consciousness and not only that which corresponds to personal Dasein existentially concerned with projecting and experiencing the world. There is also the world itself, in its own independence of being from consciousness and from the existing I. {11} Is the world there? Can we separate human consciousness from the world? Is it not precisely only and solely human consciousness that “has” this world? Or is it the personal I, thrown into the world and projecting itself in it, from which the personally projected world can no longer be detached? Would it not mean thinking in a very old-fashioned, pre-Kantian, especially pre-existentialist sense, if we dared to speak once more of an “absolute” world, one that exists in and for itself? Have not the results of the new physics, of relativity theory and quantum theory, demonstrated in their own way the inseparability of subject and object, of subjective results of examination and observation, and objective being as such? {12} Concerning the philosophical interpretation of the new physics, I have my own thoughts that I think can certainly be supported objectively, although they ob-

 Regarding this Frederik Jacobus Johannes Buytendijk provides especially profound insights in his article “Zur Phänomenologie der Begegnung” [For a Phenomenology of Encounter] (Buytendijk 1950). The same is true for the explorations within the context of his Die Frau [The Woman] (Buytendijk 1953). One might want to say that most of his earlier physiological or psychological conceptions and publications prepare the radical clarification of this ontological-phenomenological core point (the nature of the “encounter” not only among humans but even between human and animal, as well as animals among themselves).

Phenomenology and Speculation

27

viously in no way touch the current mathematically and experimentally justified results of physics. On the contrary, I think it is precisely those results that require new philosophical interpretations, but not idealistic or existentialist ones. {13} Let us remain first on purely philosophical ground: What about the possible ontological independence of the world from consciousness and the I? Earlier I mentioned that such an ontological non-dependence [Seinsunabhängigkeit]⁴ belongs to the nature of a real world! If the world in which we live had no ontological non-dependence, but, for instance, presents only a sort of Indian Maja, then it would not be a real world, but only a feigned one. {14} Let us now proceed immediately to the innermost, deepest point of what phenomenology is. Is there a nature [Wesen] of actuality [Wirklichkeit], of reality [Realität], that can be examined totally independently of whether it is de facto realized somewhere? Is that not pure fantasy? {15} It belongs to the methodological foundations of phenomenology, as it has been discovered by Husserl, that for knowledge of the nature of a thing or matter [des Wesens einer Sache], one is not required to have this thing or issue before oneself in multiple empirical instances, but that a single exemplary case is sufficient for analyzing its nature. Furthermore, this single exemplary case need not be given to observation—it can stand (phantasmatically) before one’s eyes in pure intuition. {16} To demonstrate generally this recognition of the nature of things [Wesenserkenntnis] I want to start elsewhere. It is in principle possible to handle everything there is, whatever its nature, in theoretical and in practical ways. This applies not only to the things and relations of this empirically experienced world, whether physical or psychical, in as much as one observes them, knows them, experiments with them, analyzes them academically, etc. One can also calculate with numbers, discover new types of numbers, construct geometrical shapes, posit and prove theorems, grasp general objects by abstraction, look at ideas (of justice, of beauty) in a sort of transcendentalizing act, bring social or legal structures into existence (e. g., introduce a duty into the world through a promise of a specific future deed, whether this promise is fulfilled, denied or forgotten; Reinach 1953); one can discover states of affairs, claim that they are the case or doubt it, render judgments or dispute them, and so forth. But we can do all of this without having their true qualia, the essential how of the being of all of these entia, explicitly in view. {17} How does one arrive at the view of these qualia, these qualia of being [Wesensqualia]? One must realize the amazing [insight] that everything that exists in

 This ontological independence of the real world is according to ontological-phenomenological insight a phenomenon that belongs to the immanent constitution of the cosmos. This in no way contradicts a deep, thoroughly creaturely dependence of this world in its being and nature on God.

28

Phenomenology and Speculation

the world possesses its own being-content essential to it, regardless to what sphere of being or what layer of being it may belong. This would include, for example, something irrational, imagined, negative, paradoxical, even the nothing [das Nichts], and obviously also being [das Sein]. They all have an essential content. At the same time, this proper content gives to the respective [thing] at the same time its final significance of being, its meaning of being [Seinssinn]. Meaning is what lies at the heart of the matter [Sache], with which it stands and falls, independent of any human insight [Erkenntnis]. That is why I say meaning of being [Seinssinn] or significance of being [Seinsbedeutung]. Yet, in order to see this significance one has to have an organ of spirit [geistiges Organ] for the nature of the things that corresponds to them analogously, just as the sense of sight corresponds to colors and that of hearing to sounds. One either sees εἴδη—or one does not see them. In the strict sense there is neither philosophical insight nor any form of insight that is not somehow and finally determined by the nature of things. Every true linguistic and conceptual distinction, even when, for example, the natural scientist speaks of energy or force or mass, of life or organism, of color or light, minimally includes an unconscious directing of oneself to the nature of the thing. {18} We just finished speaking of a meaning of being, a significance of being of all givens, that is not inserted into the “things” by the human being, but which they have themselves as such. For there is an objective logos of the world and of all beings in their being. That is one of the most wonderful secrets. The world and being are in themselves full of meaning. Meaning is pervasive in them. The totality of all res, all entia, and all givens form a cosmos, a cosmos of meaning, a κόσμος νοητός. Within it everything has its specific and immovable position of meaning, even the meaningless; for in the final account everything is meaningfully connected with everything else and thus possesses an indelible being at its place of meaning. For example, every single number, as does the entire realm of numbers, has a specific, marked place of meaning-being, as do judgment, states of affairs, and in general the entire realm of logic, of values, even the transcendentals like the good, beauty, being, the primordial dimensions of place and time, and so forth. These are only a few arbitrary examples for the purpose of illustration. {19} Obviously, this cosmos of meaning has to be entirely distinguished from the real world, which also forms a cosmos—the latter would be nature, supra-nature [Übernatur], infra-nature [Unternatur], whether physical or psychical, whether earthly, heavenly, or below the earth. But conversely the real world, if it is taken as such or in its nature, can be classified into the cosmos of meaning—as everything that is according to its nature. {20} To work out slowly the nature of the specific thing usually requires long and very precise philosophical work, in which the eye must be directed ceaselessly to the initially only vaguely suspected place of meaning of what is to be examined

Phenomenology and Speculation

29

according to its nature. This is phenomenology in the comprehensive and radical sense. Phenomenology is an investigation into the nature of things [Wesensforschung]!⁵ [This is] phenomenology without any thematic limitations, as we noted them in the transcendental-idealistic and existential phenomenologies. We thus cannot really give a special name to this third kind, as we did for the first two cases, precisely because it is phenomenology or research into kinds as such, without deduction or limitation. {21} Everything there is, then, can be examined in its pure nature [Wesen]. Wesen is here nothing mystical, nothing speculatively constructed or imagined. It results from the exact focusing, if I may put it this way, on the respective given itself, thereby avoiding all construction. Actual Wesensforschung [i. e., investigation into the nature of things] proves that this is possible. It is proven by the successful results of earlier or current phenomenological explorations into all areas of being and in all disciplines [Wissenschaften]. It is especially demonstrated to anyone who learns to research in this way or is led to the nature of things or to the things themselves by those who know phenomenological research. What a given obtains through recognition of its nature [Wesenserkenntnis] in terms of what is plausible, evident, comprehensible, and illuminated all the way through, derives from the condition of its explicit place in the totality of relations of meaning. Accordingly, Wesenserkenntnis has its own verification in or obtains it from itself. {22} One can equate Wesensforschung with ontology in a very precise sense: onto-logic = ontology. Only in this case, first, the “on” (what is [das Seiende], the ens) must be taken in the most general sense of “what exists” [des “es gibt”] and, second, the “logic” meant here must be derived from the objective logos of what is [des Seienden]. The cosmos noetos is the logos-[logoshafte] cosmos of everything that exists according to its nature [alles Seienden seinem Wesen nach]. {23} How do the other, the so-called real disciplines or sciences, relate to this Wesensforschung, this onto-logic, this phenomenology, especially the natural sciences? If we pursue, for example, the phenomenological view of what turns force into force, energy into energy, light into light, matter into matter, then every contemporary person will at first envision physical force, physical energy, physically visible light, and so forth. Besides, physics alone will be assumed to be responsible for research into these things. What should Wesensforschung mean when it comes to such givens? What would be the task of the philosopher here? It almost seems  [The term Wesensforschung could be translated as study of or research into or exploration of being, essence, the nature of things, their kind or genre, etc. An “investigation into the very nature of things” probably comes closest to what Conrad-Martius means by this term, but given its ambiguity and polyphony of meaning, it will be left untranslated in the remainder of the text.]

30

Phenomenology and Speculation

as if we want to return to a priori methods in order to arrive at what the natural scientist is in a position to determine through the laborious and immensely successful work of countless experiments and mathematical-physical calculations with their explicit definitions and exact functional equations. It is as if we wanted to conjure the danger of falsifying speculations, through which antiquity (especially Aristotle), to the Middle Ages, and then the Romantic philosophy of nature made their fundamentally incorrect physical specifications. {24} Surely not. Who would still hazard this today? First: when phenomenology wonders about the general nature of force or of light,⁶ then it does not first of all consider their physical instantiations, or at best it does so only in the form of an example. For there is also the force of the soul, the force of a thought, the force of an expression, of a symphony, of a landscape, of a proof. There is the force of God. Perhaps one may object that those are all just allegorical expressions. Yet, is it not curious that, on the one hand, one wants to explain the use of such a concept in the physical realm through an allegorical transfer to the psychical, yet, on the other hand, and just as often, uses instead the same concept in the psychical through a transfer to the physical. For example, the physicist says that basically the talk about “force” in the physical context is merely an allegorical analogy based on the subjectively experienced sensation of muscles onto a physical state of affairs, which cannot be understood in itself. Yet, physicists could care less about this “in itself ”—if it has any sense for them at all. They only want to set up a mathematically exact functional equation for the different relations of force or energy. For only through such functional equations can they master nature theoretically, which in the end also leads to a practical mastery of it. {25} Yet, what about this psychic force and this psychic energy? They are experienced immediately, are given themselves. But they are now themselves taken as something that one cannot really grasp scientifically—perhaps, at most, if one could embed them in physically definable foundations. Yet is it not possible to ask after the general qualia of something like force or energy, be it physical, psychical or whatever? Can one ask what they are in themselves, in their own being? Let us take a different example. There is not only physical light but also the light of the understanding, there is joy that shines out from the eyes like light, there are explanations full of light, a lit landscape, there is the light of transfiguration, there is godly light. Are these things simply images, based on physical light? Yet why, if we wish to speak in such terms, would such an analogy be possible at all? Surely it must have some sort of objective right, a fundamentum in re, a rational basis in the thing itself. Even physical light is precisely not simply an electric

 It can obviously also ask about the special nature of the physical force or of the physical light.

Phenomenology and Speculation

31

wave motion, caused by a quantum leap of energy into the atom, which appears only subjectively to the human eye as we see it. It is “more”; it is an explicit qualia; we can focus our spirit’s gaze on its nature. In the case of the joy transfigured by light or the illuminated understanding, it is in no way a matter of electromagnetic wave motions of different frequencies and thus of different coloring. And yet light is and remains light and is not darkness—in one and the other case, and in all other cases. When is something “light”? When does it constitute light? According to what aspects of being [Wesensmomente] is something constituted in itself as light? It is indubitable that it is possible to ask such questions and that there is an appropriate path of phenomenological-ontological exploration here. It is also validated by the previous results of phenomenological research. {26} Now we come to the most decisive question: What is the relationship of determinations of Wesensforschung to physical determinations? The answer is simple. Although light, i. e., physical, natural light, “is” not an electromagnetic wave motion that arises from a quantum leap of energy, the waves are all physical foundational conditions for the possibility of its real occurrences in nature. Very precise relations of conditions, which can be grasped in their functional relationships through precise equations, bring physical light to its natural incarnation, if I may put it like that. This physical light corresponds in its general nature precisely to what “light” is always and everywhere, because that is its nature. {27} What phenomenological Wesensforschung determines can in no way contradict what natural science finds, and the reverse is also the case. Both lie on completely different levels. Yet, the two series of determinations also can in no way replace each other. The factual goal and method are completely different in both cases. All the same, they do need each other, even if that may sound odd to the natural scientist or any academic [Fachwissenschaftler], for that matter. Natural science, however, does not itself need any sort of reference to Wesensforschung. It seeks the mental mastery of nature. It can achieve this entirely through the positing of functional relations of dependence. It has even impressively succeeded in grasping relationships that escape classical physical determinations. It is a wholly different matter when the relation between physical determinations and their real foundations are interpreted. As soon as physicists begin to interpret their particular results in terms of a vision of the world, if they begin to philosophize—and who of the great ones does not do so today?—something else is going on. {28} Now a few words about speculation. “Speculation”—this dreaded word, this dreaded matter. Thomas Aquinas says once in the Summa theologiae that ac-

32

Phenomenology and Speculation

cording to a gloss by Augustine on a passage in 2. Corinthians,⁷ speculare does not derive from specula (a knoll for surveying the area), but from speculum (mirror). To “see something in a mirror” would mean: to see the cause through its effect (causa per effectum). The similarity of the cause is reflected (relucet) in the effect. Here speculation would be the same thing as meditation. In the first case, if speculare were derived from the knoll or the watchtower, speculare would mean to observe exactly and carefully, to survey. The speculator would be the spy. Thus whoever does not want to have anything to do with speculating in the first sense (the going back from immediately observed effects to the causes that are not visible and are only mirrored in the effects), can adhere to the careful, attentive, skeptical speculare. ⁸ {29} Yet, fundamentally and factually [sachlich] speaking, we need both. In every realistic interpretation we have to proceed from the empirically visible effects back to the causes that are at first or fundamentally not visible, but [only become so] with all required care, with an ever new, factually dependent surveying. What does “factually dependent” [sachlich gebunden] mean here? A twofold factual dependence of a very different type is required. First, it concerns fundamentally, as shown, the surpassing of empirically determined relationships toward factually fully valid causes that are not given immediately. {30} To the “factually fully valid causes” [Zu den “sachlich vollgültigen Ursachen”]! Factually valid causes are not at stake within natural science, whatever opinion one might hold about it. Natural science posits mere relationships of conditions: if so… then so… Only a post hoc, not a propter hoc. This is the natural scientist’s good right, and it is full of significance. With it they are able to master nature. But at no point is the real full context of causes even interrogated. It is in no way even at stake. But it is at stake for the philosopher. And very gradually even the natural scientists, especially physicists, are beginning anew to ask about it in a philosophical manner. They do so because they have suddenly discovered such strange things. The discussion about an asserted or disputed “actuality” in the microphysical realm is such a thematically philosophical interrogating and—horribile dictu—speculative projecting. {31} Speculations are always preliminary sketches—projections into a not yet or fundamentally unknown land. They are “preliminary” with regard to the strictly empirical facts known at the moment, the ones that could someday be grounded  As far as I know, to the passage: “And all of us, with unveiled faces, seeing the glory of the Lord as though reflected in a mirror.” [2. Cor. 3:18]  Greek: the σκεπτικοί, the skeptics, derive from σκοπέω and that comes from σκόπελος, the location for spying something out. Thus, the same thing. [This note is an insert that Conrad-Martius added later, when she revised the text for inclusion in the three volumes of her collected works.]

Phenomenology and Speculation

33

empirically, which would then validate the speculative preliminary sketch or refute it. They are “fundamental” if it can be shown empirically and experimentally that the “unknown land” can in principle not be transformed into one that can be seen or determined empirically—at least not with classic scientific methods and categories of experience. This is the case for microphysical relationships, which, as we know, has not hindered our grasping them mathematically-physically in the most precise manner. {32} I spoke earlier of a seeking for the full causality of effects [Wirkursächlichkeit]. In this regard, too, a peculiar blindness governs our time, which has been caused by a one-sided education in natural science. A good example for this is physicalizing biology. The phenomena of living development, formation, and transformation never become fully causally explainable through functional relations of dependency, regardless of how precise they are. Biologists have nothing in front of them except material physical processes. If they fully wanted to explain them causally, they would have to transcend the visible effects and move toward the invisible causes or go back to them. They must speculatively project. They must look through them to the possible full causality, which is neither quantitatively nor qualitatively commensurable with the known effects. In this case they will arrive, like Driesch, at something like “entelechy,” that is, a goal-oriented causality [Zielursächlichkeit], although it was still determined in far too narrow and singlelayered a fashion by Driesch. It is the same issue for the realistic interpretation of quantum-physical relationships. Here too something has to be projected speculatively, must be sifted through into a fundamentally unknown land in contrast to the classic surface relations. {33} Yet, how can one avoid wild speculation or imaginary and fantastical interpretations in this? First, one obviously does so by never overlooking, falsifying, or wholly abandoning the empirical given and what is empirically verified. For this is precisely what needs to be interpreted. But now the second condition that is almost entirely lacking in nearly all natural-philosophical attempts at interpretation: The projected interpretations of the given empirical relationships also may never contradict the nature of the thing or state of affairs to be interpreted. Furthermore, the interpreter must keep the nature of the thing just as much in view as the empirical givens to be interpreted. It is, for example, not possible fully to ground causally living processes of formation or even of organismic life as a whole (regardless of how much good empirical material one might have), if one has not taken a decisive look at the nature of organismic life or a specific living design process. The functional conditions that biologists establish—which is their singular scientific right—only represent the matter in a single paltry cross-section as opposed to a whole. They cannot give the whole nature of the matter [das volle Wesen der Sache]. It is the same issue in physics and, in a downright aggravating sense,

34

Phenomenology and Speculation

with the attempts to interpret by the new physics. It is hard to say how many false paths—in regard to the interpretation, not in the natural sciences themselves— have here already been pursued and thus explicitly falsified the matter to be interpreted. In either case, this has caused at least as much harm as linking lacking factual contact with the empirical. Speculative sketches require both thematic contacts: the empirical and the ontological [wesensmäßige]. {34} Furthermore, I am convinced that all productive, all creative scientific work (including in the human sciences, broadly understood) is embedded in speculation. All real scientific discoveries are preceded by a more or less dark visio of what must be found, much like a teleologically effective guiding star [zielursächlich wirkender Leitstern]. The successfully productive researcher, then, is always accompanied by an often unconscious gaze for being [Wesensblick], at least in a particularly sure instinct for the nature of the thing. One clearly sees here that the gaze for being and the speculative visio must be strictly distinguished, as are pure Wesensforschung and speculative research. Wesensforschung aims at the nature of the thing, but this is an exclusively “ideal” given, belonging to the cosmos of meaning. Speculative interpretive research, conversely, aims at an unknown connection (whether unknown at the moment or fundamentally) that must have the same kind of being (real within natural science) as the complexity of facts that are to be interpreted. Yet, as argued above, topically fruitful speculation includes knowledge into the nature of things [Wesenserkenntnis].

Bibliography Buytendijk, Frederik Jacobus Johannes. 1950. “Zur Phänomenologie der Begegnung.” Eranos-Jahrbuch 19: 431 – 486. Buytendijk, Frederik Jacobus Johannes. 1953. Die Frau. Cologne: J. P. Bachem. Conrad-Martius, Hedwig. 1923. “Realontologie.” Jahrbuch für Philosophie und phänomenologische Forschung 6: 159 – 333. Conrad-Martius, Hedwig. 1933. “Heideggers ‘Sein und Zeit’.” Deutsche Zeitschrift 46 (4): 246 – 251. Conrad-Martius, Hedwig. 1934. Die “Seele” der Pflanze. Breslau: Frankes Verlag Otto Borkmeyer. Conrad-Martius, Hedwig. 1944. Der Selbstaufbau der Natur. Hamburg: Claassen & Goverts. Conrad-Martius, Hedwig. 1949. Bios und Psyche. Hamburg: Claassen & Goverts. Conrad-Martius, Hedwig. 1963. Schriften zur Philosophie. Vol. 1, ed. Eberhard Avé-Lallemant. Munich: Kösel. Husserl, Edmund. 1913. Ideen zu einer reinen Phänomenologie und phänomenologischen Philosophie. Erstes Buch: Allgemeine Einführung in die reine Phänomenologie. Halle: Max Niemeyer. Reinach, Adolf. 1953. Zur Phänomenologie des Rechts. Die apriorischen Grundlagen des bürgerlichen Rechts. Munich: Kösel.

Transcendental and Ontological Phenomenology {1} It may well be a singular situation in the history of the human sciences: not only that the most different, even almost opposing, philosophical movements came forth from a great philosophical master, with all of its representatives appealing to this master as their original teacher, but also that these movements have each themselves achieved such historical significance as cannot yet be measured. This situation shows that it is not simply an issue of mere misunderstanding of the original teaching stemming from an insufficiency of the matter. We have always had that. The most immediate students of significant teachers have often become the worst representatives of the respective teaching. Yet, in this case we have three streams that possess a common source, and each in its own way represents a great and internally cohesive overall philosophical conceptual framework. I am referring to the three well-known directions that proceeded from Husserl: the transcendental-philosophical, whose representatives were and continue to be Eugen Fink and Ludwig Landgrebe; the so-called Munich-Göttingen school to which I belong with several others; and Heidegger’s existential philosophy. There is no doubt that the first-named group properly understood and carried on the true philosophical intention of Husserl’s enormous work. Of Heidegger’s reputation and glory, we need not speak here. Heidegger and the great movement that followed him ultimately diverged the furthest from Husserl’s intentions, even if he did not start out that way. Concerning the Göttingen school, we often read that they only took up a couple of main themes from the master and even largely misunderstood those (the so-called Wesensschau, evidence, the slogan “back to the things themselves,” the refusal of any kind of psychologism, etc.).¹ Thus they supposedly cannot be called a historically significant group among Husserl’s true followers. This is exacerbated by the fact that the Göttingen movement that during Husserl’s teaching in Göttingen formed a “school” in the most explicit sense, was torn apart and decimated by World War I, by Husserl’s transfer to Freiburg, and finally—after his death—by World War II, including all its political presuppositions and consequences. In either case, in Germany it disappeared from public view. No real school was formed in Freiburg. In the final two decades of his life Husserl was increasingly left alone, aside from a couple of the aforementioned representatives and students.

 [As in the previous essay, Conrad-Martius added several words or whole phrases to the piece, when it was prepared for inclusion in the three volumes of collected works, which in the German are placed in brackets. These later additions are placed in parentheses in the translation in order to distinguish them from bracketed inserts by the translator.] https://doi.org/10.1515/9783110763096-004

36

Transcendental and Ontological Phenomenology

{2} At the end of his afterword to Ideas I, which was published in the Jahrbuch für Philosophie und phänomenologische Forschung only in 1930, Husserl speaks of “the infinitely open land of true philosophy,” of the “promised land” that he saw extending before him and that he would not himself experience as fully cultivated. By this statement he obviously meant the transcendental phenomenology discovered by him with increasingly profound agitation. On the basis of the transcendental reduction, the entire realm of meaning and validity of each and every being could be explained in its primordial constitution via this phenomenology. Curiously, for us Göttingen phenomenologists, who were nothing less than transcendental phenomenologists, the purely eidetic ontological phenomenology (investigation into the nature of things [Wesensforschung]), which was also discovered by Husserl yet valued far less by him, seemed just as much an infinitely open or even a “promised land” in the philosophical sense. It still seems that way to us, not only to the few of us who remain from that earlier time, but also to those who have suddenly “been bitten by the phenomenological bug.” This earlier phenomenology seems to have nothing, absolutely nothing, in common with Husserl’s transcendental philosophy. It appears as its direct opposite in regard to its final philosophical orientation. For Husserl the “return” to the finally constituting primordial grounds of transcendental consciousness and the “return” to “absolute subjectivity” formed the center of a prima philosophia that would clarify and ground everything. The apparently entirely opposite turn “to the things themselves” meant and means for us a breakthrough to an entirely new and definitive philosophical basic attitude and with it the redemption from all prejudices rooted in criticist, epistemological, psychologistic, historicist and similar traditional approaches, even a redemption from all our prejudices about things. Husserl himself admittedly often stresses that the true philosopher must be and remain a “beginner.” That is to say, to interpret its nature, one is always obligated anew to see the “matter” [Sache] to be clarified with one’s own eyes and without relying on any previous opinion, whether held by oneself or by others. The slogan “Back to the things [Sachen] themselves!” comes from him. Yet does it not remain a wholly contradictory intention on the one hand to lead back to final transcendental subjectivity and on the other hand for every locus of being and the whole of being to lead up to the highest, unparalleled, because foundational objectivity? Surely some kind of error of interpretation must hold sway in either or both of the positions, otherwise the two groups —transcendentalists and ontologists—could not both be phenomenologists. {2} One has often tried to explain this as being simply different phases of Husserl’s own philosophy. In fact, already the second volume of the Logical Investigations and even more so the Ideas for a Pure Phenomenology and Phenomenological Philosophy appeared to us, his students, as an incomprehensible return on Husserl’s part to transcendentalism, subjectivism, or even psychologism. We were so

Transcendental and Ontological Phenomenology

37

enraptured by Husserl’s breakthrough to pure objectivity and soberness [Sachlichkeit] that our seminars back then consisted in an almost constant and on our side even oppositional dispute with the great teacher. What we judged so negatively, was taken in a very positive sense from the side of critical idealism (Neo-Kantianism, Rickert’s school, etc.). In their view Husserl seemed finally to have found entry to a true epistemological-critical philosophy. Yet they were confused by the apparent remainders of ontologism and intuitionism. For us, these very “remainders” from the hand of the master were again welcomed with joy. Every sentence in his oral and written expositions seemed to flow from the full evidence of true, illustrative selfgivenness [anschauliche Selbstgegebenheit] and every mere construction seemed carefully avoided. In his later Freiburg years, forced by circumstances, many of us lost touch with Husserl. This certainly was the case for me. Yet it was exacerbated for me—and arguably also for others—by the fact that in the occasional meetings with Husserl we became more and more puzzled at the increasingly deep expansion and increasingly purer justification of his transcendentalism. It seemed to me like a speculation that increasingly enmeshed him and lost precisely what was most philosophically precious to us older phenomenologists: the radical matter-offactness [Sachlichkeit] regardless of the ontological region, the unfailing and determined commitment to begin always anew in the face of any problematic taken up. My own philosophizing was more and more intensively turned toward a topic that had enveloped me from the very beginning of my independent philosophizing: the question of the nature [Wesensfrage] of actual being as such, specifically of nature [Natur]. Obviously, I remained strictly within the framework of research into the nature of things [Wesensforschung]. What really is reality? What is the nature [Wesen] of nature? What are the consequences for being [wesensmäßig] if the empirical world and empirical nature with all their possible contents are posited as actually existing? {3} Yet was it not precisely this reality that should have been bracketed in Husserl’s famous reduction? Certainly, it was meant not to be negated or even only doubted. Husserl never doubted the reality of the world, of nature, or even of the supernatural [Übernatur]. Yet the question of whether this noematic world is really real was supposed to be entirely suspended within the enormous realm of the continually noetic-noematically flowing intentional fully fulfilled senses [Sinnfülle] of consciousness with its infinitely many layers, implications, and foundations—a realm always investigated from new perspectives. At stake was supposed to be the “real” being of each relationship, not only the actual being of concrete empirical nature. The word epochē best expressed what was meant by this move. It was not a matter of an epistemological question or claim. It also did not concern, as I thought for a long time, a thematic-phenomenological narrowing, as if Husserl were occupied only with a thorough investigation of the essence of

38

Transcendental and Ontological Phenomenology

consciousness, and all its potential relations, while the world as actual or existing in any other sense remained bracketed. For the being of the being [Seiend-sein] of the world lies simultaneously within the universal interweaving and unity of meaning of the stream of consciousness. To hold, see, or suspect something to be real, to believe in reality, whether consciously or unconsciously, whether in a simple attitude to life or via the abstraction of research, is to grasp noemata with their own most proper sense. How could the noema of the being of being [des Seiend-seins] not belong to the total meaning of absolute consciousness? How is it possible to turn renouncing the multi-shaped noema of being into the presupposition of a universal phenomenological philosophy? {4} That is not at all what happened. Husserl’s refusal to judge (epochē) does not concern the supposition of being that belongs to some noematic sense or other. It only concerns whether a real being, a real reality, corresponds to such a supposition of being of whatever shape. It is not possible to mark the particular problematic in any way other than by a terminological doubling of the expression: “real reality” [wirkliche Wirklichkeit]! Husserl often employs it even if not always in an explicitly clarified manner. I introduced it long ago into my own ontological analyses of being. Its linguistic necessity is due to the lack of always newly differentiated categories. For me, this descriptor concerns on the one hand “reality” as a noematic content, on the other hand the consciousness-transcending reality of the noematic aspect of reality. This latter is precisely the real reality. It can never belong to the noematic-phenomenal total content [Gesamtbestand] of the world because at stake in it is the actual “standing-on-itself ” or the “being-grounded-in-itself ” according to being [seinsmäßige] of the world and all its contents. In this lies the real reality of the world, whether it is factually given or not. Oddly, this is never clearly expressed in Husserl. Yet I do not think that one can solve this problem in a way other than taking into view the nature of reality [Wesen von Realität] (real reality) as such. Husserl often says with emphasis that being or beings independent of consciousness are nonsense. That is certainly true when it concerns the being or beings that belong to the noematic contents of consciousness. It would really be tautological in that case. It is just as self-evident that what is grounded within itself according to being—according to its nature!—is independent of consciousness. Yet in both cases the question whether a reality relying on itself, that is as such a reality transcending consciousness, really exists is something wholly different. This epistemological question whether or not an actual being corresponds to the noematic being was completely pushed aside by Husserl. He was concerned almost entirely with the systematic exploration of the gigantic area of intentionalities themselves unified by sense, grounding each other reciprocally, and constituting the universal phenomenon “world” from finally original and thus absolutely evident givens.

Transcendental and Ontological Phenomenology

39

{5} It seems to me that the term “reduction” (instead of epochē) expresses even more forcefully Husserl’s transcendental position: the world is seen as reduced or led back, away from all positing of being. This is slightly more than a withholding of all judgment about being and non-being. In the case of the epochē the world within its universal manner of givenness remains the same as it was before, while it becomes a world-phenomenon through the reduction, wholly regardless of whether a real world corresponds to it actually or not. Yet from the epochē one can pursue an entirely different, contrary path. In this case the world with all its contents is posited as hypothetically existing. Here, one also refrains from judging. In this case, too, no decision is made about being or non-being in any sense. Here also the epistemological question is left out of consideration. Yet instead of bracketing real being hypothetically and thereby removing the world (in the reduction) from real reality, the real being of the world is instead hypothetically posited and accordingly represented with the immersion of the self [selbsthafte Eingesenktheit] into being. Yet when we practice epochē, albeit not the reduction, in this manner, the aforementioned consequential question arises concerning all empirically givens: what are the consequences for a closer, ontic constitution of the world given only phenomenally via epochē? This is a wide composite of questions not easy to answer. One can show that an empirical nature in real reality cannot exist without being itself ontically rooted in a potential sphere both above and below the physical, in which the current world is given. To mention another example obvious to me at the moment: space, as it is given to us in immediate empirical life, can also not exist as a being that is [als seiend seiender bestehen] without an ontological leading back into a space above and a space below. {6} The decision has been made. Transcendental and ontological phenomenology have separated. Both are concerned only with an investigation of the nature of things [Wesensforschung]. Both set aside the epistemological question, both practice epochē in regard to the facticity of phenomenally given reality and in general of all beings. Both keep in view everything, absolutely everything, without deducting any thematic content. Neither case involves a contrast between objectivity and subjectivity or a contrast between empiricism and transcendentalism. This is obviously not the case for ontological phenomenology (Wesensforschung). In the case of transcendental phenomenology this erroneous conception has admittedly always suggested itself. Precisely because of this error Husserl’s intentions were entirely distorted. Fink mentions in his article “Die Phänomenologie Husserls in der gegenwärtigen Kritik” [Husserl’s Phenomenology in Current Criticism] (Fink 1933, 38),²

 In regard to this article by Fink, which he still edited and for which he provided a preface, Husserl said that it contained no sentence that he could not explicitly endorse as his own conviction.

40

Transcendental and Ontological Phenomenology

which provides excellent orientation, that Husserl’s phenomenology is governed by the contrast between “mundane” and “transcendental,” not like critical philosophy’s contrast between “empirical” and “transcendental,” and especially not like the contrast between “objective” and “subjective.” He claims that for Husserl there is no necessary reference to an “innerworldly” immanence, even if subjectively a priori. There is merely a priority of the world for him, of the subjectivity discovered only through the reduction and to be understood in a wholly new, “metaphysical” sense. “World” refers to everything here, including the psychical in any form, the human person, even the ultimate subjectivity achievable by positive science. We are confronting the deepest point of Husserl’s transcendentalism, which was almost never understood, especially by us ontological phenomenologists. “Transcendental” in the sense of the transcendental critique and “transcendental” in the sense of Husserlian phenomenology have a wholly different meaning. The entire physical and psychic, empirical and ideal or categorical world must in Husserlian phenomenology be traversed backwards into subjectivity—whether individually or communally. Only thereby can it reach the mysterious “ego” from whose living functioning the entire validity of being and sense of the world can be derived as such. This is why Husserlian phenomenology is a “philosophy of the origin” [Ursprungsphilosophie]. We cannot get behind this ego. There is not even a “name” for these aspects lying behind it, because all names stem from a flow of consciousness in which “time” is already constituted. The ego, however, is that which first constitutes everything and anything, thus also time. It itself is thus “timeless.”³ {7} I have tried to sketch the two great opposing directions of Husserlian phenomenology from the pivotal standpoint of the epochē. I obviously cannot give more than brief indications here. An essential question, however, stands before us. Is it possible that the entire validity of sense and the being of the world of beings [Welt des Seienden], in its widest sense, can arise not only from an egological

Incidentally, the best proof for the close correspondence of Fink’s interpretations with Husserl’s own conceptions is Husserl’s last great work Die Krisis der europäischen Wissenschaften [The Crisis of the European Sciences] (Husserl 1954). Its main manuscript developed 1935 – 36.  Cf. Revue internationale de philosophie (1939), a commemorative volume published a year after Husserl’s death. Landgrebe (1939) rightly points out here that Husserl’s Vorlesungen über das innere Zeitbewußtsein [actually “Vorlesungen zur Phänomenologie des inneren Zeitbewußtseins,” i. e., lectures on the phenomenology of the consciousness of internal time], which he prepared immediately after the publication of the Logical Investigations and which was published by Heidegger in the Jahrbuch für Philosophie und phänomenologische Forschung (Husserl 1928), already hint at much that later develops into his definitive transcendental philosophy. And [Landgrebe also claims] that the essential deepening that Husserl then gave to the concept of intentionality (as a concept of effort [Leistungsbegriff ]), was not understood by any of his “ontological” students.

Transcendental and Ontological Phenomenology

41

subjectivity that cannot be surmounted backwards but also from ontological objectivity that cannot be surmounted forwards?⁴ “Arising” is here meant not in a theological but in a philosophical sense. Moreover, this is the case because both raise the claim, surely to be justified, that they take no step without verification in observational evidence. Are these two not radically contradictory? I do not think so. The same logos that is thought in the most universal sense pervades the world through nature and being; its universality lies hidden within human reason. Nothing can contradict it [widersprechen] here, but only wonderfully correspond to it [entsprechen]. The latter is the metaphysical-egological or metaphysical-transcendental “objectification” (Husserl) of the world; the former is the metaphysical-ontological or metaphysical-transcendent objectification (actualization) of the same. I speak of a “transcendent” objectification. Here lies a fundamental problematic that was scarcely yet able to appear within the philosophical range of vision in Husserl’s time. Like his entire era, Husserl knew only the “classical” world of empirical actuality. This actual world was simply empirically given. To climb “behind” it in primordial fashion—except through an extra-philosophical leap toward God— was not within the possibility of rigorous philosophical analysis. One knew only the retreat to the transcendental. Today the entire situation is completely different. The new physics has pried open doors that lead to the wide (actual‐)potential realms of grounding the world. Even the identification of these ontic (transphysical) realms of grounding [Begründungsbereiche] requires new, non-classical, still “nameless” categories. Only in this way do ontological and transcendental logos correspond to each other in their universal scope. {8} Once more: both transcendental and ontological phenomenology assume the attitude of the epochē. Neither has anything to do with a claim or doubting of the being of this world. For real reality can never be evidently recognized. All the same, there is an essential exception here. The Cartesian cogito does actually have its evidence of being within itself. I cannot doubt that I am. Yet it is always possible to doubt the real reality of the world or its contents. This epistemological insight was in fact the original point of departure for Husserl’s transcendentalism, which is why he always returned to Descartes. That for Husserl it thematically concerned the primordial constitution of the world from the subjective side of reason has its justification, perhaps even in this state of affairs. Yet his factual analyses were never epistemologically oriented, for they were solely conducted in an eidetic  [Conard-Martius is here contrasting not only a movement backwards with a movement forwards, but also a mounting or traversing underneath with one moving over or above, so the first “surmount” in this sentence should actually be something like “submount” or “undermount,” if there were such a word in English. The term is also used in the previous paragraph, where it is translated as “traversed backwards,” literally “climbed underneath backwards.”]

42

Transcendental and Ontological Phenomenology

sense. Fundamentally, he was just as indifferent to epistemology as we ontological phenomenologists have always been indifferent to it. This we also learned from our master.

Bibliography Fink, Eugen. 1933. “Die Phänomenologie Husserls in der gegenwärtigen Kritik.” Kantstudien 38 (1 – 2): 319 – 383. Husserl, Edmund. 1928. “Vorlesungen zur Phänomenologie des inneren Zeitbewußtsein.” ( Jahrbuch für Philosophie und phänomenologische Forschung 9, ed. Martin Heidegger). Halle: Max Niemeyer. Husserl, Edmund. 1954. Die Krisis der europäischen Wissenschaften und die transzendentale Phänomenologie: Eine Einleitung in die phänomenologische Philosophie (Husserliana 6, ed. Walter Biemel). The Hague: Martinus Nijhoff. Landgrebe, Ludwig. 1939. “Husserls Phänomenologie.” Revue internationale de philosophie 1 (2): 277 – 316.

Metaphysical Conversations Dialogue Partners: Montanus and Psilander

Plant and Animal {1} Montanus: Dear friend, here you are innocently plucking apart a flower and yet I’ve heard you mention several times that whether plants have a kind of lower consciousness or a sort of sensory capacity is a question that probably belongs to a realm inaccessible to human knowledge. Psilander: I must admit that this insight has not yet moved me to the sort of awareness that would demand vivid practical consequences. M: And yet presumably you would never tear a plant to pieces like this if there were actually the slightest possibility that it might be endowed with the capacity for sensation or pain? P: You doubt this possibility? What about the epoch-making discoveries in botany? M: You mean the discovery of “sense organs in plants” and stuff like that? {2} P: We already knew that plants respond vividly to light, mechanical stimuli, and to the influence of gravity with particular movements of their own, but it now seems certain that the possibility of such stimulus responses and motion triggers is created by specifically shaped organs that fit the kinds of stimuli perfectly, just as in animals. Should not similar inner processes correspond to such similar external conditions? M: You mean the plant not only reacts as a living and suitably ordered unity to the external influences in a specific way that depends on its organization, but that beyond this it must also feel these influences in itself? P: Surely one should not deny this possibility up front. M: These facts, which have been found via laborious experimental work, now provide us with curious indications about the actual structure of the nature of plants. Yet, I don’t think we should agree too quickly with the interpretation that takes this in the direction of a total elimination of the border between the being [Sein] of animals and plants, such that the “scholastic” borders between natures [Wesensgrenzen] would finally be erased altogether. Quite to the contrary, it seems to me that precisely these new discoveries actually and more vividly highlight the ultimately incomparable specificity of the being of plants. Psilander, why don’t we together try to find the point where the being of animal and plant cannot be merged into each other by any conceivable transition? That should also be the https://doi.org/10.1515/9783110763096-005

44

Metaphysical Conversations

point where we would come up against the constitutive root of their respective character. {3} P: You mean a division in principle between plant and animal that cannot be leveled by any transitions? But what about the most basic organisms that belong so closely to each other in their appearance and lifestyle that it seems impossible to assign them to one or the other classification? I can obviously understand that one refuses to consider such particular phenomena as autonomous movements, living reactions, or the appearance of formal sense organs in fully formed plants as beginnings of animal being. But surely it is indisputable that the distinctions between animal and plant become entirely unrecognizable in the realm of the lowest lifeforms. M: Does something being unrecognizable necessarily mean that it is not there? Is it not possible that on these [low] levels the formation of types of figures [Gestaltstypen] is still so embryonic and rudimentary that a division in principle between them can simply not yet emerge? But then it would surely also be possible that there are preliminary steps of development where nature in a sense hasn’t yet “decided” whether something is a plant or an animal, levels where we cannot speak of either one or the other. Yet does that speak against the possibility of a radical difference in structure in those places where the divide has been accomplished? {4} P: So far, I have always assumed as one of the most fundamental accomplishments of natural science the insight that there are no absolutely delimited types in nature, precisely because of the curious transitional forms that one encounters all over the place. M: The characteristics do indeed merge into each other gradually and steadily within the region to which natural science is confined. P: What region must we visit to find your absolute types? Is it not the special task of scientific exploration to distinguish the natural classes of living beings as clearly as possible from each other by delineating their particular properties? M: The differences in kind or in the final foundations of being [Seinsgrundlagen] are ultimately expressed in the external configuration in some manner and, in this way, it must be possible to find types that correspond to real groups of fundamental kinds through differences in bodily constitution accessible to the natural scientist. But the joints in being [Wesensschnitte] cannot be found in this way. {5} P: And psychology? Research in the natural sciences is not limited to determining purely physical characteristics. The question that precisely interests us right now, the question about the sensory capacity of plants, belongs to the domain of physiology or even psychology. Is that not where the only possible path of a properly prepared experiment lies?

Plant and Animal

45

M: When we want to know whether a given kind of plant has something like sensory capacity or not, then experiments, especially direct and detailed observation, are in principle the only path and means for obtaining the corresponding insights. You are quite right about that. When I said earlier that the decisive question would necessarily lead us into a different subject area, I meant that this is due especially to the fact that the question about a difference in principle between plant and animal calls for a wholly different way of posing the problem. This is the case because for now it makes no difference whether a given type of being can be found here or there, whether it is realized in some living being or other. Rather, one must first and foremost grasp the two possible types of being—of plant and of animal— in their specific delimitations in general and as separate from any question about reality. The point is to find and determine the proper nature [das eigne Wesen] of the ontic fundamental structures [der ontischen Grundstrukturen]. But, as we’ll see momentarily, such an investigation is not at all scientific but of the philosophical sort. {6} P: By ontic fundamental structure you mean those final foundations of being that you referred to earlier? M: Yes, the final foundations of being. Yet here not in a transcendent-metaphysical sense, but in the sense of the very immanent foundation of the given [des immanenten Gegebenheitsfundamentes selbst]. But let me add immediately: once we have seen the two types of forms entirely separated from each other and completed in themselves, we won’t be remotely tempted to look, even theoretically, for a “germ of sensibility” or of “consciousness” in plants or for real autonomous movement. Experiments and observation for these special questions would then become entirely superfluous. For the two kinds of forms divide in such a pure and precise manner that it would be impossible to consider the typical “dress” of plants or even the animal’s typical kind of configuration anything other than an immediate and necessary expression of their general nature. {7} P: Well, then I beg you to depict in more detail what you call the ontic fundamental structure of animal and plant. M: Okay, Psilander, let’s start to work on this together. P: Because you’ve been a bit bored by everything discussed so far. M: If one wants to cross a lake, one gets tired of wandering along the shore. P: But how should we begin? I’ve never been stumped like this. M: Let’s above all start with concrete examples. Maybe the sort of examples where the animal configuration on one side or that of the plant on the other are given so clearly that we can attribute them without hesitation to the two realms of living beings. And, conversely, also those examples in which analogous expressions of life and forms of appearing tempt imagination and superficial re-

46

Metaphysical Conversations

flection to assume transitions or to erase borders between kinds. I’m thinking on the one side of mimosas and on the other side of something like a polyp. P: The mimosa because of the particular autonomous movements it seems to perform?¹ {8} M: Yes. It seems to refer to the embryonic disposition of an animal sensibility and manner of reacting. And the polyp with its flowery appearance instead gives the impression of not having quite divested itself of the shell and fetters of the plant nature. So, imagine the mimosa’s movement of its leaves, which consists in the slow and rhythmically exercised folding of the leaves, and compare this phenomenon with the incessant blind groping and searching movements of the polyp, as one can watch them in every aquarium. While you do this, try hard—setting aside for now all hesitations—to conceive of the mimosa wholly and entirely as a plant and the polyp instead as an animal. The point here is the theoretical distinction of types via especially vivid examples, not the question whether the mimosa is still a pure plant or whether the polyp is really already pure animal. Based on this attitude what would you specify as the characteristic that distinguishes the specific movement of the plant from that of the animal? P: I feel a bit embarrassed at your direct question, because neither do I quite get yet where you are headed, nor am I sure that I have the desired attitude already. As regards this specific case, I notice that the movement of the plant occurs in response to an external stimulus while that of the animal occurs based on an inner stimulus, maybe accompanied by the sensation of hunger or something of the sort. Yet surely this cannot be a decisive distinction in principle, given that the animal also winces if I touch or injure it. And there are also those strange, apparently searching movements of climbing plants through which they are able to find a support that has been haphazardly placed here or there. These seem to be based on an inner stimulus just like the searching movements of the polyp. {9} M: You are quite right; the two cases I chose do not have entirely identical conditions. In any event, I just meant the different manner of the movement itself. This remains in principle specifically different in precisely the same sense, whether it is called forth by an inner or an outer stimulus, as you say. But for the sake of greater clarity, let’s make the external appearance of the two cases as similar as possible. Let’s contrast the searching and groping movements of the polyp with the “similarly” searching movements of the climbing plant and the “apparently”² wincing movement of the mimosa with the wincing movement of an animal to  [Mimosas are a genus of multiple species of legumes whose leaves are sensitive to touch and thus seem to respond to being touched in seemingly conscious ways.]  [The term gleichsam means “similar” but can also mean “apparently”; both meanings are intended in both cases, i. e., some doubt is cast on whether what looks similar is only apparent.]

Plant and Animal

47

a forceful touch. Does it not seem remarkable to you, for example in this latter case, how very differently we feel these movements, namely, as if from inside the living being? P: For now, I see only one thing, namely, that the mimosa’s movements don’t seem accompanied by even the most embryonic sensation, as long as I think of it only and solely as a plant. But why do I exclude up front in the case of the mimosa what in the case of the polyp I simply assume—that’s again the same question. {10} M: Yes, you won’t make any progress on this point. You cannot pay attention to what may or may not potentially accompany the movements, but must focus on what distinguishes them from each other within themselves and purely for themselves. You always and without hesitation attribute sensation in one case and exclude it in the other because even without clear and explicit knowledge you “have” the plant, and with it the rootedness in movement, differently than you do the animal. To give you a first clue: do you not see the plant’s movement as in some sense less “free”? P: You mean that the retraction of the polyp’s tentacles already represents a sort of free expression of the will while the movements of the mimosa’s leaves is subject to an absolute necessity and in a sense determined by natural law? But that is a dangerous topic. Is there even something like free expression of the will? And even if there is, the polyp with its very primitive psychic organization would probably be just as unable as the mimosa to withstand the wincing movement triggered by the stimulus. {11} M: I do think the will is free by its very nature. But thank goodness we do not have to quarrel about that right now. Certainly, in the case of the polyp we cannot speak of a will in the strict sense, of a free expression of the will. Let’s say that for the case of retracting tentacles in response to an external painful touch, the animal cannot do otherwise than to accomplish a—or even this specific—reactive movement. Although in this respect it is subject to the same constraint as the plant, still the lack of freedom in the two cases has a radically different character. Or at least the reason for the lack of freedom is different. In one case the lack of freedom is only factual, in the other it is there in principle. P: “Only factual”—because the movement of the animal can in other cases also be free? But I thought the question about the freedom of the will can be set aside? M: Freedom of movement is not necessarily equivalent to freedom of the will. But if you could actually for a moment glance at the possibility of free will: the plant would not be able to make use of such a will, even if it had one. The animal could. The animal is just missing free will, while the plant lacks the very possibility of actively performing a movement. It cannot be the real bearer and subject of a movement. It lacks the ontic possibility of mastering bodily being from the inside.

48

Metaphysical Conversations

{12} P: Why do you call this an ontic possibility? Is it not simply tied to certain specific conditions that natural science has determined long ago? Plants do not have any muscles and no nervous system. M: First, knowing these conditions determined by natural science for the autonomous movements of animals does not hinder the appearance of analogous movements in plants on the basis of other external conditions. These are simply accidental givens, only facts. Second, they are no more than clever and expedient aids to serve a given ontic state of affairs for a specific goal particular to it: no muscle or nervous system, no physiological apparatus taken on its own, would aid a bodily being [einem körperlichen Wesen] in conducting autonomous movements. It could not aid it, if the bodily being were not “stuck” in this precise manner in its body [Leib], if it were not in a particular way personally tied to its body, as is actually the case for animal beings. But you won’t encounter this “personal” aspect in anatomy or in physiology; it cannot be encountered there. One assumes nowadays that animal movements have been perfectly elucidated and explained if one has discovered the purely physical aids, solely because the kind of movement at stake here, namely autonomous movement, is not being kept in view. Imprisoned in a natural science attitude, one only sees the physical performance of this movement, not its highly admirable ontic manner. It is ontic because it concerns the entirety of the respective living being—the living unity of the plant, the somehow “personal” unity of the assembled unity of the animal—not the scientific dimensions of the physical foundations. But you will understand me best if we continue our direct analysis. {13} P: I am quite happy to have tempted you once more to a little theoretical exposition. Your way of approaching the problem has become much clearer to me. If I have finally understood you correctly, you mean that the plant lacks the possibility for a “free” movement because it merely undergoes the movement and, unlike the animal, it is thus not the true bearer and subject of the movement. You think of the movement of the plant as passive in a sense, but that of the animal as active? Yet I still don’t quite see why the specific movement we considered, the wincing of the polyp, would be free in principle, because it is active. It seems instead as if such reactionary movements that represent an immediate effect of a stimulus also happen to the animal, just like the movement of the mimosa’s leaves happen to the mimosa. They don’t seem to be active movements of the animal. {14} M: The conviction that the movement in one case happens to [vollzogen an] the particular organism, i. e., to the plant, in the other case is executed by [vollzogen von] it, hits the mark. Yet an ambiguity in the meanings “passivity” and “activity” has again overshadowed this felicitous insight for you. Psilander, would it

Plant and Animal

49

not be possible that there is something like an active passivity and a passive passivity, if I might put it like that? P: I don’t get it yet. {15} M: Remember that even in the animal and in the human there are two wholly different types of reactionary movements: one in which for example my leg jerks up when someone hits beneath my knee; and the other when I immediately and involuntarily pull back my foot when someone steps on it. This is immediate and involuntary; for we certainly cannot speak of freedom in the sense that I would withdraw my foot on the basis of a free act of the will. This is not an activity in the sense that I am in control of the withdrawing, that I activate it but might as well let it be. Withdrawing it is an immediate effect of responding to the pain and I am actively involved in it only to the extent that I am simply exposed to the necessity of withdrawing my foot. And yet, what a fundamental difference between the involuntary twitching of the leg muscles and the involuntary act of withdrawal! It is precisely an act of withdrawal proceeding from me; admittedly a reactive act, forced by the pain; an act that I must implement—but the act character itself is not destroyed by it and cannot be destroyed. Yet the other is and remains merely a twitching in the leg. I myself withdraw the foot, albeit forced, only as a reaction because I cannot do otherwise, while in the other case my leg merely twitches. The polyp retracts its tentacles by itself, even if forced, even if only reactive, even though it cannot do otherwise, even if every trace of free will, even of consciousness is lacking—while the leaves of the plant, of the mimosa, are only being moved. Do you get that a chasm lies between this passivity and the other one? In one case we have a movement that is in itself actively undertaken, despite being forced as active upon the one undertaking it, who is the real bearer of the movement. In the other case the movement itself is already passive, because it does not proceed from the respective being, but this being is in some sense only the stage upon which the movement is conducted. {16} P: Yes, I have been vividly struck by the difference between a forced moving oneself and a forced being moved. And it now seems to me that physiology textbooks do not pay sufficient attention to it. All the same, when I try to imagine in what sense the animal could be the subject of a “self-movement”—without drawing on the freedom of the will—then all escapes my grasp again. If one disregards the physical and physiological apparatus, then these living movements must basically be triggered by the plant’s inner life or however one wants to express this in a vitalist manner. Presumably this life lives just as much in the plant as in the animal. And I thus don’t really see how a difference could be established, if you don’t want to turn the plant into a purely mechanic substrate of its movements. Or maybe you can explain more fully what you mean by the real [eigentlich] bearer of movement in one case and not in the other.

50

Metaphysical Conversations

{17} M: Yes, you are urging us to the decisive point. Even the expression “bearer” is still ambiguous. Permit me a little illustrative experiment: one might say that there is a factual and a sentimental conception of life, though I don’t mean anything condescending by the latter expression. According to the first conception, one might for example posit a powerful and tall tree as the primordial type [Urtypus] of true plant-being: we see it grow from its inner life into this shape according to the particular laws of its form [Formgesetz]. Standing before us with its branches far extending and its crown, it is, through this living law of form, a plastic formation from the innermost to the outermost tips of its branches and roots, but, as alive, also subject to these inner laws of formation: in the progressive growth and the regular succession of life cycles from blossom to fruit. This is entirely different in the sentimental way of looking at things: its crown and its branches are no longer just proceeding from an inner growth, but are now above all powerfully borne and extended by the tree itself as it stands tall and erect—almost like a “tree person.” It clasps its roots deeply into the soil; it elevates its crown over the woods; it extends its branches majestically or searchingly far and wide. Where before there was only formation, determination of form, figure and growth, now there is bearing, extending, clasping, and striving upward. It is not as if this required a real or currently performed movement—as if, for instance, we were to interpret the gentle swaying of branches in the wind as a nodding and bowing. Rather, the point is solely the manner in which its corporeality stands in relation to the tree as a whole in the two cases: in one case it is interpreted as merely shaped and grown organically, in the other case as actually governed from the inside by the current and accidental posture. You don’t need to assume sensation, consciousness, real ensouled being, or pride, longing, or something of the sort at all. Projecting a real soul into it is only a further step in potentially lifting the tree out of its tree-being. So far, the only thing at stake here is the inner relationship to its given corporeal being. {18} P: It makes no difference in this whether the tree [imagined as a person] continues to maintain the same bearing, right? M: Exactly. Viewed as a “tree person,” the tree could, for instance, have been paralyzed into its current posture by some magic spell; like the chief cook in Sleeping Beauty extending his hand to box [the kitchen boy’s] ear. It would still appear as such a tree person, even in this sleep that has descended on it, in this unconsciousness of itself, in this inner bondage that makes it incapable of stirring. Even unreleased from this magic spell it would still in principle govern its own corporeal being from the inside, be constituted with this possibility of governing according to its being, be merely momentarily “paralyzed.” Yet the tree as tree is not paralyzed and thus, so to say a posteriori incapable of movement, but it is so a priori: it cannot be “paralyzed,” because it does not have its own limbs that

Plant and Animal

51

it possesses as such from inside. What is most essential is for you to grasp the root point [Wurzelpunkt], as it were, at which finally the flip occurs from one view into the other. If you “have” and observe the tree as a whole, then what must be grasped differently in principle within the two views? {19} P: You said yourself that it is the relationship of the tree as a whole to the “corporeality” given to it… M: Sure, but what about this relationship? P: The presence or lack, in principle, of a capacity to govern from the inside… {20} M: Certainly, but what is still missing is the positive content of this governing capacity in one view, its impossibility in the other. We ascertained the intuitive fact but we have not yet explicated it in terms of its proper essential content. Does not the difference depend on the fact that the pure unity of the plant in some sense proceeds only from the inside to the outside, while that of the animal instead appears also to be taken in or back from outside to the inside? P: I still don’t quite understand. You said yourself a moment ago that this bearing, this capacity to govern one’s corporeality must be comprehended as proceeding from the inside? M: Yes, but for it to happen from the inside in this way, the corporeality must not only have grown from the inside to the outside, but must be given or taken back from outside to inside: what I want to govern, I need to be able to reach, I must possess it. The plant has only become and been fashioned as a living unity; but the animal has been given its corporeal being once more “as a gift.” If corporeality is turned back and given back into the living being, then this being possesses its corporeality from the inside and the possibility of mastery in accordance with its being [seinsmäßig] is present. {21} P: Accordingly the polyp can retract its tentacles because it possesses them in the sense that it is able to master them, even if this retracting is forced on it as an involuntary and unconscious reaction. I’m beginning to get it. Only here we can really talk of a body [Leib] in the precise sense. M: Good. You see that the constitution of the plant is, as it were, a wholly single-layered one, because it precisely only presents this living, growing structure? In this case corporeality cannot be separated from an “inside,” from a personal center. Yet as soon as the corporeal living unit wants to possess itself, it must be “detached” from its corporeality within itself. Only what has first been detached can then be given back, can be possessed. This creates a two-layeredness, in which corporeal being and personal nature are confronted, even if just in the most primitive, in a sense embryonic, beginning. And only with this two-layeredness, as you quite rightly say, is the body given and posited as “body.” P: You apparently without further ado presuppose the possibility of a direct interplay between body and soul with this way of looking at things?

52

Metaphysical Conversations

{22} M: If by that you mean what we just saw, that the animal as such is a selfowning, personal executor of its movement, because it is a self-owning, personal possessor of its body, then yes. This really has almost nothing to do with a soul, though. In the traditional quarrel—whether in terms of interplay or parallelism —body and “soul” are separated artificially and then one obviously tries in vain to bring them back together. But it’s actually the case that not first of all body and “soul” but body and personal nature of being [Wesenheit] form an ontic whole—from the outset oriented toward each other by being detached from each other. Only in their ontic belonging together are they what they are. The question isn’t any longer whether I or an animal can move my limbs myself and directly or not, when one realizes that my limbs are precisely the corporeality personally given over to me and that in this respect my personal being is precisely what possesses its corporeality. P: Then where does the soul have its place? M: Do we really want to rush on like this? And chase after such a flitting bird as the soul, to boot. But maybe together one day we’ll capture it. It almost seems to me as if today you had acquired a little taste for such a chase. P: You are right; a certain desire has awakened in me. But you’ll permit me to ask one more thing today: what do we do with sensibility now? That was, after all, our starting point. Namely, whether the plant has something like a capacity for sensation or not. But we haven’t really discussed that yet. {23} M: And we cannot really plumb the depths of that question now. That is, the general question about the nature of sensibility and its position in personal experiencing. But we are quite close to the insight that purely vegetal entities cannot sense. Everything so far was just a preparation for that. To sense surely means first of all to experience immediately in and with the body what happens to or in it, to have its experiences, to experience its fates immediately. Yet how could that be possible if I do not really own this very body as body personally? If it is not in this sense given into and back to myself as we just tried to determine it? P: The same thing that first makes possible autonomous movement also makes possible sensibility? M: As a conditio sine qua non—yes. For it is not necessarily the case that a “possession” of the body in this sense must, in fact, also be accompanied by sensibility. P: Just as in the case of autonomous movement. M: Precisely. But a plant is external to itself; thus, how would it be able to own itself through feeling or move itself through governance? P: I now also understand why you said in the beginning that the question of reality would lose its meaning and gravity, once one has seen the distinction between the principal types.

The Soul

53

{24} M: The question whether the real plant is a pure plant-unit in the sense identified? P: Yes. It also seems to me now that it already expresses this in its appearance, although I couldn’t say more precisely what it really is. M: The light and loose structural composition of the plant, its being entirely unfolded and turned to the outside in order to please—is that not the necessary disposition of this one-layered entity? Is not the plant created such that in it the plastic or, if you wish, maybe the artistic side of nature can express itself freely and exhaustively—a side that must be subordinated to other, personal purposes in the animal and the human? In the case of the plant the configuration is still its own purpose; in the case of the animal and the human it becomes a means and a basis. The plant is so to say only “configuration.” P: And everything that appears in it is process, not act. M: Process, yes. That is indeed a decisive expression. What gives a stronger feeling of an impersonal process than the mimosa’s movement of leaves in their secret living rhythm? And it’s probably no different for the “searching” movements of climbing plants. {25} P: This impression of the impersonal and selfless in the plant has become so forceful to me that really a chasm has now opened between it and the “gorging selfishness” of the animal. M: Now, Psilander, I would love to keep talking with you. But I think it makes more sense to close for today. If it suits you, let us get together again soon.

The Soul {26} Montanus: You are encountering me in the midst of a reflection, Psilander, that will probably seem a bit ridiculous to you. Psilander: That makes me all the more curious to hear what it might be. M: I was pondering why mermaids, fairies, and the sort of folk that belong to the realm of elemental spirits, do not have a soul. P: Indeed, I must admit that I have had little personal acquaintance with such rabble. M: I will tolerate your ridicule, as you can see. Actually, I am bold enough to venture that if I were able to give an answer to that question I would have much better knowledge of what the soul really is. P: But why do you want to refuse them a soul if, as it almost seems, you are willing to attribute to them a kind of existence? What do you mean by a soul? Why would a fairy not be a being equally free in spirit as you and I?

54

Metaphysical Conversations

{27} M: Those are too many questions and confusions at once, Psilander, for me to respond to all of them just like that. I neither attribute existence to elemental spirits nor do I refuse them a soul. Whether they exist or not makes no difference to me at all. I don’t attribute anything to or subtract anything from them, but—to speak philosophically—it seems to lie in their “objective idea” that they do not have a soul, that they cannot have a soul. But what is meant by a soul, that’s precisely what I do not know and what I would really like to find out. And for this reason, I try to compare with the human or even with higher animals all beings who differ in the particular structure of their being in this regard, that is, those beings who, as it seems to me, do not have a soul. Maybe we would be able to recognize more easily what is needed for a soul, if we see where in any case it cannot be found and why? P: Let’s stick with the rather more “real” plant, Montanus, than with this dubious spirit folk. {28} M: I’m just happy that at least you don’t seem to attribute a soul to plants. We won’t neglect them by any means. But they seem too distant from true “soul natures.” It is precisely the fact that—according to their basic idea—these spirits are free conscious beings like ourselves, moreover that, like us, they have a bodily, earthly form, and in all of this seem as close as possible to us, and yet don’t have a decisive “something” that’s crucial to being human, namely what we call the “soul”—it is precisely this that has so greatly aroused my philosophical curiosity. P: By “objective idea” do you mean the sort of unified configuration for these beings that we derive from folk tales and poetry? M: Don’t you think, Psilander, that one can accuse a bad poet of having completely missed the true being of these creatures? P: That is indeed a response to my rather thoughtless question. If poets and folk tales had created these figures arbitrarily, then there obviously wouldn’t be any objective match or mismatch. Still, Montanus, I would really like to hear from you how you are going to determine this objective idea of elemental spirits, though presumably you haven’t yet encountered them either. {29} M: You are still a bad philosopher, Psilander. Don’t you think that philosophers can “encounter” any being between heaven and hell if they really want to encounter it? Obviously not in the meadows, in the woods, or in the heavens themselves, but surely in the marvelously inexhaustible “realm of intuition”? But I really have no intention of giving you a lecture here. I told you before, I’m still seriously searching myself. Yet I would be very pleased if we were to set out on the path together. P: On the path to the fairies and the mermaids?

The Soul

55

M: No, to the soul. They are just helping a little to point us in the right direction. But let’s start with the plant, Psilander, considering you referred to it. So, you don’t intend to attribute a soul to plants? P: How could I, given what we discussed just the other day? M: We saw then that the plant cannot have sensation because it does not have a “body” in the true sense, didn’t we? But even though you are probably right that one should not attribute a soul to a being that has no sensory impressions; still, the two questions are completely different and need to be carefully separated. P: After all, Aristotle does endow the plant with a “soul” and yet does not grant it sensory capacities. {30} M: We certainly do not want to tie ourselves in any way to Aristotle’s concept of the soul, Psilander, even if it can be fruitful in a certain respect. When we speak of a soul in the precise sense we surely have something entirely different in mind. We mean something very particular that doesn’t fit the plant in its nature. P: The Aristotelian determination of the soul has always seemed oddly “formal” to me. M: I suspect there will be any number of occasions to point to it and its valuable meaning. For now, Psilander, let’s forge directly ahead on our path. You will surely admit that a plant, such as a flower or a tree, can seem to have a soul, if seen from the perspective of a poet—even though we know and see clearly that these vegetative structures in truth do not have a soul? In the same way one could see a plant as “quasi” capable of sensation, although it isn’t and cannot be so? P: The other day you made a distinction between a factual and a sentimental conception of nature. In the sentimental attitude we perform these projections that cannot ultimately be factually justified. M: Good. So, one can look at a flower “as if ” it had a soul. P: I think so. {31} M: And if we want to draw out what we projected inside via this attitude, then we would necessarily grasp something that really counts for us as a soul— otherwise we wouldn’t have put precisely that in there? P: That makes sense. M: Let’s take this narcissus in front of us, Psilander. Why don’t you provide it— true poet that you are—with a flower soul, a narcissus soul. P: I almost think, Montanus, that the narcissus is looking at me as if from out of its soul. M: With that you’ve already said something essential. The narcissus seems to look at you “from out of its soul”—it’s as if it opens up to you out of its soul, does it not? Its entire particular being, as it is there before you in its purity and gracefulness, seems to be the immediate “mirroring” and “projection” of a partic-

56

Metaphysical Conversations

ular, immanent center, as if “of spirit” [geistig], from which it “radiates out”— maybe one could put it like that? P: Yes, I have a similar intuition. It’s rather hard to grasp precisely, though. M: Yes, you feel quite rightly that we haven’t yet grasped anything serious or solid with this. I also fear, Psilander, that we won’t finally get very far in this way. {32} P: If we stick with the plant? M: If we insist on forcing a soul on the plant to see what is up with this soul. For the plant, for all intents and purposes, resists the adoption of a true soul. We cannot really anchor it within the plant and so reach only a certain characteristic of soul-like nature, a purely “superficial” soul. The plant ultimately resists real ensoulment far more than the adoption of sensibility. P: Yet, conversely, Montanus, it precisely seemed to me that in the way in which you just tried to grasp and depict it, by endowing it with a soul, the specific “flower-ness” was maintained in much purer and more pristine fashion than via the attempt to grant it sensibility, to turn it into a being “possessing a body,” a bodily quickened and moving being. {33} M: That’s not contradictory. In a real [reell] or ontic sense the plant is much closer to a being with mere sensory capacity, to the lower animal, than to one that has a soul. Purely on the level of being, it has more “receptive capacity” for this sort of fashioning. But sensibility and bodily mastery remain sensibility and bodily mastery, regardless of where one locates them: the plant is necessarily turned into “animal” through this specific aspect of animal existence. In the configuration and fashioning of the soul, conversely, we can be oriented by the being that is supposed to possess this soul and live from it. And so by depending on the nature of the flower, we picture a true “flower soul,” even if for fundamental reasons we cannot “really” manage to do so. Maybe we’ll see later on what is truly the matter with this flower soul. For now, let’s put aside all poetic “projections” and transformative arts. Nevertheless, one point that has emerged with the preceding discussion already fairly clearly might actually be important, Psilander, namely, that the sphere of possessing a body and of sensibility has nothing or very little to do with the sphere that delimits the soul in the most proper sense? P: If things are really like that, Montanus—I don’t really see it clearly yet— then shouldn’t these two spheres be separate in humans as well? Considering the human being is also—and in a real and true sense—a being with bodily senses and with a soul, maybe we would see it there more fully? M: Good, Psilander. Let’s examine that question. Would you admit that we are given into our entire body “personally”; that we are also “personally” present precisely where we feel a bodily pain, maybe in a finger? {34} P: I believe so. At any rate, it has always seemed to me that all those theories really falsify the situation, which want to make us believe that we experience

The Soul

57

a particular bodily pain, pressure, warmth, and similar things “within” consciousness or “within” the soul, but not on and in the respective place of the body itself. M: And we have to be present—we, personally—where we experience a pain? P: Certainly. M: Thus in some sense I am truly “handed over” [ausgeliefert] to my body all the way to the “outermost finger tips” or rather: “my” body reaches so far that I am handed over to it in this manner? P: Yes, I see that. But the old question, Montanus: how is it possible that “I” can be spatially extended? M: Let’s not lose sight of the soul. How the I is connected to the body is its own question. And I believe it might well not be entirely unsolvable if one presupposes certain insights. At this point, however, we only know, and only need to know, that the I really participates in the entire body, yet is neither its “spirit” nor its “soul,” but appears as given into the body together with them. Or do you want to claim otherwise? {35} P: Yet doesn’t one speak of hands having “soul”? M: If by that you mean just the living I that distinguishes a living body [Leib] from a physical body [Körper],³ then it comes down to what we just discussed. But surely this way of talking doesn’t mean the soul in its precise sense. P: No, I meant it in a wholly different sense, in the way in which one speaks of a soulful gesture or says that “the soul speaks through the eyes.” M: Here we can note a difference of degree, Psilander, right? The hands of one person have more soul than those of another? P: Yes. And by this I now see that real ensoulment is clearly distinct from the mere indwelling of the I in the body; for the latter must always be one and the same, precisely insofar as it concerns a body. And, besides, I live in my entire body, yet only some particular parts of the body can have “soul” in the aforementioned sense. So, what is up with this ensoulment, Montanus? We now seem to have discovered a very tight connection between “soul” and body. It almost seems as if I were in my body in twofold fashion—on the one hand, “I as such,” or however one should put this, and on the other hand, I through or with my soul. {36} M: To be sure, in a certain direction there is indeed a very tight connection between the soul in its precise sense and the body. But this connection is all the same fundamentally different from that between body and “I as such,” as you

 [The qualifiers “living” and “physical” are not in the German text and only added in English for clarification. “Body” in the English text will always translate Leib (living body), unless explicitly indicated otherwise.]

58

Metaphysical Conversations

say. My hands having soul surely does not consist in a real inner dwelling of my soul “in” my hands, as one could say it in regard to the bodily constituted I? P: No, that doesn’t seem to be the case. M: Psilander, consider how stimulations of the soul—like a joy that thrills the soul or a resentment that rises up from the depths of the soul—are “painted” on the body, as we say, or how they tend to settle down into it? Does the resentment or the joy, it itself, here “live” in the body or on the face? P: Speaking of a “settling down” of these conditions of the soul into the body seems to me an especially apt expression. It is as if the soul radiates into the body or, even better, is mirrored in it. M: That’s an excellent turn of phrase, Psilander, and gets directly at what I was looking for. On the one hand, I “live” in my body as such, am factually and really handed over to it; but on the other hand, my soul or I, inasmuch as I am “soul,” radiate into the body or am mirrored in it. But why don’t you take a look back at our “flower soul” now? {37} P: Yes, I just thought of that: that earlier conception and the perspective we just gained seem to agree with each other more or less. You said approximately that the artificially ensouled flower seems to open up before us as if out of an immanent center, so that the particular kind of “appearing” is presented as a “mirroring” of its inner being. And yet I have to admit that I am not at all satisfied yet, Montanus. I thought the soul would allow me to descend really into the “depths” of being. M: And instead we’ve just dawdled about among “mirrorings” and “radiances,” right? P: Yes, something like that. M: But so far we really wanted to clarify the relationship between soul and body in some way or, rather, a particular difference between the I, inasmuch as it is a bodily I and dwells in the body and truly governs it, and the I inasmuch as it is an ensouled I or possesses a soul. So far, we know very little about the soul itself. Or are you able to state now why mermaids and fairies do not have a soul? {38} P: No, I couldn’t say that. M: Well, until then we do not know anything about the soul. Yet all the same don’t disdain what we have discussed so far. Let’s first designate a “place” for the soul; let’s find “where” it is hiding within the I-totality that is constructed in such a complicated way. And in that respect, it seems to me, we have gained nothing so very trifling: Note how the I has been placed into or split into different dimensions and how these relate to each other in particular ways. We have touched in passing on the I insofar as it expresses its life in spirit. We saw how, in a different sense, precisely this I is handed over to the body and governs it. And we learned to distinguish from this the I insofar as it has a soul. Don’t you think we would be right

The Soul

59

to say now, for example, that the I “elevates itself ” up to spirit or to being of spirit and that through the body it is fashioned into or out into external being or existence? And in the soul—yes, what now? P: In the soul the I seems to be really “at home.” M: Excellent. And if it turns out that the I unfolds itself, as it were, in “spirit” beyond itself or “into the heights,” but in the body out of itself or into outer existence, does not the soul present itself as the true center or real middle of the totality of the configured and constructed I? {39} P: Could one perhaps add that the I, as it is fashioned through the spirit into a height and through the body, as it were, into a “width,” so it is fashioned through the soul into a “depth” or into its own depth? M: You are extending my image and although one has to be quite careful with images of this sort, in one respect you have hit the mark: when I called the soul as it were the “middle” of the I as a whole, then we are still stopping at the position of the soul inside the I as a whole. We only gain the soul itself if we, as you say, climb into the proper depths of the I. P: Given that you are always talking about the configuration or fashioning of the I into spirit, body, and soul, is this I or I-ness for you something special next to or, better, before these possible dimensions of fashioning? M: Don’t you think that one must make such distinctions? But not in such a way that the “pure” I would already form all by itself a concrete unity. An I or as one might better say, a being that is a self [selbstiges Wesen], is in need of the specific configuration or figuration, otherwise it remains a “nothing.” Yet on the other hand, the I is surely not just a simple “composition”—the whole—of “soul” and “body.” A being that is a self is fashioned out of one root; this is the place where the I, so to say, “commences” [anhebt], in order to split in a particular way, at least in human beings, into this one sole I in soul, spirit, and body. But I believe, Psilander, we should not lose ourselves in the particularities of a being that is a self as such. {40} P: No, but surely it is good to have a certain basic perspective on which we can build the rest. According to the prevailing view, the soul or even the spirit (or “consciousness”) always seems to collapse into the I as such, while the body only seems attached to the I in some external fashion, so that a sort of transposition is required to see body, soul and spirit as belonging equally to the I or to see them as particular areas of configuration of the one and only I. M: You are certainly right about that. The I is I, but soul, spirit, and body belong to it. Or also: the I is itself, but it possesses soul, spirit, and body. The possible differences in the concrete units of configuration also follow from this: only the human has soul, body, and spirit. A lower animal is formed in its selfhood only in bodily-sensory fashion; a higher animal lives already out of a soul-center, but

60

Metaphysical Conversations

does not rise up to having a free spirit [freie Geistigkeit]. A being that is purely spirit would be figured only in terms of spirit and would not possess, it seems to me, a body or a soul; it would not need them. Elemental spirits, conversely, would be configured by spirit and by body, but they lack a soul. Thus, we have besides the bodysoul-spirit totality of the human and the body-spirit unity of the elemental spirits a bodily-sensory figuration for lower animals and one solely of spirit in higher spirits. But, Psilander, do you think there are beings that are just soul? {41} P: I couldn’t possibly answer that. M: Because we still don’t know very much about the soul and its position in the human being. For even if soul, spirit and body belong, as you said, “equally” to the I, still their position, function, and signification for the I-totality differ fundamentally from each other. I think it might now be illuminating to look at elemental spirits and their “soul,” or rather their lack of soul. What do you think, Psilander, how must these spirits be distinguished from a true human being? P: At first glance I see only that they can do all sorts of things that humans are not able to do: they can vanish and reappear in marvelous fashion; they can make themselves invisible; to some extent they have power over time and space; forces of nature that are entirely closed to us are at their free disposal; and any number of other apparently marvelous things. {42} M: But does it not seem to you that all of this would be only a secondary effect of their nature that is so fundamentally distinct from human nature, as if all of this were arrogated to them only accidentally? If a human being were to acquire all those capacities, would that being cease to be “human” and become an “elemental spirit”? Moreover, you speak only of the “advantages” of these kinds of beings. Might there not possibly be some real reason for the story of the mermaid who longs for humanity and especially for human tears? P: Humans can weep because they have a soul. M: How much lies in this simple insight, Psilander—as if we could immediately come very close to the soul and its nature with this insight. And yet it is so very difficult to get a hold of it. Incidentally, as far as concerns the purely objective or we might say philosophical grounding, this story already includes a certain inaccuracy—as is the case for those poetic creations that throw together and mix up the separate forms of infinitely rich existence: a mermaid that “longs” for human existence basically already has a soul or at least the rudiments of a soul. In the original folktale we accordingly do not actually find this sentimental expression. {43} P: You mean that such a spirit would be fully content within the sphere to which it properly belongs? M: Not, however, because it would be especially “content” or anything like that. But because its entire being must exhaust itself with the existence and the

The Soul

61

life of the sphere to which it belongs. Does it not seem characteristic to you that, in contrast to humans, these beings must in a certain sense be absorbed without remainder into the actuality of their particular existence, while humans live as if out of or from a ground that lies “beyond” their actual existence? P: Maybe what you mean coincides with an idea that I’ve already had the whole time but didn’t know how to express: in contrast to all mere “spirits,” even those fashioned with a body, as far as I can gain any sort of intuition of them at all, humans present themselves to me as if weighted in themselves or “fixed” into their being in a particular sense, while those spirit-beings are distinguished by a certain “lightness” or “ease” or “unrestraint” of being and existence. I just don’t know how to explain or ground this characteristic of lightness in this and of weight in the other case. Yet what you just said about the “ground lying beyond” seems to make the matter already more comprehensible. {44} M: This indication is spot on, Psilander. I don’t know what would give a better grasp of the phenomenal difference in character between these two natures. But tell me: you don’t mean all of this in a psychological fashion? In the psychological sense there are obviously people with or without “backgrounds,” people who are entirely absorbed in their being and doing and people who always remain “beyond.” That is obviously not what we mean here. For the human as human has a soul and if we had something correct in mind with the idea of a “ground beyond,” through which humans, as you rightly said, become so to say “weighty” in themselves or seem tied to or fixed in themselves, then this aspect must be ascribed to every human being necessarily, because constitutively—even if it may appear more clearly in one case than in another. For there are people who are, as it were, “without soul” and it might certainly still be interesting for us to describe them. Also, do I assume correctly that your “weight of existence” [Daseinsschwere] has nothing to do with the serious nature [Schwerlebigkeit] of individual people, with their melancholy mood [Schwermütigkeit], their awkwardness [Schwerfälligkeit], with their serious and “troubled spirit” [schwerer Sinn], as it were?⁴ {45} P: Not at all. I was thinking more of the way in which one depicts a stone on account of its weight: it is heavy because it cannot exist differently—that is, if it is to exist as “stone.” One cannot take this aspect away from it without robbing it of its entire nature. M: So that other “weight” works in the same way? For presumably you do not want to align the two in other respects?

 [Schwer in the sense of heavy, weighty, dark, or serious is used in all these expressions in German.]

62

Metaphysical Conversations

P: No, weight is here obviously meant in a figurative sense, namely inasmuch as a being of spirit [geistiges Wesen] can have something like that at all. M: Would you call the human a being predominately “of spirit”? P: Yes, I do think that one can call it that. Humans are principally distinguished from other beings on account of their free being of spirit [freies, geistiges Sein]. M: From lower beings? From the animals? P: Yes, but mainly from animals. M: And from the higher spirits? If such higher spirits existed, would it be a matter only of a difference in rank or degree between them and humans, or would instead their entire ontic structure be different? P: Do you mean to say, Montanus, that what makes humans distinctive is the possession of a soul? {46} M: That would be judging too quickly. But it is possible that the possession of a soul is just a necessary consequence of its real, its proper nature. Maybe it wasn’t quite wrong when you said a moment ago that it is principally the free nature of spirit that distinguishes the human as human. Yet maybe with this having of spirit [Geistigkeit]—and as we must add, in and with having bodiliness [Leiblichkeit], which similarly is not only accidentally attached to the human—humans have a wholly different place and significance in existence than any conceivable spirit folk might have. It is precisely this special status that requires an entirely different inner “composition” for the human and also makes necessary the possession of a soul. P: Purely logically I understand this possibility, but I don’t yet see at all what you are trying to intimate with this. M: Let us return once more to our last starting point, Psilander. Could one not say that a spirit always has to belong to a very specific sphere—that it is “assigned to” this sphere in its being and existence in a particular way? P: I see something of the kind at least for the elemental spirits; they cannot be separated from a certain sphere of nature. That was already implied in what we discussed earlier. {47} M: But I think that all “spirits” as such must necessarily be tied to such a specific sphere or dimension, spirits of nature and higher ones. But let’s leave that aside for now and stick with our elemental beings. Not only every typical domain of nature (woods, meadow, mountain), but even each geographically different region must have its specific natural spirits, different ones in Greece than in the “foggy North,” right? And every element, like fire, air, and water, must have a specific kind? P: Naturally. M: But how is this apparently very tight relationship between such a sphere of nature and its spirits constituted?

The Soul

63

P: It almost seems as if the spirits were born out of such a typical sphere, as if the “original”⁵ spirit of this domain of nature were in a sense “thickened” into a personal being. M: Maybe instead of “personal thickening” one could also call it the “substantivizing” of the original spirit of a sphere of nature: the “spirit” of nature has become a spirit. Yet is that only a relationship of origin? Did it not seem to us earlier as if there were a permanent relationship between such a spirit’s entire being and existence and the domain to which it belongs? P: The spirits cannot “detach” from their sphere. {48} M: Because of a kind of attachment to it, as if it were the “mother” of their existence? P: They cannot do otherwise. M: But why? Are they subject to a physical or psychical constraint? P: No, but somehow they can subsist only with and within the respective sphere as such. It’s like the earlier case of the stone and weight. M: They belong together constitutively? P: So it seems to me. M: Then how do we want to comprehend them? Despite all dependence, they are, after all, independent beings who stand and exist in and for themselves? P: Otherwise they would certainly not be able to act freely from themselves, which does seem to belong to their nature. M: Thus in any case they do not simply remain subject in their being to the spirit of nature or the respective domain of nature; they are not merely determined or governed in their effective being and doing via this external sphere. P: Isn’t the opposite the case: that they themselves govern over nature or that the element of which they are the spirit is part of their specific particularity? The element is subject to them, not they subject to the element. {49} M: You do seem to know more of this rabble, Psilander, than matches your initial scorn. P: You are right to laugh at me. But, as Plato rightly taught, one always knows more than one thinks. Incidentally, the concrete image of Ariel, the spirit of the air, just floated up to me out of the “storm.” He is master over wind and fire; he produces such heavenly music in the atmosphere; he has the lightness, speed, and transformative capacity of the airy element to which he belongs. All this makes it seem more as if the spirit of this element has truly passed into him, so that

 [The German term ureigen means here “original” or “primordial,” but also “proper” or its “own,” in the sense that it is the spirit of a sphere of nature itself that becomes or is expressed in the spirit-being.]

64

Metaphysical Conversations

he can both govern it externally, as well as freely realize in himself everything that corresponds to this “spirit.” M: Magnificent, Psilander. I almost think you have already grasped the solution to the matter inadvertently. A spirit of this sort is not externally governed by the “spirit” of the respective sphere of nature or element, but this spirit lives in it itself. It is the elemental spirit itself that is free, precisely because it personally bears or manifests this “spirit.” It is only itself inasmuch as it continually actualizes it in itself in a free manner or “lives it out” in itself. The elemental spirit is tied to it, because it cannot do other than precisely bear and manifest this “spirit” personally. Yet it is simultaneously free in it and “master” over it—as if over the external sphere, in which the same “spirit” is formed naturally and “settles down,” as it were, because as a personal being it can rule and command as it wishes within the limits of its totality of being, as supported by the respective spirit. Only now can one really understand why such a being is so inseparably shackled to the sphere from which it “emanates,” as it were. {50} P: Precisely because it lives only from and within the spirit that has settled down externally in this sphere of nature, as you say? M: Where else should it belong, Psilander, other than the realm to which its own spirit, through which and within which it itself lives and is, refers and drives it in uninterrupted actuality? P: That makes sense. But what actually brings about this ambiguity of the concept “spirit,” Montanus? The whole time I’ve been wanting to ask this. What does it mean that a specific “spirit” is configured within nature—precisely the “spirit” that is supposed to live within the elemental spirit in personal substantivizing? M: You are right, Psilander. Much remains to be cleared up on this point. All the more, as, for all intents and purposes, we do not even know yet what a “spirit” is, what it means to be a “being of spirit” [geistiges Sein] or a “nature of spirit” [geistiges Wesen], and so forth. Just as we are now in search of the soul, so some day we will have to undertake a quest for the spirit. Only that may make it completely clear to us what “spirits” in a personal sense are. In either case, just in terms of the phenomenon, we needed the distinction between the spirit that is fixed or settled down externally in nature and the spirit substantivized in a personal being. Let us be satisfied for now with the perspective gained. It was only a stopping point on our way to the soul. I hope we will momentarily reach another one. Do you think, Psilander, that the human also belongs invariably to a specific sphere? {51} P: Unless one wants to say that the human truly belongs to the earth, not the element obviously, but this planet. M: Good. But does the human relate to the earth in the same way as Ariel to the atmosphere?

The Soul

65

P: Decidedly not. M: Did we not say that those spirits are so intimately tied to their natural domain because precisely the same spirit rules in them as in the respective sphere, determining them in fundamental fashion? P: Accordingly, humans would have to appear as determined throughout their being and existence by the “spirit of the entire earth” in the same way as Ariel does from the spirit of the atmosphere—if the human should belong to the earth in a similar way. But is there such a thing as a “spirit of the whole earth”? {52} M: We don’t want to examine that now, Psilander. A much more immediately important indication for our question was contained in what you said. In general, are humans oriented by a specific “spirit” in their acting and existing in the same manner as those beings? P: The being of humans seems in this respect “freer” by far. It is not determined within itself in a specific dimension up front. M: Certainly, but what is the reason? Does it not have something to do with a fundamentally different constitution of being? When we said that every elemental spirit is exclusively ruled by a specific “spirit,” then this has a far more fundamental sense than the one highlighted earlier. It does not just mean that the elemental spirit cannot be anything other than the “bearer” of this spirit, but it also means that its entire figuration, its particular total figure [Totalgestalt] is determined, formed, substantivized, by this specific spirit. There is nothing in it that is not guided out and upward by this substantivizing spirit in its uninterrupted actuality. Therefore, one can call it a creature “born of spirit” [geistgeboren] in a precise sense. Inasmuch as it exists at all, it is born out of “spirit” continually and ceaselessly. {53} P: Only now, Montanus, are you really grounding the explicit character of “lightness” [Leichtigkeit] that these beings have. Is it not precisely because they are oriented by spirit according to their being in their entire form? M: And because “spirit” is something essentially actual, something that holds itself in its nature, as it were, in an eternal “suspension.” What is “spirit” or “out of spirit” never manages really to fix itself in itself; it never manages to determine itself rigidly in being and thus also does not arrive at “weight.” The “levity” [Leichtbeschwingtheit] of a pure being of spirit or of a being born of spirit depends primarily on this actuality of being that cannot be suspended. In this way, it arises “always and ever anew” and is “drawn” always and ever anew from this spirit that gives it life. P: Is it not also connected to the fact that the elemental spirit—as it seems by its very nature—can change or exchange its external appearance, cast it off or take it up again, in whatever way it pleases?

66

Metaphysical Conversations

M: To be sure. Obviously, it can do so only within the limits of its specific configuration, as determined precisely through this spirit. And, fundamentally, this spirit doesn’t have a real “body of flesh and blood” at all, but an external figure, in which it has been merely “cloaked,” if I may say so, by this its spirit, through which it is and lives. Psilander, I would like you to have before your eyes with appropriate vividness this very particular nature of “being born of spirit” or being “substantially spirit” of the elemental spirits. The question about the human can now be repeated in a much more concrete fashion: is the human also a creature “born of spirit” in this sense? {54} P: Apparently not. The human seems to be “composed inwardly” from somewhere else. M: But wasn’t the spirit most essential, even in the human? P: You said at some point earlier that because of their spirit humans, so to say, unfold and are raised beyond themselves. This expression now seems to me to hit very well upon the contrast to that spirit-born species, in which the respective being lives and is from spirit (as it were, “down” from it). M: Humans thus have a different “basis” or sphere of rootedness within their totality of being, one from which they themselves are and live? P: Do humans not seem rooted more “deeply” in themselves in a certain sense, Montanus? M: It appears the same to me. And should we not now at once dare to claim, Psilander, that humans live from their “soul”? Are they not rooted in it according to being? {55} P: It was fairly obvious that that’s where you were headed. M: And yet it is only a very preliminary result and, so far, grasped only quite superficially. The full insight into the matter shall still reveal itself to us. For now, a question: when we said that the elemental spirit “lives” from spirit, then this meant at the same time that it is penetrated by this “spirit” in its inner form as a whole—can the same thing now also be said about the soul in the human being? P: Would that not lead us to the Aristotelian-scholastic specification that the soul represents the determining, even the pervasively determined “form” of the human being—as generally is the case in every living being? M: But does that seem right to you? Or, rather, do you really find that it applies to the soul as we have been keeping it in view throughout? P: Not really. M: Weren’t we agreed earlier that the human is formed or configured into body, soul, and spirit from an undivided “root,” so to say from a united formative root? Thus, also into the soul?

The Soul

67

P: It follows that the soul is not what determines, but what is co-determined. By contrast, what you call the formative root appears to correspond more to the scholastic “soul.” {56} M: We don’t want to examine that now. But you say quite rightly that the soul—our soul, the soul in its precise sense—is not what determines or forms, but what is co-determined, co-figured, co-formed. And one has to maintain that this aspect itself, which uniformly forms throughout—through which the human as human appears as “of a piece”—must be distinguished from the soul that is comprised in this primordial formation of being. P: Yes, I think I see that. M: On the whole, does not a difference between soul and spirit rest on this, Psilander, that the soul is always “middle,” “center,” or “ground” of something that is already formed, yet the spirit can exist for itself and through itself alone? This is why the spirit, but never the soul, can be what fundamentally determines and fashions certain beings. P: But in what special sense can one still claim now—what seemed to emerge earlier—that, in contrast to beings born of spirit, the human is “rooted” in a soul, that it forms the “ground” of human existence? {57} M: Should one not here be able to distinguish between actual existence [on the one hand] and [on the other] existence given once and for all or determined from somewhere? If humans are and live, then they live and are from out of their soul. All the same, the soul need not be—like the spirit—what in general fashions the totality according to being. Don’t you have the overall impression, Psilander, that the total inner formation, the entire constitutive composition of being is wholly different for a living being that is grounded in spirit and lives out of its soul? Or, even more, that these two species of beings, on the basis of their different formation of being, confront or are placed into the world and the environment in fundamentally divergent senses? P: I just always see the superficial characteristic of, I want to say, greater “submersion” into their own being in the case of humans vis-à-vis the aforementioned “levity” of the spirit-creatures. And while you have in some measure made clear to me the reason for the latter, Montanus, we still have not touched upon the aspect of the particular “weight” in the case of the human, but turned away from the path. And it is precisely this point that seems so fundamental to me, as if this were to allow us to grasp the matter. {58} M: You are quite right, Psilander. You said earlier that humans seem more deeply rooted in themselves, and now, appear to a special extent “immersed” into themselves. You also pointed again to the characteristic of weight, that the human in some specific sense seems to be a more “natural” being than even the elemental spirit, yet on the other hand also belongs to nature in a very specific sense. All of

68

Metaphysical Conversations

this now urges on us one and the same basic particularity in the ontic composition of the human—a particularity of being that we must absolutely try to grasp. But we did not lose our path; instead, we are well prepared for it. One important insight especially now seems to me easily gained: What makes for the real difference is not that humans as such are immersed in themselves to a “greater” extent, that they are rooted more “deeply” in their own being, but that they are immersed in themselves at all, that they are at all poured into their own being, so to say. What is particular is not the degree of “self-rootedness” but its pure fact. P: So, you would say that beings born of spirit are not rooted in themselves in this sense at all? M: I think that the phenomenal contrast of weight in the one case and levity in the other precisely coincides with the fact that humans—according to the disposition of being inseparable from them—are “poured into” themselves and that precisely this aspect does not and cannot enter into the idea of a spirit-being. {59} P: But when you say that the being born of spirit is substantivized from spirit, that this spirit forms the basis of this being in terms of being, then does this not also concern a spirit that is placed in it personally, that has become independent personally? Does this spirit-being not stand “for itself ” in the same way as an independent, detached individual unit? M: Without doubt. Yet this contrast does not contradict that [claim]. The fundamental aspect, that humans are also placed into their own being in a special manner, is in no way exhausted by the fact of personal independence, but adds a specific peculiar character to it. And, conversely, despite its personal independence the spirit-being is “placed outside” or “lifted out of ” itself through or with its particular constitutive disposition of being. P: It is still not quite clear to me what aim you have in view. M: Does not being of spirit necessarily lead beyond the narrowly personal? P: Because one participates in the world that the spirit encompasses? M: Yes, sort of like that. Yet in the present case you should not grasp this in too much of an “intellectual” sense, but in a foundational one: beings that are substantivized out of a specific spirit, that have it as the “basis” and “root” of their entire existence and their entire inner configuration, must thereby at the same time live immediately in the world or sphere of spirit, which is precisely the specific sphere of this “spirit.” They must be classified into it irreversibly, must be, as it were, “assumed” into it. {60} P: One can even say about humans that they are arranged into a specific world of spirit immediately—in each case according to the spirit that rules in someone personally and out of which he or she lives. But if I understand you correctly, then you see a difference here in principle. The human apparently does not dwell within such a world of spirit in a similarly primary or unalterable fashion? It

The Soul

69

is not the true “foundation of being” in the same way in this case as in the other, but a sphere into which the human reaches precisely only by virtue of his or her spirit, i. e., in secondary fashion? M: Speaking of the world of spirit as “foundation of being” [Seinsfundament] is well put. We only have to guard against comprehending the possible relation of humans to a similar sphere, to which they might be wholly devoted in spirit, in too external a sense. This would tarnish the overall ontic contrast in its purity. Take, for example, a saint who manages to separate entirely from his or her peripheral and externally oriented being and to live “in God”: would such saints not become assumed into a “realm of spirit” that “is not of this world” with their entire being, doing, and experiencing? Would they not be truly grounded in it? {61} P: It does indeed seem that one could rightly speak here also in a certain sense of a “foundation of being,” given that the life and being of such a saint would be wholly determined from “elsewhere”… M: Because this life would receive “power,” “light,” and “orientation” immediately from there. P: Certainly… and yet… M: Yes? P: I don’t really know how to express it… as if it were in this case not really a foundation of being in precisely the primary, or as you say, fundamental manner; as if—even in this particular case—it still always remained something secondary to that primordial relation that must be found in true spirit-beings. Surely the saint would be able to reach this state only through deepening or interiorizing. Yet in the case of spirits this relationship is present, I almost want to say, “in any case.” M: It is constitutive for them, just as weight is for the stone? P: Yes. M: But I want to remind you now, Psilander, of the religious idea of the “primordial” human, of the human “before the fall.” We do not imagine this human as removed from God and sunk down into peripheral and external existence; such a human was still thoroughly secured and assumed in its entire being “within God.” Would this being-assumed not also be a constitutive one? {62} P: It couldn’t have been constitutive or it would not have been possible to disturb it by the fall. M: But certainly a fundamental, primary, primordial one, not one reached only through the personal spiritual effort of this first human? P: But do we want to be oriented here by a specific kind of religious-philosophical perspective? M: Certainly not, Psilander. Yet could it not signify something for our problem if we can form the idea of a human being who is still “integral” in this sense, as Franz von Baader says so perceptively? Even with this integrity, this human

70

Metaphysical Conversations

would all the same not cease to be truly “human”? Or does it seem to you that the pure idea of the human would be destroyed by this? P: No, certainly not. M: It would indeed be strange if, what most properly corresponds to the very idea of the human according to this profound perspective would actually contradict human nature. Yet if it does not contradict this nature, then maybe the human could also appear as a being that is classified and assumed into a realm of spirit in that fundamental and primary sense. Yet what does this mean for our difference, which seemed so essential to us? {63} P: You yourself posited this difference, Montanus. I cannot help you if you destroy it through your own objections. M: I think that the difference in principle between the potential [möglich] way in which the human could be assumed into God or into a realm of spirit and the real [reel] way, in which beings substantially of spirit or born of spirit are assumed, still stands. In fact, it will now be possible to grasp more precisely the decisive point. P: You seem to wish to indicate something already with the contrast between “potential” and “real”? M: Not more than you did earlier with the indication that the relationship in the case of the human cannot be constitutive, because it can be disturbed by the fall, according to that perspective. But now, Psilander, I will raise another serious objection: isn’t there also the idea of fallen angels? Angels who, as it were, have fallen “from God” or from the “godly realm”? P: I am not a philosopher of religion, Montanus. You are downright chasing me through heaven and hell. That’s all out of my line. {64} M: Even though we are not philosophers of religion, there is little that is more instructive than looking at the essential relationships that underlie these perspectives. Nowhere are the true limits of being preserved in purer fashion than here; that is why one can learn so very much from them. If there are “fallen angels” in the primordial religious imagination, then presumably this aspect does not contradict the essence of such creatures. Yet in no way do we want to assume this up front, but want to see ourselves, whether it is self-contradictory, whether the aspect of a potential “falling away” is in conflict with the pure intuition that we want to gain from it. If it isn’t, then it also cannot serve by itself to ground a difference to the being of the human. P: The result then would be that the “being-assumed” [Aufgehobensein], as you call it, into the sphere to which it primarily belongs would not be constitutive even for the pure spirit-being? At least for the pure spirit-being in the form of the angel? M: No—it is still constitutive for them. P: Then I do not understand you yet.

The Soul

71

M: The conceivable falling away does not eliminate the relationship that is at stake in the way in which the spirit-being is classified into the sphere or world of spirit in a primary sense and according to being; it has nothing to do with it. And the moment you grasp that distinction, you will also immediately understand how to distinguish this (constitutive) being-assumed [Aufgehobensein] radically from the one that is possible for the human. P: But I still see in no way what one can distinguish here. {65} M: One cannot fall out of the aspect that constitutes one’s own being and nature? P: Certainly not. M: But a conscious and free being could still resist internally against its constitutive being? P: What are you thinking of? M: Let’s take an example from an entirely different sphere that has nothing to do with relations of being or nature: for example, the empirical-individual constitution of someone born blind or deaf would include precisely being blind or deaf? P: Certainly. M: Such people could not discard or rid themselves of their deafness or blindness? P: No. M: But they could live in a constant inner opposition against this infirmity, in continual rebellion against it? P: Obviously. M: They can downright live from this opposition and insubordination—in such a way that the content of their lives, yes, the entire basis of their particular individual form, to which they have conformed themselves via this life, would be taken away, if they could be rid of their infirmity? {66} P: There are such cases. M: Now, if the substantial classification into a godly realm would be constitutive of a being, then it could not be rid of this constitutive aspect of being in a quite different sense, namely in principle? P: To be sure. M: But even such a being could enter into opposition against this its fundamental position in being and could make this opposition in some sense the “source” and “sustenance” of its entire existence? Specifically, as a being born of spirit, it would substantiate itself into a very special “shape” or “figure” with and through the ceaseless positive denial of its primary and basically unalterable position? P: You have the fallen angel in view with this remark?

72

Metaphysical Conversations

{67} M: Yes—the idea of an evil spirit in person. Such a spirit would have become unfaithful to its proper position and determination and in this respect have “fallen” from it. Yet what is peculiar about this is that it thereby rages against its own, its primary substantial being, against the sphere on which the being given to it is essentially based. It cannot divest itself of this being and thus it can never achieve that after which it strives. This is why Franz von Baader, who uncovered and comprehended these circumstances in masterly fashion, calls this an “eternally hellish” striving. But you will now be able to distinguish very clearly: the fallen angel would obviously no longer be truly “classified” into the realm to which it initially belonged—because the “spirit” of this realm no longer rules it actually and vividly, because the fallen angel itself no longer affirms this spirit positively and “calibrates” it always anew in itself. And yet the angel is still substantivized from this realm in its being, because it is all the same a spirit, who assumes form and figure, in a primary sense, only and solely from this realm. Even if, in a secondary sense, it tries to force itself into a second, into an independent form, its true completion cannot finally ever take place. Thus we have to distinguish a being-assumed according to being or one that is substantial and thus irreversible from one that can be brought about and preserved only through free dedication [Hingabe], through a positive affirmation of the respective spirit. The substantial being-assumed determines or constitutes first of all the primary “figure” and the primary position of being; but the being-assumed that relies on positive dedication already presupposes the fixed figure and position of being. Accordingly, if we speak of the human potentially being assumed into such a sphere or into such a realm, then this can always only have the second meaning; even if such a dedication may truly transform the entire being of such persons, and may in a sense raise them beyond themselves. It still always remains a secondary transformation in regard to the constitutive disposition of being. {68} P: Now I understand: this constitutive being classified or assumed into a realm of spirit that falls to spirit-beings contrasts with the constitutive beingplaced-into-oneself or being-left-to-oneself of the human being. M: Exactly correct. You call it “the constitutive being-left-to-oneself ”—so let us make this point still more precise. We do not mean by this that the human would be simultaneously abandoned, as if he or she would thereby necessarily be cut off from any higher sphere. For we know that it conforms to the idea of “integral” human beings to be “elevated” with their entire being and nature into that sphere, from which they received their existence as a “creature.” Mark well, Psilander, that these two aspects do not contradict each other, but to the contrary, presuppose each other: only because humans as such are placed or set into themselves or into their own center, can they at the same time appear as if elevated into it or raised above themselves. The spirit-being is less elevated into it than primarily un-

The Soul

73

folding itself into its being from it. But what is even more important: because humans are placed into their own center, they can “fall back” into it or into their very own self. Even though they need not necessarily be “cut off ” or “abandoned,” this constitutive “being-placed-into-oneself ” still makes it possible for them to sink into themselves in a radical sense, to fall prey to themselves absolutely. A spirit-being cannot fall in the same fundamental fashion out of any sphere that bears it and on which it is based or fall back onto itself. Devils necessarily believe in God— for they are and remain indissolubly tied to God. {69} P: You have just touched on an aspect that has always struck me as remarkable in the purely psychological observation of the human—apart from any potential religious connections: the immanent abandonment, if I may put it like this, that seems to characterize the human on the basis of its most proper nature. M: You are entirely right. Only I would make it more precise in such a way that although this aspect of immanent abandonment is admittedly indivisible from the nature of the empirical human, it is very characteristic for the pure idea of the human only inasmuch as being placed according to being into oneself or into one’s own center encompasses that possibility within it, but is not necessarily tied to it or identical with it. P: If we follow that idea of the “integral” human, should one not be able to say that humans belong originally to two “realms” or “dimensions,” are led into existence and fixed in it by both: on the one hand from the, as it were, “lower” or natural sphere, which at the same time fastens them into their ownmost being in a particular way, and on the other hand from an “upper” sphere of spirit, which raises them as such beyond themselves? {70} M: There is surely something correct and anthropologically extraordinarily essential in this. Yet it has very little or nothing to do with our purely ontic differences, which in a sense lie one level lower; they are more confused than clarified by the reference to this perspective. For in the fundamental, in the ontic sense, a being can really only be placed into its ownmost existence from one side or from one “point.” There can be only a single basis on which existence can become most itself. In this sense, the spirit-being “is” “from above” or from the sphere of spirit, the human “is” “from below” or from its own immanent center. Obviously, you will not understand this determination in a genetic sense. P: No, but in regard to a kind of positing of such a being in itself. {71} M: Correct. And that is at the same time the most important point, Psilander, that you really must hold onto: all of this concerns precisely final aspects of composition; what is at stake is how a being is placed into being in a primary sense. It participates in it from its constitutive foundation of being. This determination is wholly separate from any consideration of where the real “home” of the

74

Metaphysical Conversations

spirit and soul of the human may lie, what spirit one should now permit to govern in oneself positively and so forth. We can neither “strive for” nor “strip off ” the ontic basis; it just is. P: And now you think that this constitutive aspect of being, the fact that we are “placed or set into our own center,” is directly connected with the possession of the soul? M: Definitely. And only insight into this connection will now truly clarify for us the significance and particularity of this constitutive aspect. Let us proceed from a peripheral factor that is easy to see. Could one not say that humans receive in their soul and with it immediately everything they encounter and experience? P: This factor probably would have occurred to me only in a reflection on the nature of the soul. M: But as beings of spirit they surely receive just as well everything through and with their spirit? P: Yes—but they receive it differently with the soul than with the spirit. {72} M: And how do they receive it with the soul? P: That is indeed difficult to determine. M: We only receive or grasp it with the spirit, but with the soul we “experience” it? P: Yes. M: But what does that mean: we “experience” it? P: That you’ll have to answer yourself, Montanus. M: If humans only receive “in spirit” something they encounter, then they are not really “pulled into” it in a personal fashion, right? They remain, as it were, standing outside of it? P: Sort of like that, yes. M: Yet if their soul participates in it or they truly experience it, then it “hits” them in a sense personally? P: I understand. M: Thus, the soul seems always involved in those cases where the human is pulled into what is experienced or is concerned by it with his or her central self. And even far more significant is the reverse insight: humans have a “soul” because and insofar as they are placed into their own center, through which they can receive—through immanently definitive selfhood—world and life in themselves and through themselves. P: With this the circle would suddenly be closed, Montanus… {73} M: Approximately, yes. But much still remains to be done for a thorough examination. P: A being without a soul thus could not take up being through immanently definitive selfhood, as you say?

The Soul

75

M: Very good. And, accordingly, also cannot reply to the world from out of an ownmost domain of the self. P: In joy and grief, in love and hatred? M: Yes—and in enthusiasm and disgust, in veneration and disdain, dedication and aversion, bliss and “abysmal” pain. P: But now it urges me to ask: does not your idea of angelic beings include such love and veneration and dedication? M: That is admittedly an essential question. Obviously love, humility, and veneration can be separated from the idea of the angel just as little as pride and hatred from the idea of Satan. But is it not just as obvious that the love of a being substantially of spirit cannot be the same as the love of a being that is placed into its own center and lives out of its soul? I think right now we must abstain from depicting in its particularity this love of the pure spirit-beings, which should not be confused with a “merely intellectual” and therefore “cold” or “empty” love that would be the mere shadow image of true love. In either case, the ontic basic condition [ontische Grundstellung] and manner of each creature gives a thoroughly particular imprint to all of its expressions, manifestations, and experiences in a fundamental sense. The natural love and natural hatred of elemental spirits would obviously be of its own kind. But we can already see and determine one thing now, Psilander: humans are through and with their soul “higher,” or you might just as well say “deeper,” that is, more rooted, posited more as their own master, than all potential spirit-beings, but precisely through this they are also more heavily weighed down. {74} P: Because they can and have to receive the world and being personally? M: Precisely so. Or in ontic terms: because they are determined in themselves in a central way and with this become “like to God,” but also because they now have to wear and bear personally whatever may happen to them in and through this self, centrally given them as their own. P: Even the human that has been “assumed”? M: Yes. Yet there is obviously a central difference here. The world falls into the soul of empirical human beings as if into a “ground” or “abyss” and remains lying there in a sense; the more cut off, the more abandoned, the more left to themselves they are, the more burdened and heavier. Yet, in the human that has been “assumed,” the soul itself and with and within it everything else that falls on it, is assumed, that is, borne and as if with wings, unburdened of its own weight. {75} P: Thus even the human, or at least in and with his or her soul, can be “of light wings” [leichtbeschwingt]? M: Yes, but now hold firm to the ontic, profound difference. The actual levity [Leichtbeschwingtheit] of substantial beings of spirit depends on this that they themselves—in their constitutive being and nature—are and subsist “from

76

Metaphysical Conversations

above,” that is, from a realm of spirit. Even the elemental spirits are based in this sense in a sphere of “spirit” that has its outer and sensory settling down in the respective domain or element of nature. Yet the potential levity of the human being that has been endowed with a soul consists in this that it can be raised up into the “heights” or beyond itself from within and with this inner center, from which it lives, and accordingly can be unburdened of itself in a particular way. It is fundamentally different whether something is constitutively light and so outside and beyond any weight or whether the constitutively weighty is protected, so to say, via a “counterforce” or a “countermove,” from falling prey to itself and its immanent burden and fixation. Like the weight on a scale or attached to a cord that holds and lifts it. {76} P: But weight remains heavy and does not become light in itself. It only receives a counterweight from the outside, so that it does not really fall. The soul, however, apparently seems able to become “light” itself and in itself. M: Have you not yet noticed that we are here being pursued persistently by an ambiguity of the concept of weight and consequently also of lightness, which comprises the solution to the entire issue? If through and with their soul humans are constitutively “weighty” beings, this does not mean that they are thereby also beings constitutively burdened by their weight. The stone is at the same time immanently burdened and therefore this burden cannot ever really be removed from it, but only be made ineffective through a counterweight. But that humans are placed as such into their own center, for now only turns them into beings truly grounded and rooted in themselves and in this sense “heavy,” weighty, reposing and enclosed within their own selfhood. This centrality and self-groundedness becomes weight in the sense of “burden,” however, only when humans fall into and down to themselves, cut off from everything that might lift them out of themselves. Yet they can be “redeemed” or can redeem themselves from this burdening; and the soul “receives wings” and becomes light in itself, as you said, because it is no longer left to its own unfathomability. {77} P: For example, through love? M: Yes, through everything that makes “free,” as one says. At the same time, the other “weight,” which depends on the simple centrality of being that is constitutive of the human, remains wholly untouched. P: I would not have thought, Montanus, that one could have drawn so much out of my initially very naively advanced opposition between weight and lightness. M: It was really especially fortunate and apt. But let us also consider the reverse side. We saw earlier that the human takes up the world and being with his or her soul and, in a sense, “carries” it, right? P: Yes.

The Soul

77

M: The meaning of this “carrying” is probably just as ambiguous as that of “weight.” P: Carrying will be more of a true “effort” and “task,” the more humans actually fall prey to themselves. M: Otherwise, they could carry it lightly and buoyantly, could take it up and lift it up, as if they were themselves taken up and lifted up, right? P: Surely. {78} M: And just as in the earlier case despite any potential “levity” the constitutive “weight” in the sense of a central self-determination was not eliminated, so in this case similarly, despite all possible lightness or even delight in the carrying, the constitutive aspect of the carrying itself is not eliminated, insofar namely as the human as such—in terms of being and primarily—has to take up the world in and through him- or herself. P: Concerning the world and of being, humans remain always in their own center; might one put it like that? M: Excellent. Humans remain in their own center, regardless of how they might otherwise be situated. Yet they do not simply remain in their own center, but the human, every human, is a center or a middle point, in which the world and existence in a sense “coincide.” P: As one also says: the human soul is the “mirror of the world”? M: Certainly—only this mirror should not be viewed or comprehended in too “spiritual” a sense. For the human spirit itself can also be called a mirror of the world. By contrast, the soul is the locus of the truly living interplay of the world in a personal self. P: And thus also of a quite individual interplay? {79} M: Surely. In the soul of a woman life and being coincide in a different sense than in the soul of a man, in the soul of someone from India differently than in that of a Chinese or a “white person,” in the sick person differently than in the healthy, in the child differently than in an adult, in each single person anew and always again. P: But, Montanus, how does this always uniquely new configuration of the soul happen? M: That is a genetic question and with it we stand immediately before a dark gate. Yet even this question might no longer seem entirely impossible to fathom, once we have managed to grasp and plumb the nature of the soul more deeply than we can do now. But I am still not entirely satisfied on a particular and, as it seems to me, very important point, Psilander. P: Then I will surely be so even less, when you tell me on what point.

78

Metaphysical Conversations

M: Did we not once at the beginning mention that humans live out of their soul as if out of a “ground beyond” themselves? Why did we call it a ground “beyond”? What is “beyond” in this case? P: Yes, I quite remember that this expression pleased me for some reason. But I couldn’t really say why. {80} M: How would you, Psilander, depict perchance an, as it were, “soulless” human being? P: As someone who lives only through “reason” without participation of the sphere of feeling and affect? M: Could not a “soulless” human also be enraged, delighted, dejected, impatient? P: Admittedly, yes. M: Do we not have the same distinction here? Is there not a soulless joy and one that is soulful? P: Let me use an image now to say that soulless joy has not as full of a sound as soulful joy. It is “empty” in itself. But that probably doesn’t say much. M: It does say something. But I want to complete the last expression through another image. Isn’t it as if soulless people in some way “run on empty” within themselves? P: Like a machine running on empty? M: Yes—but don’t put the emphasis on the machine, but on the running empty itself. In someone “without soul” the central self is in a sense not “cranked up”; his or her being, doing and self-expressing does not run through this central self, is not weighted with it. P: This is why everything runs so smoothly, right? Without any friction? That’s also why everywhere the “full sound” is missing that we find in soulful people: for only where “matter” has been “taken along” in a central way can there be a full sound. {81} M: Quite right. But note further that, aside from soulless people of reason, there are also soulless “people of affect.” There are people who represent, as it were, a mere “affect mechanism” and despite all their “inner” resistances, frictions, reactions, and releases are just as “empty” and in a more profound sense “unencumbered” as those for whom everything proceeds smoothly, because without hindrance and solely in accordance with reason. Thus soullessness does not consist in the lack of affect as such, but soulless people appear as if shifted only to their own periphery, as if living only in this periphery. P: But does not the region of feeling and affect in the strict sense somehow stand in a closer relation to the soul than the other region of the effectuating being of the human?

The Soul

79

M: Yes, you are quite right. But if I might indicate briefly how the relationship approximately presents itself to me: the sphere of feeling appears to me almost as the “body” of the soul or as its specifically peripheral self. Just as every external impression is immediately “felt” in the corporeal body, in the same way every “inner” impression is also felt in this “body” of the soul. Yet, as long as the soul is not centrally involved, it remains a merely superficial, a fixed sensing—a mere “stimulation” and a reacting to this stimulus. This region of the specifically sensible experiencing and reacting in no way comprises the soul as a whole—indeed, with it we gain only the “shell” of the soul. And this insight is fundamentally important for every “account of the soul” [Seelenlehre]. {82} P: You have now shown us from a different side, Montanus, why humans who live from out of their soul centrally participate in everything in a special sense, but I do not quite see yet why that also means that with the soul they stand “beyond” within themselves. M: But it is not difficult to show it from the preceding. For although it is a “specialty” of soulless people to be entirely surrendered to the periphery, it seems conversely to lie in the being-constitution of the human as such to have to leave the center continually on account of the peripheral being and doing—in order to “live” at all. Human living out one’s life, taking up the world, working in it, one’s dedication to this or that region of one’s own total being, to the region of knowing, the immediate region of feeling, the region of sensibility—all of that involves a going out of and being situated out from the central self. The soul remains necessarily continually in the “underground,” as the final basis of one’s ownmost being and one’s accomplishing oneself in this selfhood, from which one can always merely go forth, yet which one can never fully take up or take out into one’s existence unfolding necessarily on the periphery. {83} P: But is there not a complete opening up of the soul and a complete dedication of it in certain profound experiences? Is there not also an unconditional resting within it, being rendered into it without remainder? And thereby a final “redemption” from all peripheral demands? M: And yet it seems to me, Psilander, as if it could not be lifted out of its final “rooted” concealment in terms of its being, even through the, psychologically speaking, “full” dedication of the soul or its absolute opening up. And as if a resting in this “abyssal” ground were not finally possible. For in and with the soul we are bound up with existence itself and as such, are in a sense “written into” existence with it. And such a final ground of being cannot—at least for us empirical humans —be unsealed, plumbed, drained fully. P: What do you mean by indicating “at least for us empirical humans”? Is this final withdrawal of the soul no unqualified necessity, after all?

80

Metaphysical Conversations

{84} M: If human existence, in terms of its being, as it is turned toward and going out to its periphery, were not an indissoluble aspect of human nature, Psilander—I do not dare to say anything about this—if it were possible that humans could enter into a purely “immanent” existence, yet without losing their personal nature, then the soul also would no longer need to be a ground beyond and closed to itself, but in this case the human would be able truly and entirely to own it. One could rest in it as the illuminated and disclosed middle of one’s existence, placed centrally into it and moving in pure immanence. But we don’t want to lose ourselves in such mystical possibilities today. Only note the peculiar fact that, now at the end, when we thought we had seized the soul in a quite different sense than initially, it has become a “mystery” in our hands. How strange, how deeply moving is that. With it, we seem to stand so profoundly in being that one almost does not dare to go further. P: If I know you well, that sounds almost as if you had the conviction that one could come even closer to it from some other angle. {85} M: Certainly, one could fix its position and significance in general being and in existence as such more exhaustively on the basis of a truly comprehensive ontology or metaphysics. Especially if it were possible to explain, in its specific sense, the fundamental contrast between “outer” or “exterior” and “inner” or “immanent” existence and being that has continually haunted us. Surely, I need not stress that it is not a psychological but an ontic or even metaphysical contrast. Yet how shall we comprehend it more fully? But let’s leave that for now. It is quite right for that which seems to present itself as a “holy of holies” within our totality of being, to remain veiled in a final darkness. P: You place the soul very high, Montanus. I have never had such awe for my own soul. M: You had better say, Psilander, that I place it “deep”—because through it the human seems connected to being as such in the deepest and innermost sense. Don’t forget: only the human as human needs a soul, so that one is placed into one’s own center and can be a being enclosed in oneself; a “little god” in a sense, a creaturely god: for God as such is “spirit.” But let us end our conversation, dear friend. I think it is already past midnight. P: Just one more thing, Montanus. What about the animal soul? What we discussed really does not fit it. And yet higher animals do have a soul. {86} M: From the basis that we have now gained I don’t think it would be very difficult to strip off the human from our soul and to place animality within it. But stop it, Psilander. You will in all seriousness make me start over again. P: No, I don’t want to do that. For now, I have enough with the soul of the human and the way you’ve loaded me down with it. Take care.

Concerning the Human

81

Concerning the Human 1 The Animal and the Qualifying Source {87} Montanus: Which is easier to comprehend in its decisive nature, Psilander, the human or the animal? Psilander: The human we know from the inside, but the animal only through empathic vicarious experience. Yet, the animal is less complicated and less mysterious. M: It is strange, my friend, but I assure you: the fact that we know ourselves from the inside, adds far less to our ability to uncover our nature’s fundamental structure of being [fundamentale Seinsstruktur unseres Wesens] than one usually thinks. P: Because it is difficult to grasp immediate life when one is looking back on it? M: Because this reflexive look back only allows us to see the little light that experience has opened up in us, but not the totality of being human within which we stand put together. {88} P: Maybe really clairvoyant abilities supposedly slumbering in us might unexpectedly widen the realm of what can be seen directly? M: That would indeed enrich the material knowledge about our being, but we wouldn’t encounter the decisive form of the specifically human nature of being [Wesenheit] on this path. P: On what path? M: On the path of empirical cognizance. Yet what can clairvoyance offer us besides a magnificently expanded empirical realm? P: Which would leave open an abundance of theoretical possibilities of interpretation? M: Yes, that too… that too. We are also searching for something that can be seen directly, albeit something that is of an entirely different kind and thus to be comprehended from a wholly different direction. P: You spoke of form, of matter… M: The human contains more actual dimensions in itself than an animal; that is certain. But that is not what we are wondering about—or, if so, only as a fact. Its possibility or necessity must be grounded in the human’s decisive formal composition of being [Seinsaufbau]. P: Get going, Montanus, get going. By now I’m quite familiar with your way of posing questions. Yet I always find it difficult to perform this turn independently. {89} M: So what about the human and the animal? On which side would it be easier to get a hold?

82

Metaphysical Conversations

P: I have understood perfectly now that the possibility of reflection contributes little to the issue. One must have lifted the human in its totality before the gaze of the spirit. M: Spot on. P: Besides, the animal probably has a simpler composition than the human. M: Certainly a simpler one. The human stands in the center of all being. If we could comprehend the human without remainder, few veils would remain before our eyes. And the animal vanishes. Yet there is something peculiar about the animal for us in our blindness. It is still entirely prey to pure nature, to strange, incomprehensible forces. Being itself engulfs us. We no longer have any distance or measure. P: And the human remains outside these darkest dimensions? Surely not. M: Surely not. But in principle it emerges up from this natural basis and at that precise point we can grab it, at least formally. P: The human governs this entire sphere of the mere possession of drives [blosse Triebhaftigkeit] with self-consciousness and free will? {90} M: Now that is a rather grandiloquent wisdom we are determining here. P: Yes, it certainly sounds like the most banal popular philosophy. But does not the decisive point lie precisely here? M: Self-consciousness, free will, mastery of drives; surely, surely! But we can never start here if we want to move beyond the vaguest of specifications, although we might end there. Think of the gaze of a dog. At times it seems to us as if the animal looking at us stands closely, very closely, at the breakthrough that would make it one of us. That this breakthrough seems all the same fundamentally impossible puts worlds between it and us. Do we want to pacify ourselves with this tormenting phenomenon by saying: yes, like all other animals the dog has no self-consciousness? Where lies the ground, the constitutive ground, for this particular boundary? Why is this small step, this tiny reversal of the gaze back onto itself, so radically impossible? If the difference were to lie in a merely accidentally available ability, why should there not be fluid boundaries, a little bit more or a little less? P: The boundary is absolute? {91} M: Yes, but the point of difference lies in the depths not at the surface. I routinely imagine that the famous horses of Elberfeld will one day “pick up their hats from their hooks” and with a knock on the door indicate to their owners that they’ve had enough of the lessons and that they plan on leading their lives on their

Concerning the Human

83

own terms henceforth.⁶ You are laughing? But surely you get what is decisive in this grotesque image. The spell would be broken. Short of that no calculative feat of any sort could lessen the absolute distance between them and us by even the smallest span. There are obviously also human slaves, for whom such an act of freedom lies de facto also outside the realm of their inner possibilities of life —but in principle it is always possible. They only have to find themselves. But the horses can never find themselves. On what, then, does this being able to and not being able to depend? What is the reason for the animal being irrevocably anchored behind this boundary? P: I get it. But I don’t know how we shall approach this “why.” M: It is not a matter of a leap into the unknown and does not require bold combinations or conclusions. We only need to grasp in clear intuition the point itself, in which the two cases are distinguished manifestly in their very nature. … We said that the human emerges out of the sphere of nature, while the animal remains immersed into it? {92} P: Yes. M: Yet what does this approximate term “sphere of nature” apprehend about the human? And should we say that the same general basis of life is given to the human as to the animal, only that the human is free in regard to it in a particular sense? P: You mean that there isn’t a full animal stuck inside the human, but that the human does have something like a pure animal basis? M: And that the human as human would really only begin at the point where it, as it were, lifts its head internally—a true sphinx, a mysteriously divided nature! Do we stand upright as humans from the very ground of our being or is only the head of our inward being a human one? P: I can suspect what you think about this, given that you’ve always said that the human is made as out of a single mold. And you have often reminded us of the scholastic teaching that there is a single form that determines the whole being all the way through. Yet there is something odd here. I do not know whether the scholastic perspective can do justice to it. One speaks of the battle between animal and human within the human, and certainly one cannot take that in a literal sense. But could the whole thing be simply dismissed with the rationalist indication that the sensory sphere is not classified respectively into or under the rational one… {93} M: O Psilander, if you start having a feel for irrationalities, then you really give me pleasure.

 [A book on the horses of Elberfeld—Die gelehrten Pferde von Elberfeld—was published in 1914, claiming intelligence for these trained horses.]

84

Metaphysical Conversations

P: Maybe I ventured out a bit too far. But every now and then I really have the feeling that our nature is constituted in two layers [einer konstitutiven Doppelschlächtigkeit unseres Wesens]. M: As if simply the mere presence of this specific animal sphere in us were, let’s say, a metaphysical flaw? P: Perhaps. But… M: This is a primordial opposition, which divides mystical wisdom from scholastic, Platonic from Aristotelian. P: And we? What shall we say? M: How should we be able to say anything about this, given that we are starting at a small point to produce some clarity for ourselves? All the same—I think that scholasticism in a general sense, as it sees things, does not reach the deepest point. P: And what about the thoroughgoing undivided being of the human? M: One would discover the synthetic point if one were to stand deeply enough. But let us now resume the thread of the issue itself. One thing is surely visible in either case: that if we were to consider humans in their formal totality, let’s say, within their personhood [Personhaftigkeit], to draw on this essential concept now, then from the ground of their being there is something upright about the human in contrast to the animal. {94} P: The word “person” certainly immediately leads to such a view. M: But how could we grasp this inner uprightness more closely? And how is it connected to that other elevation of the human inwardly above one’s own natural basis? P: Or, maybe more correctly, that our own nature becomes in us a basis, while for the animal… M: Let’s find the right expression now. P: The animal remains stuck in it. It remains cloaked in it, or how shall I say this. M: But humans strip off this covering in themselves and are thus essentially naked within themselves. If you add the uprightness to that, then we have for now two essential phenomena. P: Excuse me, it just occurs to me how in Kipling the wild animals define the human: naked and walking on its hind legs. M: Oh, great, that hits the nail on the head. Is not outer habit a significant symbol of inner constitution? Do you want to regard it as an accident that the human does not look like a bear or a parrot, that we do not run on four legs and do not have fur or a colorful dress of feathers? P: But it certainly never occurred to me that there could be such a thing as inner nakedness.

Concerning the Human

85

{95} M: I wouldn’t know a better image. The animal, instead, remains clothed in its nature. … What do you actually mean by this nature we are discussing here? P: Everything that is operating immediately in the animal and wherein and out of which it lives—sort of like that? M: Yet not as if the animal were only a passive instrument of certain forces of nature that use it or that are placed upon it? In this sense it is not simply handed over to nature? P: In our conversations about plant and animal we comprehended the distinction in such a sense that the animal already possesses its body and thus can truly undertake actions. M: Even if they are always involuntary, if they are called forth by a reactive necessity? P: We saw that. M: We once called the plant “the quintessential being of figure” [das Gestaltswesen katexochen]; maybe we should speak of the animal as a “quintessential being of action” [Aktionswesen katexochen]? P: In distinction not only from the plant but also from the human? M: That’s precisely what I mean. Is not everything turned immediately into action in the animal, everything that drives it and lives in it naturally? Turned into action, thus realized to the highest degree within itself—but precisely realized immediately, with instinctual necessity transformed into the corresponding external action? {96} P: The first is supposed to distinguish the animal from the plant, the second from the human? M: Yes—but what is at stake for us now is a deepening of this second aspect, this second boundary. A sort of primordial spontaneity lives in the animal as in the human—or do you find this way of putting it open to objection? P: Spontaneity? Although the animal acts involuntarily? Precisely spontaneous acting I would assign to the human. M: Voluntary is not spontaneous. When humans act consciously, then they no longer act spontaneously, because they establish a boundary between themselves and this acting. Because for now we put a stop to what wants to break forth from us—spontaneously!—before putting it into action—or perhaps not. Spontaneous is what stems from the final, natural source, thus from the inside… P: I can feel what you may mean. The way in which this source springs “from the inside” is different from what we usually mean by “inside” in the “psychological” sense? M: The entire totality of a respective being’s living out of itself is finally drawn from this—shall we put it like that? P: Although certainly some confusions with this still remain…

86

Metaphysical Conversations

{97} M: Oh, Psilander, not just some confusions. This is the darkest point, yet the one on which hangs all of nature [Natur], if we want to comprehend it as nature at all. We will have to touch on it over and over again. But right now all you should see is that a lack of freedom in acting in no way contradicts this immediate acting from a driving “ground,” the incomprehensible spontaneity—and its decisive characteristic lies precisely in its incomprehensibility. P: Instead both demand and presuppose each other… M: Very true. And only because of this lack of freedom can the primordial living out of itself take on this brute and in some cases demonic form. Yes, one needs to orient and comprehend the demonic in general by this point? P: But there are also demonic humans… there are humans controlled by drives… savages… M: And then you demand an absolute boundary? P: Yes—but this in any case doesn’t seem to be its place. {98} M: Quite to the contrary, precisely here. For, as we saw earlier, the point is not that it might similarly be possible for humans to live only spontaneously, like the animal to move only from blind action to blind action, but what matters is that they can also not do so! The living nature of the animal, however, exhausts itself constitutively in this form. We experience even the most savage humans differently than an animal, because in principle the possibility of this distance between themselves and their acting exists for them—and that is the case because they are beings standing upright in themselves. This is precisely the relationship that we want to pursue further. By the way, considering you reminded us of the Jungle Book: nothing is more ridiculous—as occasionally happens—than to interpret the life of the little Mowgli as a representation of the development of humanity from the animal, compressed into a single life. What’s ingenious is precisely that this little savage, despite his life being so perfectly adapted to the animals externally and internally, is and remains human, from the first second of his awakening existence onward. And that is so precisely via the specific something that we are pursuing. The essential facticity of his humanity stands formally behind every word and every act, regardless of when he finally attains consciousness and the living expression of his humanity. P: But one more thing. By so much emphasizing this unimpeded and immediate spontaneity does not the surely essential fact that the life of wild animals runs on such firmly fixed tracks receive short shrift? For this life seems almost as if knitted into a predetermined course of existence. {99} M: “Even the stork in the heavens knows its times; and the turtledove, swallow, and crane observe the time of their coming; but my people do not know the ordinance of the Lord.” [Jeremiah 8:7] Only humans in their freedom can be dreadfully without discipline—and all the more the further they are re-

Concerning the Human

87

moved from the savage. That is self-evident. But is there a contradiction here? If the sequences of actions that break forth without restraint from the animal, if they did not in advance have within themselves sensible determination, measure, and goal, how would the animal be able to subsist, how would it arrive at an existence capable of life from a chaotic self-devouring frenzy? Is not precisely each kind of animal marked by the specific shape of the vital force of life [Lebenstriebkraft] expressed in it, which is symbolized in its body and grants direction, quality, measure, and pace to its actions? The laws are written into the blood of the animal from out of this force. These laws lie and function behind it, not in front of it—as in the human being. P: Here [are] representations… motives? M: Yes. In the case of the animal how would they be able to restrain the spontaneously effective life of the animal, if they belong to this life itself, are stamped on it by its shape? P: You sound almost as if the life of the animal drew only from itself and were self-determined by itself. Is it not mainly a reactive one? {100} M: Because some specific drive or other, some concrete desire or other is necessarily unleashed by certain external conditions, impulses, sensory impressions? P: Yes. M: My friend, now we are turning in a circle. Do you want to cut off yet again the animal’s spontaneity, the originality of its acting [Urwüchsigkeit], because it is not free? What do you mean by reaction? P: That a specific drive, a specific desire is caused necessarily by certain external conditions, impulses, sensory impressions… M: Thus that the animal responds to this stimulus with a very specific action? P: Must respond. M: Or responds according to nature? That presumably includes the “must”? P: Yes, one can say it like that. M: Yet, what responds in the animal? Or how can something respond when it is not the case that a specific kind of life-tendency effective primarily in the animal is precisely stimulated via this stimulus and is operating in the concrete situation concretely and de facto. What highlights this originality better than this necessarily natural, necessarily reactive responding? {101} P: You are right. I already saw earlier how much each conditions the other. But now I’m really wondering about what you call “primary vital force of life” or something similar. Does something like that exist also in plants? And is it not found somewhat differently in lower animals than in higher ones? Earlier, for a moment, I felt so strongly what you are presumably trying to pick out.

88

Metaphysical Conversations

Wolf and eagle, snake and crocodile—it seemed to me as if with every new animal I was hurled into life or existence ever anew in an original manner. M: Ah, that is good. A mode of existence that is in the final account always differently qualified seems to have become embodied with each species of animal, out of which the ultimate and intimate difference of kinds of animals is drawn forth, a difference for which there are no precise words. P: Should one not say something similar for plants? Plants are quintessential beings of figure, as you said, and animals quintessential beings of action. What is expressed in plants purely in terms of shape in an ever new sense, in the case of animals is embodied in their nature, which they live out vividly through their corresponding actions. I think one could say it like that now. M: Spot on. Jakob Böhme speaks of a “qualifying source” [Quall]⁷ that is expressed specifically differently in each thing or in which this thing, animal, human, or plant “stands in primordial fashion.” That is an excellent expression. For what wells up [Quellende] in it and primarily drives it is tied up in a particular way with what qualifies it [Qualifizierende]. You have now answered your question about plants yourself. But you seemed to have hesitations about lower animals? {102} P: Yes, it occurred to me earlier that it certainly seems easy to experience “snake and bear, whale and crocodile” differently in a fundamental sense—but that does not seem to work equally well for the lower kinds of animals. M: You are thinking of snail and starfish, polyp and jellyfish? P: Yes, sort of. M: And it does seem comprehensible to you in the case of the plant? That is, it makes sense to speak of a uniquely characterizing qualifying source for every different species? P: Yes, but I also see now that the question that bothered me wasn’t whether even lower animals are qualified and fashioned out of a specific qualifying source —why should there be a greater difference in this case than in that of the plant— but whether the lower animals are also to be understood as beings of action in your sense, just as the higher ones? M: If you have in mind what we might call the “demonic” in higher animals, namely this breaking forth of actions from its own soul-middle, in which the animal lives immediately, then you are right… P: Now you have for the first time touched again upon the soul—something I have anxiously anticipated.  [The term used here (and in the title for this section of the dialogue) is Quall, referring to the distinctive source in which each kind of being stands so as to make it the sort of thing it is. The term is derived from Jakob Böhme via Franz von Baader. The closest English equivalent would be the philosophical term “qualia,” but that does not quite convey the same sense.]

Concerning the Human

89

{103} M: But we won’t stay with it right now. We still have a long path ahead of us. We will only understand precisely this difference between higher and lower animals fully at that point. But the very first, most primitive point of difference between plant and animal does lie, as we know, where the living organized being begins to perform actions from out itself—even if they are only completely vague corporeal actions. Admittedly, the animal is still imprisoned in its bodily mass on these levels, is still as if divided among them, although a center of action must surely exist. P: But this center has not yet become that independent soul-middle, which you just mentioned. Have I understood this correctly? M: It is not yet deepened into and back to this soul-middle; yes, we could put it like that. But we would not want to connect genetic or developmental points of view with this formulation. P: I understand. You say that it is as if caught up in the bodily mass. … Is that why all actions remain so particularly peripheral? M: Certainly. P: But what about insects? M: You are right to ask. That is a very strange chapter. For insects almost the reverse seems the case. For them the entire bodily dimension seems practically to be “consumed.” {104} P: In a certain sense the expression “quintessential beings of action” suits the insects especially well, even if in an entirely different sense than in higher animals. Presumably, one cannot really speak of a soul-middle in these cases either? At least their unceasing hustling and bustling, as artistic as it is, has always seemed absolutely “soulless” to me. M: One almost wants to call it their fanatic hustling and bustling, so as thereby to indicate the complete blindness in which it occurs and at the same time to point to the irreversible spell under which they operate and which drives them. Yet even this expression already assumes too much “soul.” They still appear more like way stations for actual and possible actions. No true substantial configuration is accomplished in them—neither to the outside nor to the inside. This skeletal body shares almost nothing with the bodily dimension that envelops the animal and serves as its dwelling. It also has no real inner sphere, in which the animal could be at home with itself. There is only a transposing of the life bustling in it according to laws into the corresponding outer action—and this is an empty transposing that produces neither embodiment nor vivacity at and in the animal. This is why their life is so curiously masklike and grotesque. It is due to this groundlessness and bloodlessness of their inner and outer being. The hollowness of their often so rude bustling corresponds in its very phenomenon to the masklike nature of their skeletal body. {105} P: You give the insects a rather bad reputation.

90

Metaphysical Conversations

M: Bad? Oh, they are highly interesting, these fanatic little peoples. Naturally fanatic, if I may say so. I have never been able to understand how one could ever have searched for something like free consciousness of action in this case. One would have to read the classic accounts by Jules Fabre. P: And now, Montanus? How do we proceed further? How do we get to the human being? M: Ah, you have the goal in view. Just have patience, my friend. I suspect, we may still have to pursue several paths before watching even the very first gates open. Let us return to the “qualifying source”—this is all still very dark. There is indeed one difficulty that should be highlighted right away. What about its singularity in each typical kind of animal and plant? If we place next to each other lion or kangaroo, eagle or owl or goose, then, as you rightly said, we can almost feel it. But it doesn’t always work quite so easily. And even in these cases we must ask: what makes for the difference, in its very root, if we disregard all fashioning, all actual substantivizing, which are indeed only symbol and consequence? {106} P: Earlier I thought I understand you to mean that what is at stake here are precisely final differences in quality, which one can in principle no longer rationally grasp. M: That’s possible—and yet, there are points one must consider and toward which we might venture a little. How far should one push the idea of a final singularity of the substantivizing qualifying source? At what degree of relationship is it replaced by merely immanent differentiation within one and the same sole kind? For example, in the case of the wolf and the hyena or the bee and the ant? P: The age-old question about the factual possibility of grounding orders, genus, species, and so forth. M: Yes, that old question. But at the moment we are not interested in firm determinations or systematic specifications, but only in feeling out certain aspects. There is something curious here that has, in fact, emerged as a phenomenon fully only because of modern research in natural science. It has dissolved or wanted to dissolve almost all absolute boundaries, all so-called “scholastic” boundaries. You are aware that this attempt is completely absurd philosophically in the cases that concern constitutive formal limits of being. Even if there are always beings that precede the differentiation of animal and plant, even if it may be possible for these to mix de facto in particular ways—the radical opposition that, as I said before, depends on the ontically formal, cannot be touched even tangentially. We agree on this. Yet in this case—in the realm of the animal, in the realm of the plant as such—the formal framework is constituted and must now, as it were, be filled in qualitatively: are there always new and newly “primordial” qualities? That is, are there full qualities that determine the entire being of the type of animal in its substantial fashioning?

Concerning the Human

91

{107} P: The biologist thinks that the entire configuration of an animal species is determined in a specific manner through the surroundings in which it lives or where it lived when the presupposed shape was fixed. M: Indeed, Psilander, one encounters grotesque things here. Each species of animal is only determined to preserve itself, to assert itself in existence in terms of its life—this insight has already become so trite today that one begins to look for something else. Yet, what if one now really sees that the fashioning of the species seems to follow this law all the way into its apparently smallest contingencies? That is, can they be understood in terms of the necessity to adapt precisely to these concrete conditions, just in order to exist? In that case one wonders: what is it that really wants to maintain itself at all costs? And one asks in vain. For precisely in its specific fashioning, the species is determined by this necessity of adaptation. Everything is turned topsy-turvy here. In order to activate the organs of reproduction and nutrition, the sensory instruments, the whole bodily habitus in a specific manner within its possibilities, all of that is present in its particular manner not because of a specific species [Spezies] that always has to be presupposed and that has to be preserved as such. No, the species is present because of this complex of possibilities of preservation. Or, more precisely: it is the result of configuration of just this and no other particular manner of preserving itself in existence—with plants in the shape of mere formative beings, with animals in the typical being of action. {108} P: Now you appear to want to follow the opinion that constructs everything rationally from the outside. Yet so far you spoke of almost creative and immanent sources of substantivizing—I don’t understand anything anymore. Where did the “qualifying source” go? M: Might you be paying homage too quickly to an either-or position, Psilander? There are always syntheses, even if they are maybe not where we look for them. In this case surely something has to be present that fashions itself adaptively or adapts in fashion. Something must have the drive to substantivizing and preserving itself in existence… P: According to science it would be the animal species that is in each case less well adapted… M: And at the very start those primitive one-celled beings, although no one knows where they come from. To be sure. Whatever. All the same it still seems curious why the development in this case remained on the lowest level, but in other cases achieved highest complexity, why there are all these many peculiar dead ends with all their infinite branches, in which the realm of living beings is forced into ever new configurations and where it tapers off blindly at all ends—just not in the one that leads to the human. {109} P: Dead ends?

92

Metaphysical Conversations

M: Yes, for from the highest standpoint one can ultimately use that term for all these curious attempts to substantivize itself in existence and preserve itself by substantivizing. Whether that is in the shape of a “sponge” or a “crab” or an “ant” or a “snake.” I think Bergson also sees it like this. What gave the impetus in all of these cases to become more complex to this degree and in precisely this direction? What provided the occasion for this specific species to develop in these narrower surroundings and a different kind in another one when the surroundings are generally alike? Are you really prepared to see here again everywhere only mere happenstance or external conditions? Really, one day the relationship might turn upside down, as Uexküll says, even if in a slightly different sense, so that the surroundings don’t create the animal, but the animal its surroundings. Or, better, and employing our own formulations: that, driven and led by the qualifying source that works in it and drives it to bodily configuration, the substantivizing being “chooses” these narrower or wider surroundings, settles into precisely those surroundings, adapting to them, in which the vital impetus, the vital range, the intensity of life, the “temperature,” the mobility of its source of life and configuration, or whatever one should and could call this, achieves specific satisfaction of configuration. In that case the surroundings and the final shape would similarly turn out to be adapted to each other precisely. And the species could be explained in its particular actual manner similarly entirely out of the drive not only to preserve itself in material existence as a consequence, but first of all to substantivize itself, settle into, and form itself into it in bodily and thus essential fashion. {110} P: Now I begin to understand a little where you are headed. You want to provide a foundation of some sort for the living, material configuration as such and all its countless appearances and modifications via a pure and, as it were, general “drive” that would precisely gain shape within material existence? M: Oh, yes, you got it. Only that isn’t a thesis or assertion or perspective, but simply a little tentative attempt—suggested by a plenitude of obtruding phenomena. This is less a strict analysis than a more roving conversation. You just said “of some sort”—and this formulation expresses precisely what is important: this merely primordial striving to embody itself into the essential existence as such —which is effectuated in the same way in each qualifying source and in which consists precisely its real, its everywhere shared being. Each material entity thus develops into a specific and quite direct manifestation of this longing for configuration. {111} P: This longing for configuration or striving for embodiment or substantivizing as such? M: One could say it like that. And the differences? The plenitude of infinitely manifold appearances?

Concerning the Human

93

P: You spoke of the differences of energy, of speed, of impetus…? M: Of passion, of measure and extent of striving for expression—this is precisely where these final and finally inexpressible differences come under consideration. In what sort of metaphysical depth they may lie—how far the differences in configuration accordingly may depend on the preliminary and peripheral, on the outer conditions of configuration, on hindrances of configuration and that sort of thing—here our vague groping comes entirely to an end. But do you know, Psilander, why we have sketched it like this as a kind of experiment? P: We were concerned with the qualifying source and its nature… {112} M: And with the possibility of its differentiation, with the possibility of a final difference in quality, which then has become embodied and come alive in the totality of the configured. An essential something in nature—the infinite transitions, what is accidental in configuration in all of these appearances passing each other or striving up with their infinite modifications—seemed to us to speak against ever new primordial qualities, conclusive in themselves and applicable, which would bear the respective configurations so to say a priori and prefigured in themselves. And, conversely, every configuration bears its own singular stamp of quality going all the way to its roots. We will have to investigate further these two phenomena, which first turn nature into nature. But that will force us to break with scholastic notions at an essential point. A fundamentally different impression of nature suddenly sets in here. P: Notions with which one actually broke everywhere long ago… M: And yet to an extent and sense that is not at all justified, and among other things has also entirely erased that second phenomenon, namely the phenomenon of the qualitative sovereignty of each shape—as one might call it. This latter phenomenon simultaneously encompasses the intuition of the substantiality of nature: that everything natural contains the source of its being in itself and depends on its own roots of configuration. This notion, which supports the entire scholastic view of the world, is, in fact, of the highest significance for each real [reel] and essential intuition of nature. It alone returns to nature its living-creative potencies. {113} P: Creative? But surely for scholasticism God is the creator of each thing? M: Don’t confuse transcendent and immanent creation. God places each thing into its substantial source that henceforth nourishes, constructs, and protects it within itself. God creates it and maintains it in its substantiality; but once it is created and sustained, it now stands within itself on its own ground. To have recognized these two aspects as essential and not contradictory is precisely the particular merit of the scholastic spirit. P: And the boundary? It has escaped me again… M: If natural entities are seen and comprehended as essentially isolated in quality, as a priori configured natures [Gestaltswesenheiten]. Yes, a priori config-

94

Metaphysical Conversations

ured natures, this expression seems descriptive. Then everything evolutionary, transition, accident, experiment, the roll of the dice, the partially or not in the least “successful” no longer has any real place—regardless of how it is introduced. It depends on the spirit of the matter. In this case the natural entities in their fullness of appearing finally lose the aspect of a certain “indifference,” namely the aspect of being a more or less (and their connectivity is expressed in this!) successful result of a single, huge life desirous of configuration. Then nature becomes, despite all substantiality of being, finally a… museum. {114} P: And creation? M: I do not think that the [divine] fiat, the “let there be,” the opening of sources, or however it is necessary to express oneself here, would lose its founding place. But this is where metaphysics begins. And it seems to me, my friend, that we have already theorized a lot today. We should return now to simple analysis, as is appropriate for phenomenologists. Although—I fear, I fear—precisely this might ultimately drive us into the arms of metaphysics. If you are agreeable to this, we’ll continue tomorrow and try to track down the human.

2 Demons and Angels, Spirit and Spirits {115} Montanus: Well, my friend, how shall we begin? Where shall we pick up? Psilander: When I thought about it later I noticed that we spoke yesterday always only of living entities of nature. What about the dead ones, which after all make up a constitutive part of this nature [Natur]? M: Something like gold and coal, water, sulfur, and salt? P: Yes… stuff of that sort. M: And why should we have talked about them, given that we wanted to work on animals and humans? P: But if I understood you correctly, then it seemed essential for a natural entity to draw on its own inner source—or whatever phrasing you were using? M: That it stands forth primordially within its own substantivizing qualifying source, which makes it what it is? P: Yes. But that only applies to living beings, does it not? M: All the way down to the plants? P: That’s what I would have thought. M: Must and can we not also speak of the qualifying source of gold, of the qualifying source of water? {116} P: But where does that leave the boundary between the vegetatively alive and the materially dead? Especially you, I would think, would want to respect the boundaries of kinds between them on any condition.

Concerning the Human

95

M: Obviously we would have to do that. But were we not also able to hold quite firmly to the boundary in kind [Wesensgrenze] between animal and plant—yes, did it not only become fully clear in the different formal relationship to the substantivizing qualifying source in each case? P: Inasmuch as it operates in the plant only by giving living shape, but in the animal… M: … is actively lived out. P: In both cases it concerns a living working of this qualifying source into the respective entity. How could that be the case for dead matter? We would really have to comprehend them also as a kind of vegetatively alive. M: So, you would say that the qualifying source works into the plant in a living manner? Or maybe, better, that what is particular to vegetative aliveness consists precisely in the qualifying source working itself out in terms of form and within the material, that it creates a bodily expression for itself in a specific kind of figure? P: Perhaps something of the sort. M: And you would deny to “dead” matter precisely this immediately formative working into and working out of a living substantivizing ground? {117} P: They are what they are—once and for all—on the grounds of a specifically shaped constellation of dead forces. There is no growth, no formation from the inside, no individual or genre-specific self-maintenance via regeneration and reproduction. M: All signs that the qualifying source has found a self-owning locus in the respective vegetatively living entity, that it not only has manifested itself in bodily fashion once and for all, but—seemingly dwelling in it—works in continuous actuality from out of it or into it (or however one wants to describe it)? P: Oh, now you have unexpectedly brought in a difference that might be essential. In dead matter the qualifying source does not possess a self-owning locus, from out of which it always effectively works… M: And yet could it not still be the embodied result of manifestation of some grounding qualifying source or other, some qualifying source or other desirous of configuration? Even for them? Only precisely in the form of results of configuration that are once and for all set down and substantially fixed, as you said? P: But surely this would not touch on the difference in kinds between dead and living. M: Yet? {118} P: I don’t really see how this way of looking at things can be reconciled with the chemical-analytic results of science. And with the transformation of one element into another…

96

Metaphysical Conversations

M: Chemistry determines very interesting laws of order and composition and substitutes corresponding forces and potencies for them. Yet could not the very specific law of composition of a physical body [Körper], which is fixed in a specific constellation of forces and as such may be secured, have still other grounds than accidental coincidence of just these potencies? Is not each time something essentially configured expressed in water, in lead, or in sulfur? Something that has reached embodied manifestation? P: Even I have a vague consciousness of this. M: Yet even in this case there surely are no configured natures that can be posited always anew a priori for themselves. Here, in the realm of matter, last of all. Beyond all of the ascending and descending, the crossing lines, the always new “experiments” and “rolls of the dice” in the same or in different directions. Final specifications about the form and manner of materializing itself into or fixing itself into existence; but taking this pure “striving for configuration” itself as general basis of manifestation.⁸ Oh, we could say a lot of concrete, singular, and illuminating things about this. But we should not lose our way. It almost looks as if your question did not get us into our topic but rather got us out of it entirely. And yet there is at least one sufficiently essential aspect here. Have we not discovered in our leaving the animal for pure matter an ever new relationship to the qualifying source that could be grasped formally? In the animal it became self-owning, was lived out actively, in the plant it worked itself out in a living and effective manner, even though the plant presents merely its manifestation of configuration. In pure matter, however, it no longer seems to be personally present or at home, although it may well count even here as final foundation of configuration. {119} P: As if the relationships were to become increasingly more “internal” as we move up. M: As if the qualifying source were becoming included increasingly more fully into the being and living itself out of the respective entity? P: Something of the sort. M: Or as if the respective entity were becoming always more fully its self-owning proprietor of the substantivizing qualifying source? Could one put it like that? P: In the case of matter it is still entirely transcendent or therefore unreachable, in the case of the plant already immanent, but in the case of the animal… M: It is immanent to the plant, but the plant itself remains outside the qualifying source; it remains passively handed over to it and to its striving for configuration. In the animal the qualifying source is not just immanent, but the animal is also immanent to the qualifying source within the animal.

 [None of the preceding phrases are complete sentences in the German.]

Concerning the Human

97

{120} P: I haven’t quite understood that… M: Not only does the qualifying source “dwell” in the animal in a self-owning manner, as it dwells in the plant, but the animal as such also dwells in the qualifying source. Has not a most particular breakthrough occurred here? Has not the substantivizing ground come to the surface of existence? So far it has only worked in a fashioning and configuring way from the depths; has it not now— with the animal—gained an active seat and voice? P: The animal draws in its reactions and its spontaneous acting immediately from the qualifying source that is at work in it—could one put it like that? M: Certainly. Yet it is just as important now to emphasize that via the qualifying source it is pushed and forced to the specific actions and reactions immediately. The animal is as if drowned into this life that is actively at work in and through it. P: Now we have reached earlier specifications. Earlier we said that the animal remains immersed in its own nature and wrapped up in it, now, that it is as if “drowned” in the qualifying source at work in it… {121} M: But I think we have now gained a somewhat deeper characteristic. The animal is still as if drowned in its own qualifying source, but the human is redeemed from it. The animal is still buried in the depths or the unfathomable deep of its own interiority, but the human is raised up. The animal still falls prey entirely to the dimension of the demonic, but the human participates in the dimension of the “angelic”… P: Those are surely new concepts. M: I pronounce them hesitatingly enough. I certainly do not want to turn the animal into a demon or the human into an angel. Both would be quite false and the latter also grotesque. P: At best one could call the human a mixture of demon and angel? M: It would be better to say: out of the demonic and the angelic. Yet even that would still be quite doubtful. But it would be good, Psilander, and highly interesting, if we could examine this opposition more closely. Is there not an ontic opposition here as it cannot be thought more acutely? P: So far I do not yet quite see what you have in mind. And if we had not already once spoken about angels… M: Then you would think again that I am making fun of you. P: Perhaps. {122} M: But you did follow me to this point, that in the animal, especially in the higher animals, the specifically demonic might manifest itself in a particular way? P: At least I can sort of imagine what you mean.

98

Metaphysical Conversations

M: Should we not be able to grasp it more closely? Did we not mean by the demonic something that in either case belongs into the “depths,” into the subterranean, the lower regions? P: What lies beyond the given, beyond empirical nature? M: Inasmuch as it does not work into it. But you are right: according to its own dwelling, its roots, it lies beyond nature. But everything that is above the earthly, what is in the heights, also lies beyond it. P: And this does not mean a factual or local difference? M: The local, maybe not in the crude spatial but in a metaphysical sense, is the consequence, not its foundation. In between, however, lies the specifically earthly —the given empirical nature, as you say. Why, then, do we call the netherworld “subterranean” in relation to nature? P: If it is that which founds everything in life—and in fact that’s how it seemed so far—then it should maybe not be all that difficult to understand. M: You identify the demonic without further ado with the qualifying source? {123} P: Doesn’t one have to do that? All the same—I did so unintentionally. M: Yet in the plant for instance or even in water, we find almost no trace of the demonic, even though we spoke here also of a distinguishing qualifying source. In general, almost only in the case of the higher animals do we brush up against a trace or hint of this. P: Thus only where the animal possesses its own center of life and experience, from out of which it acts… M: Where really the qualifying source has first broken through to open and free efficacy. This is precisely that which can speak to us out of the eyes of an animal in an angry or imploring, a greedy or subdued manner, and always in this particular quivering muteness. And sometimes it expresses itself in incomprehensible actions of power and force. But even in those cases it still remains ultimately bound, ordered, and fixed, which hinders the free manifestation of the demonic in its nature. P: Accordingly, there seems to be an opposition here. There cannot be anything demonic where things are bound. M: Yet it is also true that there cannot be anything demonic where there is freedom. Is not the demonic what is specifically unfree? P: An ambiguity of the expression “freedom”! M: Quite right. The lack of freedom of the empirical entities of nature is not the lack of freedom of the demonic. {124} M [P]: The lack of freedom of the demonic does not contradict the lack of boundedness, but the empirical lack of freedom does. M: Is it not precisely a decisive characteristic of material nature to be fixed into specific figures and into the same determined courses of existence? This is

Concerning the Human

99

not what turns nature into nature, but what makes it a material, an empirical nature, a nature manifesting in sensory fashion. P: What turns it into nature lies precisely in the participation in the dimensions of depth, in the dimension of the demonic? M: Great, you have understood. Only that the demonic stops being demonic precisely at the point and as soon as it is configured into, substantiated into, and fixed into specific figures of nature. Or, rather, one cannot even speak of the demonic in those cases where it lies already in the determination of driving and qualifying life to preserve being and stability in fixed formations. P: Thus, one can speak of the demonic only where it can work itself out freely? M: So, what does “free” mean here? P: Not to be fixed, not to be configured… M: Not to be substantivized. But how can we form a better notion of it? The substantivized is that which is truly worked out within itself as what it is and so has gained embodiment and stability. What has not been substantivized, what is thus still shapeless… {125} P: Is the “hollow”… M: Sometimes you have very apt images that can only be felt in their significance. Must one not positively identify this dimension with the hunger and the greed for substantivizing and becoming bodily? P: You already once before mentioned this greed, namely as in vain, when we touched on the figure of Lucifer. M: Yes, only in that case we are dealing with a fallen angel, thus with a being that is rooted in the dimension of height in its substantiality of spirit, a being that lost its standpoint and thus its standing and now wants to gain back standing and being violently on its own. Lucifer does not belong into the dimension of the demonic, even if he has become the self-evident lord of all demons. Yet in this dimension of depth we are dealing with what on its own account or “according to nature,” within itself is life greedy for configuration, because it lies precisely before all configuration or assuming of being. Pregnant with the chaotic fullness of any conceivable qualifications, it yearns to express them in manifestation and effectuation. The demons are born here, in chaos. P: All the same they are figures [Gestalten]? {126} M: You are right and that does not seem contradictory to me. They are and become figures and thereby real demons, as long as they are posited singly for themselves and receive a personal seat and personal voice within themselves. But the figureless is precisely “figured” in them; they are quintessentially non-be-

100

Metaphysical Conversations

ings [Unwesen katexochen].⁹ And, Psilander, should not their particular power, the irresistibility of their reign, where it announces itself, precisely rest on this constitutive drive toward effectuation, substantivation, and figuration, wherever and however? Their brutality if hindered or resisted, their persistence, is the brutality and the persistence of a life greedy for configuration as such. P: It also seems to me now that their lack of freedom rests on this. For surely what is shaped out of primordial life, cannot do otherwise than follow this primordial life. M: Very right. They are obsessed with themselves, just as, in turn, a human or an animal can be possessed by them. Yet, Psilander, this is something other than the animal itself, as we said earlier, or the human having demonic qualities. Do you understand? P: Yes, but how is such a real being-possessed possible? I have no notion of this. {127} M: Nowadays people have not much of a notion left of such things. But must not the demonic throw itself greedily on every “empty space” that shows up somewhere within the substantial world and its configurations? Where it can force its way into them and make use of their embodiment and capacity for expression, where it may force its way onto the surface of existence through the human or the animal. That’s how I would imagine that sort of thing. P: What does “empty spaces” mean? M: Where no full embodiment of its own, of natural life, exists or still exists constitutively or developmentally or through conscious self-emptying. As is well known, self-emptying, de-substantivizing is not only the first step to perfection in the mystical sense, but also the now dangerous basis for the breaking in of “subterranean” powers. Woe to someone who is not prepared. The materiality of the world, its being weighed down and fixed in this, is not just a hindrance for the lost elevation into the spiritual, but at the same time serves for those uprooted as protection against being swallowed up by the demonic powers of the abyss. This is approximately what Franz von Baader says. But now, Psilander, how do we find our way from the depths to the heights? P: From the demonic to the angelic? You spoke of a radical opposite. M: A polar opposite, yes. Is it not as if we were rising from lack of freedom to freedom, from darkness to light, from the chaotic figureless to the majesty and strength of figure? {128} P: Those are characteristics… images…  [The term Unwesen literally means un-being, un-nature, or un-essence, but is employed to refer to spirits, ghosts, or apparitions with the implication that they do not have full being in the proper sense. The term is also employed in the expression sein Unwesen treiben, which is used later and means something like “wreaking havoc upon,” “causing disturbance,” or “acting nefariously.”]

Concerning the Human

101

M: We will first have to work our way toward the root of the opposition. Are we not rising up into the realm of the spirit? P: Angels are spirits… M: Yes… at least they are spirit-like in being. P: But… aren’t the demons also spirits? At least I would always have thought that they belong into that category. M: And accordingly they are not a worthy subject of examination for a contemporary person? P: Oh, Montanus, you know well how much you have already pocketed me. Whether one believes all of this or not—I know you do believe it—in either case unfathomable insights arise from it. M: Our demons are then also spirits—spirits “of the depths” so to say. P: In any case, at least the way one talks about them, they have the capacity for linguistic expression, self-consciousness, intelligence? M: Because they announce themselves in whisperings, in good and bad commands.—Or, for example, those possessed by demons who address the still entirely unrecognized Jesus of Nazareth as the Messiah and Son of God? P: For example. M: Are humans spirits because they have intelligence? {129} P: No. But surely it means that they have a spirit. M: Maybe that is not so simple either. Yet right now we are searching for the aspect that makes us call demons—in distinction from humans—spirits. P: It almost seems to me as if it were connected with their disembodiment [Leiblosigkeit]? M: With the lack of a material body [Leib]? P: Yes. M: Because they are, as you said earlier, “hollow,” without being [wesenlos], without any true substantiality? P: It almost seems to me like that. M: So, what makes up their most proper nature is precisely involved with this and this is why they have this insatiable hunger for configuration and effectuation. P: Even popular belief claims that spirits are phantoms, that they don’t have any real reality. M: The spirits that show up on occasion, you mean? For example, the spirits of the dead that gad about at the places of their earlier life or in the church cemeteries? Namely [in those cases] when they cannot detach from this existence, because they are tortured by the memory of some crime or whatever. P: Yes, I meant those kinds of superstitious notions.

102

Metaphysical Conversations

{130} M: Here, too, what would turn them into “spirits” would be, in fact, their de-substantivizing occasioned by death, the dreadful lack of an effectuated body for their unsatisfied appetites? P: That’s what I was imagining. M: But, Psilander, do we not also talk about God as spirit? You look at me a little puzzled and that is a good thing. For God surely must be the one being who does not lack substantiality or being really there in body [Leibhaftigkeit] in any way. P: Truly I am somewhat confused. M: And should that not be precisely because God is absolute spirit? Or at least [that a notion of God] would be impossible without this presupposition? P: Total substantiality? M: Yes. Is not total and free fashioning and realizing of one’s own being impossible to all material things, precisely because matter… sets boundaries? P: It now seems that way to me as well. And yet it appears to be precisely the opposite of what seemed evident to me a moment ago. M: The exact opposite. Earlier a spirit seemed to become a spirit through the constitutive or somehow conditioned inability to embody itself and gain actual shape, but now precisely in and with the possibility of absolute substantivation. What do we do now? {131} P: I don’t know. M: Well, we will have to pull ourselves together and look more closely at what “spirit” is. … Perhaps one should begin with something quite distant and in a sense only analogous. Do we not also speak, Psilander, of the spirit of a type of flower that arises from it, of the spirit of a region that delights us in a particular manner? Can one not also say: let us hope that the spirit of this landscape does not oppress or cramp you? Or: the spirit of this symphony or of this cathedral is an elevating and finally liberating one? P: Well, surely all of those are just analogies. M: Maybe… maybe not. In any case, there is something in the matter that permits us or challenges us to employ this expression. What is that? P: One also says: the atmosphere of this region or the mood that lies over a landscape… M: But in precisely the same sense? Is not the mood somewhat less, something more superficial than the spirit? Even if in general mood and spirit may correspond qualitatively to each other? P: If the spirit of a landscape is oppressive, so its mood is also oppressive? M: Yes. Yet surely not always. Could one not say on occasion: the spirit of this landscape is an essentially elevating one; but today a dreary mood pervades it? Or: This animal has a wild spirit, but today it is out of sorts?

Concerning the Human

103

{132} P: Mood is something more accidental, but the spirit is connected to the nature of something? M: Maybe so. P: But Montanus, would you posit the spirit of an animal to be the same as the spirit of a landscape or a building? M: We do not want to posit but to search. Yet indeed could one not say even for the case of the animal that an impersonal spirit holds sway over it or speaks out of it? Just as in the case of the cathedral, the flower, the region? P: Surely one cannot say in the case of the flower that a spirit “holds sway over” it? M: But in the case of the animal and the symphony? P: Yes… maybe because there is something happening here. The animal acts out of this spirit; the symphony is fashioned from it and composed in it. M: So, a certain spirit also “holds sway over” the landscape or the cathedral… P: But in this case the aspect of setting something in motion is missing. Why does it work in this case and not in the case of the flower? It’s almost as if there is not enough “space” in it… M: That is good… not enough space. It is too single-layered. A certain spirit can only “speak” from or “lie above it”? Is there not always, Psilander, a sense of something hovering here? {133} P: Something rising up, weaving back and forth, holding sway in this sense, yes. Yet those are material images that can lead us astray? M: If the image can be applied to the matter at hand, then it signifies something. Incidentally, all such expressions have a material sense and… one of spirit! And the second might be the primary one. One only has to get to the core nature of the images. So what about this hovering, weaving, and holding sway? We have a characteristic aspect, but not the thing itself. P: I’m just thinking about why a certain spirit may speak out of a house, even one that is uninhabited; why a spirit can hover above it; yet this cannot be the case for a… chair. At first it seemed to me that this is possible for a house, because just like the symphony and the cathedral it has been created from the specifically fashioned or oriented spirit of an artist or builder. But a chair can also be created under the guidance of an artistic idea. M: Thus, it depends not on what lies behind the matter, but on what goes into it? Or maybe better, what comes out of it? P: The chair is too “dead” for a spirit to speak out of it. But the house—is it more alive? It’s strange, but it almost seems like it. As if the house could breathe, but the chair couldn’t.

104

Metaphysical Conversations

{134} M: Now you have inadvertently used a marvelous specification that has very broad bearing. Only what breathes can develop spirit, and everything that breathes, develops spirit. P: Such a bold conclusion was actually very far from my mind. Breathing—can breathing mean anything other than the real breathing of animal and human beings? M: You yourself spoke of the “breathing” of the house a moment ago! P: Yes, but that was purely allegorical… vague… M: Obviously the house does not breathe in the material sense of the animal, not even in the substantially alive one of a plant; for it is surely not a living being in this sense. And yet there has to be something that provoked you to speak like this. You had certainly a clear phenomenon in view. But let’s leave the house to itself. Let us pick out what you sensed or maybe only believed to sense—this particular, living “dwelling” [wesen]¹⁰ in itself, this inner movement of life, what must be proper to everything, what we want to comprehend in the characteristic of a spirit speaking from it. {135} P: I especially like the expression “dwelling” here. That’s what it is: an inner, a vivacious up and down in one’s own embodiment encompassed with itself. That’s also what I meant with the image of breathing. M: And I wouldn’t know anything that could be marked more really and more originally with this expression of breathing than precisely this. Cannot only something that “stands primordially in its own qualifying source” actually breathe in a real sense? P: Something that draws its fully effectuated being from its own qualifying source? This is what we said earlier. M: It is “embodied” [geleibt] always anew in itself, out of its own root, through its own inner movement of life. This is precisely the “breathing up and down” of which you spoke earlier. P: One need not discover or sense any of it materially—as one also does not of life itself? M: Quite right. It is precisely the “movement” of this life itself. P: Yet how one should now proceed from breathing to spirit is not really clear to me yet.

 [Here and subsequently wesen is used as a verb in the sense of “to be,” “to live,” or “to dwell,” an antiquated form Heidegger will later also employ on occasion.]

Concerning the Human

105

M: Does the pure meaning of the word signify nothing? Is not the very point of the matter symbolized in it? Does spiritus not mean “breath”?¹¹ P: I see no spirit in breath. {136} M: Because you immediately comprehend breath [Hauch] in a material sense. Yet, Psilander, when you are walking through the woods and can almost feel the “spirit” of this forest: is it not as if the forest were exhaling its particular, its substantial nature and you inhale and experience in spirit precisely this “air” as its spirit? P: With your formulation “as if it were exhaling its substantial nature,” I think it has suddenly become clearer to me what you mean. I took even this “breathing” [Atmen] still in too material a sense and thus not sufficiently deeply, not essentially enough. It is quite right: in such instances one has the feeling as if the nature of the thing [das Wesen der Sache] were once more stretching itself freely around it… M: The nature of the thing, which on the other hand is configured and embodied in the fixed structure? P: Yes. M: Should one not be able to place “to body” [leiben] and “to spirit” [geisten]¹² next to each other as two different manners or forms of substantial effectuation? P: “Embodying” would refer to the form of fixed effectuation, “spirit” to the unfixed one? M: We might say it like that, at least in preliminary fashion. P: You mean that everything that is substantiated out of its own root, accordingly at least all entities of nature, must possess body and spirit in this sense? {137} M: Allow me not to answer this immediately. What about the demons, Psilander? Did we not say that it belongs to their nature that they cannot get to the substantial on their own? P: Yes. M: And what does that mean for us? P: That in their being they cannot effectuate or fashion themselves, cannot act in body, to employ the new expression. M: And also not “act in spirit”? P: I don’t know…

 [The term for “breath” employed here (Hauch) is different from the one employed so far for breathing (Atmen). Atmen refers to the biological activity of breathing in humans and many animals, while Hauch refers to a lighter exhalation or a breath of air, a light breeze.]  [The words for “body” and “spirit” are here (and subsequently) used as verbs, i. e., “to body” and “to spirit,” which unfortunately does not work in English. When possible the formulation “activity of ” or “acting in” body and/or spirit will be used to mark the verbal nature of the terms at least on some level.]

106

Metaphysical Conversations

M: Oh, here lies a difficult, ambiguous point. Can we not talk about a specific kind of “spirit” that speaks out of some demon or other? About an evil or good spirit, maybe even about a sweet or fierce spirit, a gentle or wrathful one? And do they not all have in common what one might call the “spirit of hunger”? P: In being driven to substantivation? M: Yes. P: Aha! M: Yes. But precisely a spirit of hunger! Is this the same spirit as the one that is “exhaled” or spread out over and around the living entity in its fullness? P: One almost wants to refer to all of the demons and even to this spirit itself as “hollow.” {138} M: And quite rightly. Does not their spirit, as regards its solidity as it were, have the same lack of being as the whole being? P: But, Montanus, it seems to me that it should only matter to us whether there is also something like “spirit” here and on what it depends, not whether its spirit is constituted somewhat differently than that of other structures. M: That is right. Yet its unrealness [Uneigentlichkeit] is here precisely so thoroughly determinative for what it really [eigentlich] is. And that’s what we are looking for. It’s almost as if it could not unfold itself here as such. As long as the demon lives and “dwells” [west] out of itself, even if as a ghost [Unwesen], even if unfigured and unrealized though still “fashioned” as a “being” of a certain kind—you recall that this “contradiction” became precisely the decisive characteristic— then it also elevates itself necessarily in itself to a spirit of a specific kind. Yet insofar as it does not really elevate itself to itself, because it cannot reach itself, but is only chased by the life that qualifies it and is as if obsessed by it, but does not possess it and rest within it as possessing it, then even the spirit it “exhales” cannot achieve real spread [Breitung] and a substantiality that freely offers its being, which would belong to it as such. Just as the whole being hungers for itself, for true beingness [Wesenshaftigkeit], so its spirit hungers for itself, for true “being of spirit” [Geistigkeit]. {139} P: Just now you used several formulations that make the nature of substantiality and being there in body [Leibhaftigkeit] far clearer to me. Namely that the demon is only “chased” by the life that qualifies it and is as if obsessed, but “does not rest within it” in a possessive way. Suddenly I saw before me in some sense the development of body or of the bodily effectuated being. That this qualifying life is now no longer “behind” the corresponding entity, which—driven by it —it cannot gather to and up to itself, but is henceforth elevated to it and, set forth from it, fashioned around it in its fullness. Thus, it now possesses it and rests in it —in the body of its being.

Concerning the Human

107

M: Psilander, please hold on to what you have now. It is maybe one of the most important points there are in the constitution of being. For now we can see the activity of body and of spirit develop at the same time and with the same necessity. In order to reach substantiality in one’s own being, is not a first movement needed that consists precisely in this turn-about, or whatever one should call it, that you just characterized so happily: the freeing of the self from the thorn of the chasing and hungering life and the elevation above it, which at the same time now makes it possible to pull this qualifying life close and up or to posit it up and out to free unfolding. {140} P: I am somewhat unsure what you are talking about now. Is all of this only an allegory, an image? Have we here turned genetic what should be understood in terms of being? Or should one consider each thing as “developed” in this sense? But would that not amount to a self-creation in every single case… you used such active and sovereign formulations. M: Let us not touch on final points too crudely, Psilander. Yes, we are just speaking in images, yes, relations of being are meant first and foremost, but they may well point to a metaphysical genesis in a sufficiently characteristic manner. And as concerns the “sovereignty,” surely that is to be applied only to the progenitor and “father” of all things himself, while everything else is elevated via the “Word” through him or from him and is led into being and enduring… P: God himself originated… {141} M: From eternity to eternity generating out of himself. We surely cannot exceed Jakob Böhme’s wisdom here, Psilander. Franz von Baader repeatedly determined that we may certainly speak of a God free of nature, that is, elevated above nature in absolute free self-configuration, but not of a God who lacks nature, that is, as if cut off from what qualifies the roots and depths of primordial life, if we do not want in the end to turn the primordial substantial [den Ursubstanziellen] into a ghost. But what is most important and alone excludes all misunderstanding: only God as such from his originally unalloyed and ungraspable silence generates, posits, and awakens the qualifying primordial and natural life in himself. Thus, he is also in his very first “beginning” and ground free of it and Lord over it. But let us return from this fleeting and timid approaching to the eternally burning core of all questions into our cooler peripheries. In order to see the activity of body and spirit develop in their essential conditions, it was important to comprehend this first point of freedom, the salient point of all possibility of substantivation, in which the entity no longer has the qualifying life so to say behind it, but has it [seiner habhaft]¹³ before it. One’s own nature and being becomes a personal “having”

 [Here and subsequently Conrad-Martius plays on the sense of “having” (haben) as owning

108

Metaphysical Conversations

[Habe]—without it there is no body, no spirit. Incidentally, all of this can be thought as impersonally and as mere happenstance of passive fate as you wish. Yet this “having” for now is just a merely potential one, one of might and mastery—how do we get from it to actual being there in body, to bodily resting in fullness and being? {142} P: If I think of what we discussed earlier: we get there by the entity fashioning itself into and adhering to the fullness it owns. M: We have to be careful with the expression “adhering,” so that we don’t catch in it only the material activity of the body, but everything else in its determination. P: Throughout I’ve had the feeling as if you mean something universal with this, something that goes beyond material nature. M: Is not also God truly there in body [leibhaft]? He, first of all and before all? P: God is spirit… M: Thus, there must be a spiritual acting in body [spirituelles Leiben]. And I suspect that we will understand the material only from this [spiritual acting in body] rather than the reverse. P: A spiritual acting in body [spirituelles Leiben] that all the same stands in contrast to the acting in spirit [Geisten]? M: Only this permits the contrast to be grasped in its completely pure meaning. It is precisely this that is at stake now. Did we not earlier call the act of spirit a free “exhaling” [Ausatmen] of substantial being? P: Thus, as I’m realizing now, the act of body will be compared to an inhaling [Einatmen]. But I don’t really understand that yet. M: Why did we call the acting in spirit an exhaling? Was it not because it is a free offering itself outward, a bestowing, giving away, pouring out? {143} P: Yes. M: Accordingly, shouldn’t the acting in body be a drawing to itself, a kind of surrounding or “giving” oneself with or to oneself? A true taking possession of one’s own being in its fullness set forth? One could also say: a burdening or weighing oneself down with oneself, if these expressions did not make it more difficult to hold onto the general spiritual sense. P: And the figure or shape grows from this at the same time? M: Must it not grow like this? Is not this drawing to oneself, this holding oneself, so to say, an adhering to, in which the qualifying life must be marked and manifest itself in its special manner? What lives and dwells [lebt und west] differ-

(Habe, habhaft). Sometimes it works in English to employ versions of “having” or “to have” but often it does not, so “owning” has occasionally been adopted when habhaft or Habe appears in the German text.]

Concerning the Human

109

ently from itself, according to the determination of the final qualifying source, also acts in body differently. P: Still, Montanus, the possibility and manner of this “as it were” [gleichsam] adhering into, which all the same is not supposed to be a real one, is not yet clear to me. M: There is maybe really nothing more difficult to grasp for such material beings as us. And yet again, nothing is more important to grasp for the understanding of the basic nature [Grundwesenheit] of all that is substantially spirit, all primary being. Does it not seem evident to you that there can be a kind of adhering that remains, as it were, suspended? An always new creating, positing, and fashioning itself in eternal actuality… {144} P: When we spoke about the nature of the being [Wesenheit] of spirits and angels in our conversation about the soul we already touched on this once and tried to grasp it. M: Yet at the time the general relationship, all insight into the nature of spirit as such, was still missing. If in the significant sense of the word spirit means “wind” or “breath,” that is, what is free from all burdened and fixed possibility to be grasped, the quintessentially free holding sway over and owning and when the objective spirit then approached us precisely as the freely breathed and offered nature of being [Wesenheit], then it might emerge now that the spiritual body or, if you prefer, the spiritual being-there in body is possessed and internalized in free and always actual welling up and existing [Wallung und Wesung] and in this possession and in this internalizing presents the configured fullness of one’s own being. P: The internalized fullness… M: Yes, in contrast to the externalized one of the spirit! The internalized fullness, in which the respective being itself becomes “sensitive” to itself, to employ again one of Böhme’s expressions. P: I’m slowly beginning to understand that despite the spiritual manner of this embodying the contrast to the acting in spirit and thereby to the only really free positing of spirit in itself will be fully maintained. {145} M: Without this spirituality of the embodying becoming one that is less actual or substantial? P: Precisely, because the greatest possible creative vivacity of self-configuration and self-effectuation is posited. I have understood it perfectly. M: And only where embodying is missing or made impossible, de-substantializing and thus empty “spiritualizing” [Vergeisten] is the immediate consequence. P: Now many relationships and the response to any number of questions that set me into such confusion in the beginning dawn on me!

110

Metaphysical Conversations

M: We will now draw out all these consequences. But first: in contrast to the de-substantialized or substance-less spiritualizing [Vergeisten], could there not also be an over-substantializing embodying [Verleiben], if I may say so?¹⁴ P: When the inhaling is not complemented by an exhaling? M: Very good. These two movements of life—which, incidentally, already Goethe grasped with intensity and tried to demonstrate on continually different natural phenomena—coincide in all primordial substantializing via their fundamental need for complementarity. Must not the mere catching-itself and internalizing-itself, without an always renewed self-un-selfing, going out of itself and exhaling itself, lead to a real fixation in itself, to darkness, rigidity, and death? {146} P: In which the entity, as it were, gorges itself on itself? And is no longer able to get out of itself… M: Yes. It loses in spirit what it gains in matter. P: So, Montanus, you intend to “generate” concrete matter in this way? M: I don’t know about that. I wouldn’t dare to approach that problem right now. Let us for now refer to two forms of possible substantializing and embodiment: the one that we just tried to grasp as spiritual through and through and the other, where the embodiment occurred in a fixed form, in which the respective entity now substantially expands itself and rests, but with which it is also burdened, confined, weighed down, and discovers an impassable boundary in its primordial aliveness [Urlebendigkeit]. P: Yet even these concrete material formations, burdened by matter [stoffbelastet], are exhaling their spirit? M: They have to exhale it, as long as they still have primary movements of life in them, as long as they are still “nature” at all. For once again: what lives, breathes. What acts in being and body, also acts in spirit. [Was west und leibt, geistet.] {147} P: But we don’t feel and know much about this spirit. In fact, we know so little about it that some would dispute its existence altogether. M: But the influence itself is all the greater. We are literally given food and drink by the spirit of the things that surround us. Yet… our organs have shriveled up and the spirit of things has grown weak and is as if suffocated! But, Psilander, our questions were quite different. Were we not looking for the nature of being of spirits [Wesenheit der Geister]? We have now clarified the spirit a little for ourselves. But what are spirits? Had we not encountered a contradiction that really unsettled us? Maybe it will now be easier for us to resolve it?

 [Vergeisten and verleiben designate too much of spirit or body, respectively, becoming wholly turned to spirit or body in contexts where this ought not occur.]

Concerning the Human

111

P: It seemed to us that God could be the most substantial of all substantial beings only because of his absolute nature of spirit [Geisthaftigkeit], while conversely demons and dead people are or become “spirits” precisely because of their lack of substance and de-substantivation. Yet just a moment ago the solution to this contradiction seemed immediately given to me. For you have helped me onto the track of a doubled form of beings of spirit: one kind acts in body by spirit [geistig leibt] and thus has a higher, freer and more vibrant substantiality than the beings that embody in a material fashion; and a second kind that can only act in spirit, because it cannot achieve embodying and thus finds itself in want and misery, as compared with the material kinds of beings. {148} M: Yes, Psilander, in want and misery. Those are good words. What could characterize the disconsolate condition of the dead spiriting and ghosting about better than these words, poor souls that are expelled from the existence of bodily fullness back into the unfathomable deep of a hungry and starving life? These sorts of expressions don’t fit the demons as well, because the invincible spirit of hunger belongs essentially to their nature as configurations of this qualifying primordial life. They are nothing but the personified raging for effectuation and configuration. One could not want to “redeem” demons in oneself! P: Thus it is not the same thing that leads to lack in one case and fullness in the other? Instead, spiritual embodying leads to fullness, while the missing of any kind of embodying leads to lack. M: Accordingly, I think, we have to distinguish between spirits out of lack and spirits out of fullness or substantial spirits and spirits of hunger? P: Yes. M: What about our elemental spirits with which we already once had such intimate acquaintance? P: With these soulless creatures, as you tried to show me. M: Maybe we have lost the soul out of view a bit because of the spirit? P: Yes, Montanus, you guessed it. {149} M: And yet we were never closer to catch both with the same grasp. Did we not find that spirits and angels do not have a soul because they do not grow out of their own original [urtümlich] ground like the human? P: Maybe I have the relationship all the same. We could say: because they do not stand in their own qualifying source in primordial fashion? M: As, by contrast, does each lower animal, the plant, and the stone? P: I know, I know; you will no longer lead me astray here. For this qualifying source to become a soul the respective being must also really live from out of it as out of a middle posited for itself—as is the case only for the higher animal and the human.

112

Metaphysical Conversations

M: You are so clever. But for the case of the human we’ll still have to come back to this. Yet, Psilander, given that these elemental spirits and the angels and other beings of this sort are also supposed to be figures in body and being [leibhaft und wesenhaft], then surely they also will have to live out of some qualifying source—must also become qualified into what they are in a living way. P: I don’t know how to respond to that. M: Did we not say that, in contrast to the human, they are substantialized from “spirit”? {150} P: That’s what we said. And at the time it was not at all clear to us what this “spirit” really could be or mean. That, it seems to me, has now become clear. At least for the elemental spirits. Surely, it is that objective spirit of nature or of natural things, exhaling its very being [wesenhaft], which now in turn appears in them as personified or configured? Oh, the consequences now really draw themselves out on their own. M: We once earlier called them creatures “born of spirit.” This expression has now been filled for us with special meaning and life. For as you rightly say, it is this objective “spirit” in some specific configuration or other that qualifies them as that which they are and what they represent, [or, we could say, the spirit in which] they dwell and [that they] enact in the body [was sie wesen und leiben]. P: Just as it is the qualifying primordial life itself that qualifies animals and humans and plants. M: And the demons? For they also live out of this primordial life, are nothing other than the personified primordial life in its many possible configurations. P: Yes, even the demons. M: Thus, it seems to me that we must distinguish between spirits born of spirit and spirits born of nature. P: The elemental spirits are born of spirit because they stand in “spirit” in some primordial fashion and the demons are born of nature, because they stand in primordial fashion in primordial nature [Urnatur]—could one put it like that? {151} M: Yes; thus the latter stand in a primary life, while the former stand in a secondary one? P: Because no objective spirit can exist, unless it is first led up from a qualifying primordial life… I understand. M: Were not the elemental spirits without soul precisely because they stood in spirit in primordial fashion, not in primordial life, because they did not spring up from below but came down from above? P: Yes.

Concerning the Human

113

M: Because they live, weave, and are spirit, configure themselves, embody, and nourish themselves from it, they stand in their very being, because constitutively, beyond the dimension of the demonic, the primordial life, the depths… P: Yes. M: But what about the demons? They live, weave, and are in precisely this primordial life, in precisely these depths. Chaotic and formless as it is, it does not allow them to come to a true acting in body or dwelling. And also, Psilander, not to a true acting in spirit! P: Yes. M: Accordingly, if creatures born of spirit lack a soul, because in themselves they do not reach down into the depths, then conversely the creatures that dwell [wesend] solely in the depths must really be “beings of soul”? {152} P: Hmm, I really… M: You really do not want to use the expression of “soul” in this case, but only where it has become the middle point of a truly configured being that now itself lives out of it and acts in spirit into open existence? P: Yes, maybe all of that. M: Thus, because the demon remains wholly drawn in the depths and the unfathomable deep below? P: That reminds me of that idea of animals drowning in themselves that we discussed before. And yet—there is an important difference here, which perhaps does actually allow us to speak of a “soul” in the case of the demon in a more real sense than in the animal… M: Because the animal truly acts in body, while the demon doesn’t? P: No, quite the opposite, that is the reason why it would be better to speak of the possession of a soul in the case of the animal. No—because the animal is not a personal being, but the demon certainly is. And surely one can speak of a real soul only in the case of personal being. M: And a personal being? What is that? P: In either case, the demon, as we have considered it so far, is one, the animal is not. {153} M: Okay, let’s leave it at that for now, so we do not drop all of the threads we have so carefully woven together. You just said that one could speak of the possession of the soul more in the case of the animal than in the case of the demon— and you are correct in that. For as we have seen the animal is what is fashioned and bodied out in a way that leaves the “soul” inside or under it, that is, possesses it. But the demon is nothing other than this naked life—having taken on figure as such. That is why I called it a “soul-being”! The pure “soul-like” become personal figure.

114

Metaphysical Conversations

P: Now I am reminded of what you named the de-substantialized dead whom one calls “poor souls.” M: Good. Precisely right. There you have the same phenomenon. In an even purer form. Because in that case it really is a soul that is “left over,” that is, the qualifying middle of life in itself raised to personal beingness [Wesenheit] that can no longer be disrobed of this formation but has now been de-substantialized—stripped of body and spirit [entleibt und entgeistet]. P: And the monadic, as you called it, is here, too. M: Yes, the being expelled back into one’s own depth and the deeps. They can no longer reach out and upward to beingness and stability [Wesenheit und Bestand], in order to achieve redemption from their own ceaselessly chasing and torturing life [Eigenleben]. Only that in contrast to the pure demons, the mighty and unconquerable dimension of the primordial is missing. {154} P: One might say these poor souls have already been used up a bit. M: One should think so, my dear! And this aspect is also really important: they don’t really belong into the depths like the demons do, but into the height, to light. But, I think, we might now dare to undertake this ascent ourselves. Psilander, is not everything that is substantialized, everything that has gained stability and being [Bestand und Wesen] in its own being [Sein], thereby in itself something manifest? P: I don’t quite understand yet. M: Take first the spiritual embodying as the most proper one in its being. The transformation of the life that earlier hungered and chased after substantializing into the effectuated and expanded fullness presents itself as an immediate transition of darkness into the light of day. P: I almost see it, but not yet entirely. I can best imagine this unfathomable deep, in which chaotic life hungers for being and stability but does not have it, according to ancient representations of hell like an open gorge, which admittedly includes the aspect of darkness immediately. {155} M: But surely this is the only possible image! That this primordial life has not yet been effectuated into that which it is—that it has not gained being and stability, what does that mean other than that it precisely is not yet what it is, that thus “there” is nothing where it is. But not the nothing of absolute emptiness— that would be neither light nor dark—but the nothing of dammed up fullness, a fullness that cannot get out, that finds itself in the state of not yet unfolded potentiality… that is the “open gorge,” is the darkness pregnant with its fullness… P: That cannot disgorge its fullness, cannot bring it to light! Now I grasp it more easily. Especially placing the two possible dimensions of the “nothing” next to each other helped me. It hadn’t been clear to me that “darkness” as such necessarily contains a positive aspect in itself, that the absence of all and any being and life can never lead to it, that it is really, as you say, the realm of potentiality.

Concerning the Human

115

M: And only in that respect finally forms a really polar opposite to light. Or better to the clear, the manifest, to the “day.” P: So, you are contrasting with each other not darkness and light, but darkness and brightness of day? M: Light and darkness are the outermost contrasts. Light is already an outermost of positivity, a breaking out of what is encompassed in bodily fashion, an ecstasis, a pouring itself out of a bodiliness [Leiblichkeit] that is posited in itself and fulfilled with itself and preserved as basis… P: That recalls the objective spirit… {156} M: Why shouldn’t it? Is not light the immediate symbol for spirit? When the being of God, as it is unfolded in itself in eternal actuality, is poured out in spirit, then this posits the ungraspable glory of light of his very being. Here, in the end, image and likeness fall together; the matter [Sache] becomes the symbol and the symbol the matter. P: Spirit becomes light and light becomes spirit. M: Yes. For spirit is the free manifestation of being, removed from any fixation. And even light you will ultimately not be able to grasp differently. P: Yet as long as a being first of all unfolds itself within itself and realizes its own bodiliness, light is not yet given, but just mere clarity? M: Oh, Psilander, I myself am only beginning to understand it by articulating it. You seem to have understood how it is. Body is the being emerged from out of itself ¹⁵—even here the movement of light, or the overcoming of enclosing darkness, consists primarily in unfolding itself, setting itself out, breaking out from itself! Yet this movement is one held “in” or suspended [eine “inne”-gehaltene Bewegung],¹⁶ one that is brought to a determining suspension—how else should the “sensed” bodiliness come about, this fullness found and configured in the body? And precisely this arrested movement, this movement of light arrested and tied back, is surely the pure clarity, the simply [einfachhin] manifest. Namely, Psilander, as long as it is really a living, an always current movement from out of itself, as long as it also remains a true “drawing breath,” even if ceased or held!¹⁷ The

 [This is the main reason why “to embody,” “embodying,” and “embodiment” are not really appropriate translations for leiben, Leibung and Leiblichkeit, respectively. For Conrad-Martius, the activity of the body is a movement to the outside, not to the inside. She refers to it literally as “stepping out from itself.”]  [Innehalten means both to keep or hold inside and to cease, stop, or suspend.]  [Here also she is playing on the dual meaning of holding in one’s breath and breathing ceasing altogether.]

116

Metaphysical Conversations

body that is, as it were, “breathed out” is the fullness that has dawned or been consumed [aufgegangen]¹⁸ in transparent clarity. {157} P: As long as it concerns a spiritual embodying? I was already thinking about the fact that earlier we called the determining materializing of bodiliness a darkening. The relationship is now entirely clear to me. M: Yes. But the “darkness” that arises out of over-materialization is different than the darkness of the unfathomable deep that is pregnant with fullness. It is not the darkness that bears life in it and only “closes it up,” but the darkness of rigidity, of death. And really: would not the matter that is throughout burdened and weighed down with itself, be in this one respect related more to what is absolutely empty? P: To be neither light nor dark? It is surely right; in that case one no longer reaches any depth in which darkness would really have a “place.” M: But now, my friend, what about the “spirit” of nature or of the things of nature—should we designate it like the spirit of God as a halo of light [Lichtglorie], which pours itself out from nature and reveals, announces, and glorifies it in its substantial being? {158} P: For the one who has eyes to experience and to see this spirit? M: Yes, for the one who has eyes of spirit. In principle, it would be the same thing as in the vision of God in the halo of light that glorifies him, which is nothing other than the spirit exhaled by him. Only that obviously the substantiating spirit in the Godhead itself must necessarily possess the highest possible form of being— namely the personal. Naturally we assume nothing of this sort in the case of itself already impersonal nature. P: But even so there surely would be a qualitative difference. M: Someone who just might be able to see the one with the open force of his or her eyes would be completely blinded by the other? P: Yes. M: The spirit of nature thus would almost have to be called a “dimming” spirit in contrast to the spirit of God. P: We already mentioned earlier that the spirit of materialized nature has become lukewarm and impotent. M: But that’s already a second thing. Even if nature were guided back to its possible aliveness, if it were again opened up and transfigured [verklärt] in its true substantiality, this infinite qualitative difference would still have to remain! {159} P: Because nature is and remains always what is tied down or fixed?

 [Aufgehen means both to rise or dawn (as in the sun) and to vanish, to be consumed, or to leave nothing behind, i. e., to disappear without remainder.]

Concerning the Human

117

M: Yes, for it is its nature to embody the fullness of primordial life in its infinity of single dispersed figures, each posited for itself, and to bind them into it substantially. Does not the single, the dispersed, what is bound apart, if I may put it like this, have to manifest itself differently in spirit than the being or nature [Wesen] that contains all in one and in itself in absolute actuality? P: Montanus—the colors! Nature in its configurations must reveal itself in color. I don’t know why I’m so certain of this. It’s like an intuition. M: An intuition. But let’s stop here. If we were to continue this, we’d completely lose ourselves in a philosophy of light and colors. The point for me was really just the insight that the spirits that are born from the spirit of nature [Natur] must have a different nature [Wesen] and appearance than the spirits that stand primordially in the spirit of God. For the qualified must accord with the qualifying spirit. P: Spirits that stand primordially in the spirit of God? Angels? {160} M: Yes. For we have now finally arrived at them who for so long hovered far above us. And the polar opposite between the demonic and the angelic will now light up in all its radical nature. So far we have distinguished spirits of hunger or spirits from lack and substantial spirits, and, conversely distinguished spirits born of spirit and spirits born of nature. Into this second opposition belong demons on the one side, elemental spirits and angels on the other. And when we now take the expression “qualified from above” in the precise sense, then the angels would also receive a special locus. P: One might say that the elemental spirits belong to a middle realm—between the unfathomable deep and the heights. Yet, Montanus, why are you always talking about merely these and the angels? Are they the only substantial spirits that one can distinguish by kind [wesenhaft]? M: There are as many breathing beings as there are substantial ones and as many possible spirits as breathing beings [soviel Substanzielles, soviel Atmendes; soviel Atmendes, soviel Geist]. There is no limit here. We highlighted these spirits because what is typical and essential is especially visible in them. You said the elemental spirits belong into a middle realm, inasmuch as nature precisely presents itself as a sort of middle realm? P: Yes, that’s what I thought. {161} M: Thus, these spirits detach themselves from the rising spirit of the nature substantivized from below, but are not able to escape the spell of this colorful and dim atmosphere? P: This wording immediately brings to mind woods and lake, mountain and meadow. M: They are substantial spirits, insofar as the dimension in the spirit of which they stand primordially, namely nature, is a self-realized and embodied one. But,

118

Metaphysical Conversations

surely, nature has the entire restlessness of this configuring and acting in body still within it—it is never done, never rests in the stores of its being once and for all? P: Do we not say that it belongs to the nature of everything alive to draw and fashion itself always anew out of itself? M: So that even God would have this eternal restlessness in himself? P: The restlessness of life itself… M: But is not God the one who is precisely substantivized into himself without remainder from eternity to eternity? How would there be room for the restlessness of something still “becoming”? P: Am I confusing two things? It almost seems like it. Is the eternal actuality of fashioning itself united with the resting of what is fully fashioned? {162} M: We cannot express these two points in a better way for now. The eternal breathing of what rests in itself in absolute aliveness—and this immanent movement, as far as it reaches, only indicates precisely what is alive, not fixed, the being-spirit of being [Geistigkeit des Seins]—is something radically different from the need to rise up always anew from a ground not yet unfolded to an unfolded existence [aus unentfaltetem Grund zum entfalteten Dasein]!¹⁹ P: But you seemed to indicate that even the progenitor rises up from the ground of primordial life… M: He is the one having risen up from eternity to eternity… P: Accordingly, the two pairs of opposites are: rigidity or fixation of the configuration and aliveness on the one hand, transition from potentiality into actuality and pure actuality on the other. M: Correct. But nature is actually the dimension of transition from potency into actuality. We would have to take away what is most particular to it, if we did not allow it to rise up always anew from its inexhaustible configurations out of the dark ground of mere potentiality to the unfolded actuality of being. P: Even “redeemed” or “transfigured” nature? M: Nature freed from rigidity or from being turned entirely into matter [Vermaterialisierung] and emptied of spirit [Entgeistung]! I think so, yes. Precisely here we see how little the two things have to do with each other. This dark, concealed [verbergend] ground out of which the figures of nature emerge and which finally takes them back into itself and shelters [zurückbirgt] them again—this is the specifically earthly [Irdische], what is ceaselessly fascinating in nature. {163} P: It is curious: earlier, when you spoke of transfigured nature, I had this feeling of a possible longing for the dark heavy, earthy nature, longing for the shel-

 [Entfalten means to unfold, but also to develop or grow.]

Concerning the Human

119

tering womb of fruitful earth, from which everything comes forth. Now I realize, liberated, that we need not fear anything of the sort. You smile. M: The “heavens” do not take but give. What is apparently emptying, evaporating, and life-deadening, according to a falsely oriented spiritualization, has already instilled fear in many.—Accordingly, the spirits that are qualified from this spirit of earthly nature, may participate in its restlessness and the transitoriness of all its configurations? P: And also, Montanus, as it seems to me, in the dark ground of life, from which they grow up, not comprehensible in themselves. M: But they are and remain spirits born of spirit. It would falsify their image essentially if we wanted to displace the abyssal potentiality, driving and drawing from itself, of this primordial ground into itself… P: Then they would become “ensouled” creatures? M: Yes, Psilander. But this way they are and weave only in and out of the spirit of the already actualized and realized nature. And yet you were right and have felt what is decisive in this. Something dark lies over and around them. They are not comprehensible to themselves, neither in their coming nor in their going. Nature, in whose spirit they qualify, closes around them together with the veiling and impenetrability of their always and everywhere emerging being, never entirely “consumed” in fulfilled actuality. The angels, however, Psilander, stand before us in the brilliant assurance of themselves. {164} P: Oh… that was a leap and a sudden dawning of something long expected. M: Now the polarity to the realm of the depths has become clear. You now understand why one uses the expression “realm of spirit” here. Even though the demons are “also spirits”… P: Because only now has perfect, eternally actual, fully living substantiality been reached… M: Which is in itself one of spirit. Now we see the demons before us as the “fashioned” and personified “abyss” in itself, in which life is uncanny, because it still bustles and bubbles up under the cover of all existence. It is sunk monadically into its own empty unfathomable deep, filled with chasing restlessness. From this emptiness and restlessness it hungers for existence, unfolding, fullness, and light. It is mighty only via the invincibility of this primordial life that possesses them and that must take hold of any locus of existence that gives it “room.” It is thus mighty and effective only through a very personal and in itself also brutal grasping of possession, even if it may occur in a fawning and imploring form. These pregnant powers, wholly potential, foreign in themselves and unfree in themselves are grasping, craving, addicted to configuration. They are indispensable in the majestic force of

120

Metaphysical Conversations

their primordial life, dreadful in the irrational lack of freedom of their possessed will.²⁰ And the angelic spirits? {165} P: “In the brilliant assurance of themselves”… M: They are fashioned and nourished by a spirit and filled by it, in which all primordial life has dawned and been consumed in glorious fullness, selfhood and beingness [Wesenhaftigkeit]. There is nothing dark, nothing unredeemed, nothing unrealized behind them. They stand beyond themselves and grow to perfect figure, devoid of all life grasping restlessness, free possessors and stewards of their wholly manifest being, at peace as regards configuration. They stand in their own fullness, turned away from themselves, eternally ready for service and dedication in sweet factuality and buoyant earnestness… P: This last thing, Montanus, says so much, but is all of a sudden phrased so unphilosophically… M: It is unphilosophical, because it is left to dark feeling, because it is not explicit? Factuality [Sachlichkeit] is dedication. But sweet factuality? Is this not a final smiling self-securing? Not a subjective self-securing that would stand against dedication without remainder. But a still abiding within one’s own limits [Umfriedung].—And the buoyant earnestness? The same thing. Not to be pulled down by the things but to bear them—knowing about the final, ultimate insignificance and unimportance in contrast to the One.—Let us now no longer speak of angels. Who wants to darken and weigh down their sweetness and majesty with words? {166} P: But how is something like a “fall” or “falling away” from this sphere and this being possible, even just as an idea? Now I really do not understand it anymore. M: Neither do I. But we will continue thinking about it. We cannot capture even the human for ourselves, without knowing a little about this. But maybe we are at least far enough to uncover and construct some of what is essential in it. Incidentally, as concerns Lucifer, do not forget that he should never be confused with a demon. He comes from above not from below, from the realm of spirit and not from the realm of primordial nature. Maybe it was precisely his craving to substantiate himself in these ultimate primordial grounds like God. The only thing that was forbidden him and had to remain forbidden to him for all eternity.

 [Except for the brief phrase in the beginning this entire paragraph is one long, convoluted sentence. Several words and precedents have been supplied in breaking it into multiple sentences.]

Concerning the Human

121

3 Evolution—The Human {167} Montanus: Have we yet gadded about sufficiently with animals and plants and stones, with demons, angels and other spirits, to dare now to approach also the human? Psilander: In all the circles that we drew around the human, our sight was ultimately still focused on this. I always felt that. M: In contrast to the animal, the human was for us the upright, the naked? P: But these determinations really still require further elucidation. M: Yet we also had a second image that maybe already said a little more. The animal is a being drowned in itself, the human a being raised up from itself. We originally drifted so far sideways precisely in the search for the “element” that still engulfs the animal, but from which the human seems redeemed. P: When we found the qualifying source from which every natural being acts in body, being, and spirit [leibt, west und geistet]. M: To this, then, the animal is still entirely handed over, while the human emerges from it. P: That’s how it seems, yes. M: But what does this emerging mean? How can we depict it more closely? {168} P: Did we not already depict it when we spoke of the demon? M: Who, possessed by the life that chases it, cannot fashion itself in it and own it in bodily fashion? P: Yes, it similarly cannot get out and up from its own unfathomable deep. M: But the stone, the plant, the animal can? P: They are bodily what they are… that is right… M: Raised out and up from mere potency to fulfilled actuality of their being? P: Yes… M: In that case surely the submersion of the animals in themselves and that of the demons must be a different one, given that the animals “have” their being like all embodied [leibhaft] natural entities. P: Certainly… there must be some sort of equivocation here. And yet… there is something shared that is missing in stone and plant. M: We already saw that the animal has something “demonic.” P: As if the animal did not actually “have” itself like stone or plant. M: Even though it stands higher on the stepladder of natural entities. P: That’s precisely what’s making me a bit confused at the moment. {169} M: Could we not say, Psilander, that a pure element like gold or water, is posited into a bodily nature, thus truly “has” its fullness, yet without possessing it? P: Yet we thought of that precisely as “possession” [Besitz] of being in distinction from the mere being-possessed [Besessensein] of the demon.

122

Metaphysical Conversations

M: Good. But is it not—in the case of gold and water—an, as it were, unpossessed possession [unbesessener Besitz]? A having [Habe] that the pure element really does not have? P: Because it is dead? M: No—it may be dead or alive; that’s not at stake right now. But the stone remains foreign to itself in its own effectuated or bodily being. P: I understand—we have arrived at what we saw already before, what seemed determinative to us already for the difference in nature between plant and animal. The animal possesses itself, is master over itself and accordingly can conduct selfowning [selbsteigen] actions, the plant cannot. And a mere element certainly not. M: Certainly not? P: It “has” itself even less than the plant. M: There is probably no difference in this regard between stone and plant. Both are loaded down with themselves as such [sich selber schlechthin aufgeladen]. Both are what they are, without “having” what they are. Yet both rest in the fullness of their being. {170} P: If I recall correctly you said earlier that the substantivizing qualifying source has found a personal, or self-owned, a current abode in the plant, while it works into the pure element only according to its potency… M: We also said that although the qualifying source has a personal abode in the plant, all the same the plant is not in its qualifying source. In the case of the animal, however, this particular breakthrough has occurred, which allows it to “sink down” into the proper depth of its qualifying life and allows it to live, experience and act out of it. P: Its own being is like an open wound in it… M: If I had said that, I would have feared that you would not understand me. And now you just say it yourself. P: I could scarcely specify more clearly, though, what I actually meant or mean with that. M: Where the soul becomes free, the being is open toward its own lack of ground [Ungrund]; it is no longer closed, no longer secured from itself—should one not almost be able to call this a wound? P: In either case it has now become clear to me that two things matter in this breakthrough, as you call it: on the one hand the animal is able to become master over its body and thereby far surpasses the formal nature of the plant, but the particular fact of being sunk into itself is precisely also connected with this. {171} M: With this sinking into itself or into its own unfathomable deep the animal becomes free of its body, into which it is effectuated in bodily fashion like the plant? P: Yes.

Concerning the Human

123

M: And with this precisely [it becomes] master over the body? P: And yet it still possesses it… M: This freedom in regard to being is no severance! This is precisely what is important to see and comprehend, that the being in its “having,” that is, the being [Wesen] resting in and permeating the effected fullness of its being [Sein] can still once more in a sense go back to itself, without thereby losing itself. The breakthrough happens precisely at this internalized point where it can master itself. But you understand that this is meant as a constitution of its nature, not as an action or a genesis. P: Yes, I get it and really understood this a while ago: this having is now also had and can be had because the respective being is not as such had by it. M: Excellent. But surely for the animal, this having of the having [Haben der Habe] extends only to the dimensions of the body? {172} P: Yes. And presumably you will want to separate the human from the animal in regard to their nature via the indication that human “having” reaches further in principle. M: And how far then does it reach? P: We actually have already drawn the line before and repeatedly hinted at it. Just as the animal is internalized in its body and thus master over it, so humans are internalized in their “soul” and free from it and master over it… M: At least they should be, could be… P: Yes, yes. And through this they possess self-consciousness, understanding, language, spirit. M: Stop, stop… now the waves are submerging us and insight turns into chaos. Self-consciousness, language, reason, spirit… P: Sorry; I’ll be more tempered. M: Indeed, there are various traps here. What about the demon? If it does not make you very upset—now that we’ve finally apparently arrived at the human—if we begin again with these mystical non-beings [Unwesen] and ask whether they do not also have language, whether they cannot express themselves personally in threatening, urging, and commanding, in beseeching and flattering, in passionate raging. P: Indeed… M: You yourself already determined it once like that and in that context pointed to the fact that in these cases there must already be something like persons. {173} P: And back then you already warned me… M: Should demons really be persons? P: If one contrasts them to humans, a significant difference indeed seems to become clear here. M: Or maybe even if one thinks of an angel?

124

Metaphysical Conversations

P: The angel also seems to have the aspect of uprightness, which is precisely what appears to be missing in the demons, just as much as it does in animals. In both cases this seems connected to what we called their “submersion” in themselves. M: Thus, this does not contradict the possibility of a kind of understanding or whatever one might want to call it? P: Surely it does in animals. That’s precisely what’s confusing me. I always thought that if there were an absolute boundary at all it would lie here. M: Would it not be possible that even an animal, a lion or a wolf, might start to talk? P: I don’t understand… M: I don’t mean the actual animal, as it is. … It is mute, has maybe become mute… I don’t know. Is it impossible in terms of its nature to imagine a talking animal? Would the animal cease to be an animal in that case? P: Poets and fairy tales speak of blessed children who can hear “the voices of the woods”… M: The woods… thus also the trees, the plants? {174} P: So it seems. And now, Montanus, maybe the stones will start to talk as well. M: Well, if they do, they’d probably talk more sense than we do. But what do those people mean when they refer to the voices of the woods that speak to the hero? P: It is an image for a deeper discernment this person seems to have about the nature of things and of nature. M: It is a very concrete image, which determines the form in which this deeper discernment arises in a very specific sense. That is, it implies that the things pronounce their nature in the “word” and that this word is understood by wise people. That’s how I would want to put it. P: That phrasing reminds me of what you said about the objective spirit. M: And must not spirit and word be closely connected? You already saw this earlier—only that you allowed for both possibilities to begin only in the human. Yet now that we have recalled that each naturally alive thing has something like “spirit,” it may no longer seem as absurd to us to speak also of the possibility— only the possibility, Psilander, no more!—of an actual self-expressing. P: But is it not the same to manifest oneself in a spirit freely poured forth and freely exhaling its being and to express oneself in words? M: Nothing could be more different. {175} P: And yet both seem closely connected…? M: Everything alive and breathing has spirit. Only what breathes life and thus has spirit, can also express itself in words.

Concerning the Human

125

P: Nothing more different… thus it concerns a contrast in the manner of manifestation? M: A contrast that we have already known for a long time. The contrast between acting in body versus in spirit. P: The body? Surely it is not the word? M: No. It is not the word in the real, independent sense. And yet—to get first of all just at the verbal meaning of “word”—could one not for example call the body of the plant the “word,” in which it gathers together, forms and fixes its being, puts it down and pronounces it? P: That is indeed a possible image. But how do I get from here to the real word? I think in that case one has to leave the dimension of the body and ascend into that of the spirit. M: Good. But could there not be something like an act of body within the dimension of the spirit? P: We did already talk about a spiritual body. M: Yet only in the primary sense of what is first, in itself, configuring, internalizing, and positing. That is the real “body,” the first degree of “word,” as one might say. {176} P: In the beginning was the word and the word was with God [John 1:1]— the whole time this is already hovering on my lips. M: Again, the burning center. Is not this “word,” the Son of God, the very being of the progenitor gathered together, internalized, embodied? P: And this in turn is supposed to be a person? M: Oh, Psilander, at this point of the primordial spirit there are always only the highest forms of configuration possible. We had to be reminded of this already in the case of the spirit. But let’s leave that aside for now. P: Thus, one has to speak of a word on a second level if one wants to get to the real word, the word in the narrower sense? M: One could at least attempt it. P: This is about acting in body on a second level, if I understand you correctly? An acting in body within spirit? M: If this really [reell] embodied entity exhales itself in spirit and if what is exhaled holds itself in, forms and fixes itself as such—perhaps this is the birthplace of the word? P: You make it sound as if everything were just expressing its own being… M: I do indeed believe that the final ground and meaning of speaking and of the word lies in this. Even for humans. I think we’ll still see that. But if for now we take a flower for instance. If a flower could speak it would speak only of itself: is that immediately evident? {177} P: Because it has no insight about anything else?

126

Metaphysical Conversations

M: Does it have insight at all? Could it have insight? P: In one of our very first conversations you described it as a sentimental, nonfactual conception to think that the plant has anything of the sort. I have not forgotten it. M: So, for example, sentience? P: Yes, precisely sentience. M: And so even more for insight? P: At least I think so. M: If the plant cannot even sense itself, then how could it have insight about itself or anything else. For it is a radically impersonal being. Its being is exhausted in and through the living configuration of itself. P: But you don’t think it’s a non-factual conception to speak of a spirit and a possible self-expressing of the plant? M: If both are themselves taken in a factual sense, no. And one can do that. In fact, one has to do so to get to the final root of being of these things. Just as the living being can breathe, freely offer, and manifest itself impersonally in spirit, so it would also be able to express itself impersonally in the grasped and determined word of spirit. {178} P: This word would come forth or sound out of the plant without it itself being aware of it… M: And even more important: it would do so without the plant itself forming or positing it! Thus you said correctly: it would go or sound forth from out of it. That is, it would sound if it were not just a spirit-word but were to appear in a material dress. P: I understand now that the plant can only speak of its own nature, that only this could be articulated in the word. At least as long as one comprehends it in a factual-essential sense. M: For what could form itself out of the plant other than it itself! P: Yes. M: And now you also understand that in the end a single word would be sufficient to reveal its being thus determined in spirit? P: A single word? M: The “name” into which it is sealed, the logos of its being. P: The idea according to which it is formed? M: Yes, maybe you could say it like that. {179} P: But, Montanus, this has now scrambled everything together for me. Now we are speaking of an idea according to which a kind of plant is formed, of a single name, into which its nature is placed, as it were, but did you not earlier dismiss those “a priori units of configuration” as scholasticism? Did you not say that it would give short shrift to the purely natural, the dark urging and seeking,

Concerning the Human

127

the accident of configuration, the ascending and descending stages of the more or less lucky or completed? At least that’s how I understood it. M: And you understood it very well. Oh, Psilander, we stand here before one of the most difficult points; our reflective understanding would probably try to tackle it in vain. The ultimate oppositions of almost all great philosophers are somehow connected to this. Obviously, there is a synthesis. But only a visionary might glimpse it some day in a fortunate moment. We can only search or grope for it, keep our eyes open in all directions. It is as you say: one has not understood nature if one has not grasped the blind urging from primordial depths in all configuration, the naked hunger for configuration and embodying in itself, even if “forever.” One has not yet apprehended nature if one has not also apprehended at the same time the ever new dead ends, strayings, half and grotesque attempts and rolls of the dice that lead first to this kind then to some other—by chance in possession of one form of true embodying and being—and now further propagate and protect it as such across unfathomable time periods. This is the indestructible ground for all evolutionist, for all “vital” conceptions of nature, for any conception that knows how to look into the depths, into the chaotic, that is founded on a feeling for the “immense urge of life.” And yet, conversely, if one has not seen that the logos sanctioning it stands above any figure as it is, the logos that gives it its name and encompasses its entire nature… This is not the only thing that can barely be expressed! You see, my friend, one thing is truly certain, and everything we saw so far leads us to it: no thing would exist without the generating, embodying, and vivifying force of the Godhead. {180} P: So far you showed me that each thing can only become what it is, when it is elevated from the unfathomable deep of the darkness that encloses everything and anything in mere potency, now gathers, internalizes, and fashions itself in its own fullness, and again emanates from it by pouring and breathing itself out. M: From where does the possibility and power derive for this elevating, gathering and for this embodied living in itself? P: Does it not lie in itself, in its primordial urging? M: Then it really would be self-creating, as you already said once before. P: No, because the “sources must be opened” first. That’s your image. {181} M: But that indeed was only an extremely vague image that said little or nothing. For it’s not a sluice that only has to be opened, but a self-consuming darkness, eating into itself in the powerlessness of mere potency. It is hard to arrive at an even approximate concept of this. But one shouldn’t think of something like a seed or a fruitful womb, for in that case the possibility of effectuation and unfolding are already fully and immediately posited. In the case of this black gorge, however, the essence of the matter lies precisely in the absolute impotence, the total

128

Metaphysical Conversations

nullity and lack of nature [Wesenslosigkeit] of all being, which precisely comprises the burning hunger and gnawing restlessness, the primordial restlessness. By contrast, what rest lies already on what is just not yet developed, but already fully posited in its being in regard to potency, the seed-like nature! It “has” itself already, obviously without owning itself. That is, it can already be reached by itself. Yet in this abyss precisely the aspect of “not being able to reach itself in any sense” makes all the difference in the nature of the matter. Here being chases after itself. How would it ever be able to develop from itself, given that it does not possess itself at all, and not even in regard to potency? P: And yet you always called this dimension the dimension of plain potency… M: You are right. There is an essential ambiguity in the expression here. Potency means “being able to,” namely according to force, and potency also means “possibility,” namely according to content. {182} P: According to force there are no potencies in this unfathomable deep, but according to content there are? M: That’s what I’m thinking. P: Insofar as there is nothing here and nothing can develop from it itself, but everything can become out of it? M: Yes. P: But that’s the prime matter of the Scholastics. M: Admittedly. But don’t forget this aspect without which the whole conception seems to me to lose its nature: this prime matter, if we want to call it that, should not be understood like clay lying ready in the hand of the artist fashioning it according to some idea, ready as a passive and patient shaping material, which only contributes matter but no content! No, it is precisely the “material” and the potency for any material that is missing entirely. For it is the hollow, the fathomless, the empty, the abyss as such. It is right that it does not contain anything, even according to potency, and can become everything and anything. But it contains everything and anything according to a longing, if I may put it like that, according to hunger, according to greed. It is not dead material, but a living nullity, not a fullness lacking quality, but an emptiness roving about in all qualities. {183} P: Thus, it is precisely the opposite of what still dangled before me as prime matter. M: It is not clear to me, to what extent scholasticism itself follows either the one or the other of the two concepts that are polar opposites of each other, although they do share the idea of a basis that is in itself impotent through and through yet is ready for any configuration. P: But one of them is a qualifying basis, while the other must receive all qualities from the form. Surely this must be the greatest conceivable contrast.

Concerning the Human

129

M: Surely. But the deeply confusing difficulty lies precisely here. What is impotent through and through would have to be elevated to potency of itself; what is without body or being would have to be elevated into having body and being? P: Yes. M: The potency for elevation from the profundities of its nullity, to true embodying and fashioning and to living dwelling [Wesung] in fashioned being [Sein]: what is at stake in all of this is the force that allows all this null self-consuming in the darkness to emerge for actualization into the dawn of day. P: The dawn of day… M: Yes. Or what would be a better way to describe it? Accordingly, the generating, embodying, vivifying forces of light must take pity on what is powerless and enclosed in darkness. {184} P: “In him was life and the life was the light for humans…” [John 1:9] M: Yes. This already mentions the human. And we are pursuing all of this for the sake of the human. But first it is important to see that this force of light must work in each thing for it to be at all what it is. P: The triune force of light… M: Oh yes, you have understood. Who else but the Godhead could draw and lift all things out of their beingless nullity, inasmuch as it generates and elevates itself from eternity to eternity. God is the generator and father of all being. Who else but the Godhead can work in all things as the gathering, embodying, truly effectuating and fashioning force, inasmuch as it grasps and posits itself in its own glorious fullness, inasmuch as it becomes body and word in mysterious gathering. Who else but the Godhead, inasmuch as it emanates as Spirit from its elevated and gathered fullness in free force and brilliant glory, would also go forth where Father and Son are present and effective in things according to force, together with them and within the quality of the thing, making it into a breathing, dwelling, and living thing? What is the Father without the Son and what are Father and Son without Spirit? What is the generating principle without the one acting in body and what are the principles of generation and acting in body without that of acting in spirit? That’s why it says “in the word was life,” for wherever the Father posits himself in word and acts in body, the life urging forth is co-posited by its very nature. {185} P: Yet, Montanus, although I now seem to feel forcefully the grounding and supporting work of the Godhead in each thing, why do you say that it is present “according to force”? Does that mean it is not present itself and as such? This is a point that seems decisively worth emphasizing. M: Oh, my friend, why are you asking me about that? I don’t dare say anything definitive about it. But you have obviously posed the decisive question. Sometimes it seems to us as if the Godhead, as it dwells in itself from eternity to eternity and

130

Metaphysical Conversations

in the undifferentiated fullness of all being as generated, embodied, and insufflated in itself, now also generates, acts in body, and lives in every creaturely thing and its differentiated quality? That would be a bit of pantheism—but resting on a strict theism that, it seems to me, in any case cannot be abolished. P: Inasmuch as the Godhead must be first considered perfect in itself, before it can manifest itself in the creature? {186} M: Precisely. It would not require this glorification in nature for its very own glorification. But might it not be a possibility on this basis? Does the Godhead qualify even in this hyacinth that stands before us? Does it glorify itself personally in the differentiated and evanescent being of the flower, by effecting and fashioning itself in it? Or does its triune being only give the force in which and through which the thing henceforth qualifies from itself, through which it glorifies itself and thus glorifies only indirectly the Godhead from which it creates itself? For it surely would be an unceasing creating, an unceasing being borne and nourished. Without this ultimately grounding and supporting force it would be swallowed up again in an instant by the darkness of nullity. In this way, however, it is able to live and dwell from out of itself, according to its own laws, possibilities and “appetites”… P: So, the Godhead with its supporting force would be a sort of unceasing midwife? M: Psilander, Psilander, that is almost too ingenious, because too ironic. But let’s take it like that for now. Do remember, though, that this force in its triune effectivity must really enter into the thing, must be made its own by the thing, must be incorporated into the body. Only in that way can it work as the proper force of the thing substantivized in itself through it, inasmuch as what always offers itself anew is truly taken in and incorporated. That is an extremely difficult relationship to grasp in its nature. Yet precisely here lies perhaps the possibility for a synthesis between pantheism and naturalism. God, who is and effectuates all in all within himself, steps back, so that the things are and can be themselves. {187} P: Steps back without stepping back… M: Yes, that’s precisely the crucial point. For without him they would be nothing. And if the glory of his majesty were fully revealed, they would also be nothing. They can only be what they are in and with his serving force. “Whoever has seen me (namely the one serving in love), has seen the father.” [John 14:9] P: But already earlier you spoke of a most difficult point… M: About a still different contrast between an extreme naturalistic, evolutionist, vitalist perspective on the one hand and a scholastic, Platonic, or whatever one should call it, on the other hand? For here meet all these latter conceptions, oriented from above and not from below.

Concerning the Human

131

P: Yes. Only because of this “point,” it seems to me, did we become so deeply enmeshed in metaphysical questions. M: As insects flit about the light we are always attracted again irresistibly to the middle point of all being. P: And hopefully won’t burn our wings. {188} M: Even if. That’s our fate. But the human, my friend, we won’t get hold of the human without these ever narrowing circles. Yet back to our confounded point. If the force for self-glorifying dwelling and embodying flows to primordial life in the powerlessness of its lack of being as buried in itself, then all the qualities within it null in spirit will rush up in hunger and greed and will plunge into “existence,” into the “day,” into this possibility of configuration, embodying and manifestation? P: At least one might imagine it that way. M: Yet is it conceivable now, my friend, that the natural cosmos, that all the realms of nature in their manifold form could be grounded in this wild urging and searching from below? P: If you phrase it like that, it seems more that chaos rather than a cosmos will leap out. M: A chaos of fullness, just as before a chaos of emptiness; a chaos of day, as before a chaos of darkness… P: In which everything and yet nothing becomes, because one continually forces the other from its place? M: In which “everything” becomes…? Also plants, animals, humans? P: That does indeed seem ridiculous… M: But elements? For are they not the immediately embodied expression of pure quality? Without any configuration lying beyond it. {189} P: I didn’t see it like that. But it makes sense to me. M: Yet even the abundance of elements perhaps not yet in differentiated, always self-owning, enclosed embodiment, in posited form, but—as you immediately saw correctly—instead one continually displacing the other in tension and restlessness and thus everything for everything and nothing for itself… P: That at least seemed to me to be the essential mark of the chaotic. M: Quite rightly. Thus something like an immense solution… could one imagine it like that? P: The primordial waters… for the first time a possible meaning occurs to me. M: There seems to be a tight connection between the “let there be light” and the primordial waters in the creation account [Gen. 1:3]. Water is truly the symbol of pure, incarnate clarity, in which no differentiated or fixed shape has of yet posited a kind of “darkness” with an act of self-deciding. But let’s stay away from daring and unfounded exegeses. Regardless of how we want to clothe all of this now

132

Metaphysical Conversations

or believe finding it clothed in this or that instance, surely it is still nothing but insight into the nature of things that makes us more and more eager, drives us ever further, and allows for ever new things to light up suddenly in some image or other? {190} P: And now makes me very eager for what comes next. M: So, how are we going to get from chaos to cosmos, from the “primordial waters” that merge and dissolve everything to differentiated nature, from pure matter to the inexhaustible abundance of the figures and configurations lying before us? P: I have no idea. M: What is missing in this chaos for it to become a cosmos? P: Differentiation, arrangement, configuration… M: A kind of forming principle would have to be added that would now enclose each nature into its own embodied being, delimits it with itself, and seals it into itself? P: A forming principle added as a fourth to the other three? M: But why did we require only three principles so far, as in the case of the elevation of the Godhead into itself? Did not a true configuration come up there as well? P: We took embodiment at the same time as configuration. M: For what internalizes itself in its fullness was precisely what forms and fashions itself for itself and in itself? P: Yes. {191} M: Yet even this divides itself into two aspects so to speak: the extending of the fullness or the gaining of fullness as such and the taking back and forming of the fullness in body into the self as it encloses itself and settles within itself? P: Is not the first of the two aspects already in itself posited in the elevation from the darkness without potency? Does not the dawn of the day, as you said, or this elevation consist precisely in the gaining of fullness as such? M: Maybe you are right. I don’t know. But we are at least agreed on one thing: that the forming, the embodying internalizing, the self-settling into a specific figure is truly the principle of what we called the “Son” or the “word”? P: That is how we described his very being. M: Thus what would turn the chaos into cosmos, and would do so continually anew in each instant, would be brought forth in the most proper sense via this embodying, internalizing, delimiting, fashioning “word”… P: Here we encounter the same issue again: does the thing take the fashioning and internalizing force of the word only into itself, in order to elevate itself by itself and from out of itself to its own configuration or is it the word itself that embodies itself within it? At least that’s how I understood your alternative earlier.

Concerning the Human

133

{192} M: Quite right. But I often have the feeling as if the two ultimately coincide. Yet maybe the first has to be stressed more than the second, because nature has to be seen first of all in its substantial independence. Otherwise one takes away all of its character. But, Psilander, if we now posit this potency for true self-determination, then does the primordial life find from itself and in blind urging all the way up to the highest levels, for instance to the human and into all configurations? P: At times you seemed to want to phrase it like this yourself, as if all figures were only the blind and accidental result of a striving for configuration as such, which always in some way seeks in existence a determinative manifestation or other through this or another condition. But I know that we have now arrived at the point to which you wanted to lead us. For in this case there suddenly seems to stand above every effectuated figure an “idea” according to which it is formed. M: Above each and every kind of plant thus an always different one? P: I don’t know… M: Or are there certain more general “guiding ideas,” to phrase it like this for now in a preliminary way, which are now realized in different kinds more or less perfectly, are embodied more or less perfectly and purely? P: That would correspond more to the aspect you often emphasized about the many and often unlucky rolls of the dice. {193} M: As if they were all striving for a specific form-idea, to which they can do justice only in very different manners according to their different primordial quality and other external conditions? P: I wasn’t really thinking about different primordial qualities. M: But we spoke all along of a primordial life qualified all the way through, which precisely as such urges up to assuming being. Think of a palm tree. Has the model of its figure been pulled from material indifferent to any content via a specific form-idea or has a specific primordial quality managed to arrive at precisely this figure, feeding on the forces of nature adequate to it, albeit drawn and guided by a most general idea of configuration, without which, it seems to me, not even the least elevation above mere matter would be possible. Or is it the constellation of effectuating forces itself, which awaken this and no other primordial quality? Is it all of this in a curious mix, and, if so, where lie the determinative boundaries of the singular? P: You called it the idea of configuration, without which not even the least elevation above mere matter would be possible? {194} M: The pure embodying in differentiated delimitation and self-determination can only lead to matter. It is the pure, the simply posited substantivation in an ever new form, in an ever new roll of the dice. Here the embodying potency in

134

Metaphysical Conversations

and for itself is sufficient, and this embodying is precisely the “idea” that stands above this lowest dimension or the logos that effectuates itself in it. But the plant? We called it a quintessential being of figure. To what extent is it something fashioned beyond pure embodying? P: To the extent that it grows up into a very specific form, and its nature consists precisely in the effecting and ever new positing of this specific form. M: But does an “elevation” above the mere embodying in matter depend just in the fact of living configuration itself? Or is this elevation expressed also in the general kind of configuration itself that pervades all the singular forms? P: I do not yet understand. M: Are all the different forms lined up entirely without rhyme or reason and only actually constituted in one way here and another there? Or is it possible to find in a sense an idea from which they arise, even if with many moves across and sideways? P: Goethe was looking for a primordial idea of the plant or a primordial plant. I am not enough of a botanist even to attempt an answer. M: Just use your penetrating glance for the essential. Nothing else is at stake here. Should one designate something like algae or a flowering plant as higher in regard to configuration? {195} P: The flowering plant. And why? Surely because its composition is infinitely more complicated. M: Would it not at first glance also be possible to imagine the opposite? Would it not be possible to conceive of a highly configured flowering plant, which reaches its magnificent result with the very simplest measures, while a moss plant for instance might bring forth what it is only with the greatest immanent complications? And yet would not the flower remain the “queen”? P: You are using certain aesthetic laws as criterion? M: Aesthetic… perhaps, if you wish; but aesthetic only in a very profound sense, which encompasses the whole being—and not, as you just thought, in a non-factual sense, but, to the contrary, factual in the most proper sense. Do we not regard the flower as the higher, my friend, because in it the nature of plants seems fully disclosed and to have reached purest manifestation? P: Now it seems to me as if what is particularly significant or higher lies already in this aspect of disclosure… M: As if it depended specifically on rising up and breaking open to the light in the most de-materialized form that is possible? P: Yes, something like that. Toward the light… {196} M: Is it accidental or for its nature eminently significant that the plant adjusts itself in its development more and more into the direction earth-sky like the needle of a magnet?

Concerning the Human

135

P: Namely as one rising up from or out of the earth up to the sky… M: Spot on. From the enclosed potentiality in the sheltering and concealing womb of the earth up to an actuality opened up to the face of the radiant sky— like an eye opened toward its light. P: If I understand you correctly, then you see in this a symbol of that metaphysical dawning of day and light, or whatever one should call it, of which we spoke so much already? M: A symbol on the level of pure configuration! But not only a symbol, Psilander. For there really has to be true force and potency in the plant in order to rise up like this and to unfold itself toward the light. P: And you would apply the force also to the development from the lowest forms, in which it still twists about in the water or on the earth, all the way up to the respectively higher and highest, in which the rising up has occurred? Have I understood you? M: O yes, you have understood. But does not your expression of “rising up” recall the human being? {197} P: The human? But that’s an uprightness of a wholly different sort… M: In the plant it remains on the level of pure configuration. In the animal this expression cannot be used at all. That may well be significant. P: We actually said once before that the animal, precisely due to and with its higher standing, seems as if once more sunk back into primordial life, into the qualifying source that has freely broken through toward it and within it. M: And I think we will soon return to this. But now—we spoke of the potency, did we not, that must live within or be granted to the self-embodying primordial life, so as for it to be able to elevate itself and rise up above the merely substantial self-determination in matter toward the light-oriented configurations? P: Yes. M: The embodying potency is the potency of the self-determination in the abundance? P: Yes. M: But this concerns a self-determination of a very particular kind, right? One that is effectuated only in and with the rising up to light, that has in itself this “pull,” as it were, to the above, to rising up, to disclosure, to de-materialization? {198} P: And which ultimately guides all the attempts and rolls of the dice, whether primitive or complicated… M: Yes, it guides them. The embodying potency, the determining, enclosing, fashioning, positing into one was this not actually that of the logos, of the son, of the word? P: Yes.

136

Metaphysical Conversations

M: Thus, here this logos would have to effectuate itself simultaneously as what pulls and guides toward the light, by entering into and sinking into the primordial life rising up into existence with its embodying force and in this way grant it the possibility and force of self-delimitation in new and ever new figures and supporting and securing these figures by granting it. The potency that streams into them always anew from this logos would have to be in its striving and seeking burdened in a sense as with an entelechy. P: I kept thinking of the expression “entelechy,” when you spoke of guiding, of pulling up, and so forth. M: Yet seen from here, what are these singular kinds of figures that are enclosed with themselves in their being and ever positing themselves anew? Are they not all manifestations of this one idea of configuration, more or less lucky and completed, in one case “successful,” in another grotesque, some still on a preparatory level, others standing already on a highly developed level, an idea that is alive and effective in the entelechy governing them? {199} P: Yet still, Montanus, you are speaking of only one primordial idea in each area of configuration, as here for the vegetative! Singular configuration is accident, condition, roll of the dice, path… M: Conditioned by what qualifies precisely here from below or whatever? P: Yes. M: Yet, Psilander, wherever and however primordial life has found a possibility and a path to embody itself into existence, according to that guiding idea, there a true nature of being [Wesenheit] has developed, a whole, something encompassed with itself and resting in existence in its specific measure of configuration? A manifestation has now been accomplished, a symbol, something that witnesses to and expresses this primordial idea in itself and through itself… P: The idea is realized in a specific differentiated form. M: Even that, if you wish. But should not the embodying logos or the logos, which supports and secures each such kind of configuration in the potency of its actual form-being, bless precisely this kind of configuration that has achieved rest in itself? P: I almost have a sense of what you mean… {200} M: And even I cannot explicate it much more precisely. Look again at this hyacinth. It has developed through many accidental and essential conditions according to its kind in this way and no other. And yet one would do an injustice to it if one were to grasp and regard it solely from the naturalistic or wild standpoint. We felt that immediately. For it is also the revelation of something essential —precisely as it is, it seems to correspond to an indwelling thought [wesender Gedanke] in primordial wisdom from eternity to eternity—and the path to a priori units of configuration appears to lie open again.

Concerning the Human

137

P: So that’s the contradiction that you kept mentioning earlier. M: Yes. But, Psilander, does not the Logos, in which the infinite being of God is incandescently posited in one—he, the heart of God, or his being rising as the sun, as Böhme says—contain in itself each and every possibility of configuration in an essential and true, if also undifferentiated and transtemporal, form? And now in and with its dwelling, embodying and guiding force in the in itself blind seeking and urging and qualifying and rising up of a specific kind of configuration has delimited and posited itself according to body and being. And if so, has not something of his spirit that embodies and presences everything in inexhaustible majesty come to this little creaturely and transitory locus, but precisely also truly and essentially, to be posited and come to body and life? And the logos, which like a guiding start, granting strength, traveled before the fashioning search, must it not now stand still in blessing above the happily newborn, sealing it in the specific particularity it has achieved and discovered with the name that corresponds to it? {201} P: And which the plant would have to pronounce, if its being could fashion and posit itself in words of spirit—I see that this one ring has now been closed. It was a long way. But, Montanus, that contradiction now seems to have suddenly disappeared? M: Or, my friend, we have only dared an attempt at a small rounding off that permitted us to take a little breather. We want to leave everything fluidly and mobile. Ever new perspectives and possibilities of perspectives appear to us—and I believe that we have seen much on our path.

M: We have arrived again at the case of the speaking plant, at the plant whose being is formed and exhaled in word. But this obviously cannot be a matter of a real “speaking”…? P: Of speaking in an active sense? M: Yes. For it has no abode in itself, in which it possesses its own being in a collected sense… it has no internalizing center. {202} P: And one can really speak only from such an internalizing center? M: Being or nature is exhaled in word not only in the free mode of spirit, but in a collected, bound, fixed, unified sense. Yet how should an entity accomplish this act if it does not possess itself in a collected form somehow and somewhere, if it is not unified in itself, “has” itself from here and in this possesses itself? P: The animal, however, already has this collecting into itself, already possesses such an internalizing center… M: Could we not, Psilander, also track down the “logos” of the animal a bit? We have already gathered the material for it on our many paths and attempts. P: You taught me to see the animal as a being of action in the precise sense…

138

Metaphysical Conversations

M: Just as the plant is a being of figure, yes. But both only express their formal nature. We already saw more for the case of the plant. We saw it rise up into the light; we saw the eternal progress from potentiality to actuality, from hiddenness to manifest disclosure [Aufgeschlossenheit] effectuated in it in terms of configuration. And the animal? P: Several times we used the expression that it seems sunk back into itself or into the depths of primordial life. {203} M: Yes, but surely not with complete loss of itself? P: How so? M: Although it sinks out of itself back into itself, it still remains itself or indeed really becomes itself. P: You are referring again to the aspect that the animal first of all, as you said, “has” itself, in that it becomes free of itself? M: Yes. The plant rises up to light and self-manifestation unconcerned with itself in some way. That is what its logos guides it to do. But the animal must first burrow itself more and more into itself, all the way into the final depths and unfathomable deep—before a new ascent can be risked. Yet that is now a wholly different ascent, one no longer purely in terms of configuration. P: A new ascent? Only in the human? Or already in the animal itself? M: The descent into the depths presupposes in itself an ever greater becoming free of the weighing down and shackling into one’s own embodied self that nevertheless is not lost or given up. This potentially enables the self to depart or break open from itself [einen möglichen freien Aufbruch aus diesem Selbst].²¹ The highest animal, which seems to live in the uncovered unfathomable deep of primordial life itself, has eyes that are no longer just passive organs of light, but already immediately long for the sun. But precisely just long for it. {204} P: Because it still cannot find the way out of and up from this unfathomable deep? M: Yes. Its logos is one of descent, not of ascent. And thus it remains formallyconstitutively enclosed on this level. It does not have in itself the formal possibility of elevation out of itself. P: Then the human has it in itself? M: Yes, the human has it. The human, in turn, is the quintessential being of light. But now on a radically different basis.

 [Aufbruch can mean breaking open, but also starting off, setting out, or departing (for a journey or on a path). That is, the human ultimately has to be unshackled from itself in the sense of opening up or even a kind of break with the self, while also setting out on the journey from the deep to the heights.]

Concerning the Human

139

P: So you mean to say that just as in the vegetative realm we are dealing with an ever new and different seeking for that pure ascent to light in terms of figuration, a seeking that ranges from the most primitive and preparatory beginnings to the most highly perfected, but with many paths crossing or leading astray, in the same way configuration in the animal realm is expressed in a seeking for its own depth, for the becoming free in itself from itself all the way to the breakthrough into the primordial depths of qualifying life? {205} M: Yes. Is that not the case? At first it is still given out from it to the materiality of its own embodying and as if distributed out to it, yet in some cases already the first vague possibilities emerge of a personal stirring in this body, announcing the very first beginning of withdrawal and internalizing. It goes through all the steps and attempts and rolls of the dice, in which at one time the immediate possibility of action in body via something like a disembodying and de-substantiating is increased to the highest degree, at another time conversely the self-enclosing and deeper and deeper nestling into in its own self is driven via capsules and shells and embodiments all the way to immovability (although both moves are completely different from the nature of the plants!), all the way to the marvelous configurations of the highest animals, in which a perfect balance seems to be achieved between highest possible mastery over the body and deepest possible dwelling into and within itself. Here the guiding logos, from which the embodying potency streams inexhaustibly, guides not to the heights but to the depths. P: And all the same it stands still in blessing over every brave roll of the dice. M: Yes, my dear. Over every brave roll. Thus the animal becomes increasingly the personal master of its body inasmuch as in its evolution it increasingly returns from an impersonal being caught up in its bodily figure to the free depth of the ground of its soul? P: The free depth of the ground of its soul? But does it not accrue the soul as soul only through the fact that this sort of inhabited depth breaks open in it? At least that seemed to be your perspective so far? {206} M: You are right. But we can now take “soul” also in a broadened sense, without having to fear further confusion. In a general and purely objective sense we can use it to name the qualifying itself. And presumably Aristotle meant it in a similar sense when he spoke of the soul of the plant. Yet the plant itself is still entirely outside of its soul, if we might put it like that. And only the higher animal that begins to dwell in its qualifying depths and to live and act out of it personally has a soul in the precise sense. P: “To live personally”—and yet it does not have a personal soul like the human?

140

Metaphysical Conversations

M: Quite right. But really in what sense? Given that it lives in it personally? Or at least I wouldn’t know to express myself differently, in order to designate the difference to the nature of plants. P: So, the animal lives personally in the soul, yet without being a person. This is the chasm whose manner we are seeking. Oh, I still cannot surmount you. M: Oh yes, you’ll see that you can. The plant is wholly immersed into its embodied figure, is it not? And thus precisely not master over it? P: Yes. {207} M: The animal, however, drawn back from this embodied figure and immersed into its qualifying ground, becomes personal master over its body? That means that only through this does the embodied figure actually become a body in the precise sense. P: Yes. M: But immersed in this its qualifying ground and living from it, it is in no way also master over this…? P: Just as little as the plant already over its body… M: Which in this case remains an impersonal body…? P: But becomes a personal one in the animal. I get it now. The animal has a personal body, but not a personal soul; for it is master over this body, because it has its standpoint no longer in it but in its soul; yet it is not master over the soul, precisely because it has its standpoint in it. M: Spot on. So how could the soul now also become a personal one? P: If the standpoint were also shifted outside of it… M: But only the standpoint! Certainly, the relationship of the indwelling itself is not thereby lost… P: Just as the animal remains living in its body, even though the personal standpoint has been shifted outside of it—that’s what you mean? Indeed, only now it really “lives” in its body. {208} M: That’s what I mean. But to where would it be possible to shift this standpoint, my friend? P: That’s precisely what I’ve been asking myself. For we have already reached the final depths of the self here. It almost seems as if it would have to be shifted entirely outside of the self. M: But surely not just into the “void”? Having reached the final depths, maybe we are forgetting potential heights by focusing on the depths? Does the natural entity have only body and soul? P: The spirit. M: After all, why have we been preoccupied with it for so long? P: You mean to say that in the case of the human the personal standpoint is shifted into the spirit?

Concerning the Human

141

M: Well, let’s figure out whether that’s the case? In either case, it is now a good thing that we learned to speak of an impersonal spirit, of spirit in a purely objective sense. For spirit turned out to refer to the being in its freely exhaled form, opposed to the embodying, internalizing, collecting, self-realizing [Verselbstung] form? P: Yes. M: And it seemed to us that every natural entity would constitutively have to have something of this, unless it had entirely expired? P: Yes. {209} M: Thus when the animal dwells in its soul and “exhales” its spirit, just like every living being of nature, it still remains, as it were, below this “spirit”? P: Which ascends above it and beyond it, unreachable for it itself… M: Yes, that’s precisely how it is, as long as one remains cognizant that the spatialized expressions in this depiction are mere imagery. And if the animal could speak, my friend, then it would speak up from this depth… P: And therefore it personally in a more real sense than that would be the case for a plant. And yet… M: And yet you would say that it would still remain an impersonal word. P: Yes. Admittedly it would sound out from the depths of the self burst open, and that makes for the difference, but it remains nevertheless impersonal. M: Because it is not personally free from this depth, but wholly surrendered to it. P: Yes. M: But what happens when a demon speaks? P: That’s different… freer… more personal… M: And yet we saw even the demon still essentially in the submerged state, craving upward eternally and in vain! It was precisely because of this similarity that the aspect of the demonic jumped out at us from the higher animal. {210} P: And yet it still always seems to me as if a demon could have something like insight and understanding and thus also a more real speaking than the animal. M: But an understanding, as it were, “from the depths,” not a free one, not one of spirit? P: A “souled” understanding…? M: Maybe one could put it like that. It grasps only what touches the depths of the being becoming a self personally, what provocatively urges into the demon personally. P: But it can indeed be comprehended and rendered in speech. Why not in the case of the animal? And what sort of strange distinction is that between an understanding “of soul” and one of spirit? I don’t really understand it yet.

142

Metaphysical Conversations

M: Now we must maybe first try to fathom what “understanding” is at all? But surely we no longer really have much calm and patience for long examinations… given how close we apparently are to our long-desired goal? P: So close to the uprightness of the human? Yes, the impatience has certainly become great. M: But as all eras have said that it is precisely the understanding whose possession distinguishes the human from the animal, it would be strange if we were to slacken here. {211} P: I see that. M: Yet in light of everything we have already said and seen, it might not, after all, actually be all that difficult to grab a hold of the outermost tips of the understanding and thus to grasp it in its distinctive characteristic [Wesensmerkmal], even if in no way from the ground up! We have already often employed the expression “having” [Habe] and “to have” [haben] for all sorts of things and have found ever new, important distinctions in the form and manner of this “having”: Is not the discerning and understanding of an issue also a kind of having of a specific sort? P: The issue I understand I have in spirit, but of course the crucial question is what it actually means to have it in spirit and not in a different sense. M: I think it’s already a pretty good basis if we know that it concerns a kind of having. And in order to see now what distinguishes this having “in spirit” from other possible ways of having, we have to remember in what respect we employed this expression before. Was it not the plant that, still completely distributed in itself, does not have or possess itself? But the animal, which is placed into its own inner center and has hence become free in body from itself, has and possesses itself as a “having,” because it is no longer left with itself in the crudest and most immediate sense? {212} P: Yes. M: And is not bodily sensing precisely just such a having and possessing oneself in body personally or at least its immediate consequence as a possibility? For what dwells in itself personally—not in the objective and distributed manner of the plant, but in the internalized, in the personal and subjective manner of the animal—surely must have with it also [mithaben] every fate that concerns this having externally or internally? P: The animal senses and feels this fate, because it dwells precisely personally and not impersonally in the body… M: Yes, in that way. But even so the animal is not able to understand its body— neither that it has one at all, nor what happens to it or what it experiences, senses and feels in it and through it and on it? P: No. Understanding, self-consciousness, intellect are missing here…

Concerning the Human

143

M: But what is missing with this understanding, this intellect? What would have to be there or happen there or be possible there, for an understanding to be present? The animal can sense itself, but it cannot understand itself: aren’t we just moving further along the same line there, only a little higher up and further back with the understanding? I have an issue or matter personally in sensing it, because I am personally wrapped up in it. And in the understanding? Am I similarly personally wrapped up in it in that case? {213} P: I am and remain distant from it… M: And yet have it? P: Yes, in spirit. M: But does not the fact that I have it in spirit depend precisely on the fact that I have it and yet remain distant from it or that I am not personally and in myself [selbstisch] wrapped up in it? P: As if it were necessary to pull out of the issue once more or required a more radical freeing oneself from it—more radical than the one we found necessary in the progression to sensation. That’s how I see it now. M: A pulling itself out once more that nevertheless does not amount to losing that from which one is freed? P: Just as the first freeing could only lead to personal mastery and sensation because the first indwelling continued to exist at the same time. M: This indwelling on the basis of sensation, however, is and remains one of the self? P: The self is wrapped up in it, as you say? M: The self is and remains within it personally burdened from and by that from which it has been withdrawn. By it, the self is tied into, fixed into, embodied into the issue that it senses, albeit in the final account personally withdrawn from it. {214} P: Otherwise it would no longer be the body of the animal for instance, if the animal were in this sense wholly removed from it itself [selbstig]. M: Very much so. For that is what defines the nature of one’s own body or of being embodied, that the self here appears fixed into the fullness of its selfhood. P: This almost makes it seem as if one could sense only one’s own body or could “have” it in terms of sensation. M: And the same goes for everything that comes close enough to be sensed— what touches it immediately and with it comes into the area of what is mastered and had by the self. But you are right in one respect: the body or the self, placed into being there in body, remains the irreversible basis of all possibility of sensation. Body and sensation stand in a just as irresolvable connection of being [Wesenszusammenhang] as… P: Spirit and understanding.

144

Metaphysical Conversations

M: Perfect. But you do realize that the “body” here is in no way limited to the material body, but encompasses everything that enters into the being posited in body [leibhaft gesetzte Wesen] in full measure. P: Psychic sensations, i. e., feelings, already speak in favor of this. M: Oh good. For in that case I also “have” and experience in terms of sensation, inasmuch as I live bodily in the internalized self—in final personal withdrawal and centrality. {215} P: But, Montanus, you want to describe the understanding as a kind of having, without the self intermingling with the respective issue? M: If I live personally in and with the issue in full withdrawal of the self, then I no longer “have” it in terms of sensation but in spirit. And what a miracle that is, Psilander. What wonder is this possibility! P: A paradox. M: A paradox and a wonder, which we would not be able to manage at all, if we had not already looked at the entity whose nature it precisely is to “dwell” [wesen] as it is called for here. P: At the spirit, if I understand correctly? M: Yes. Did we not see in the spirit the nature of an entity unfolding and exhaling itself in a radical selfless form? Acting in body is becoming a self, acting in spirit is undoing the self [Das Leiben ist das Selbsten, das Geisten das Entselbsten]. The being clothes itself with the body, envelops itself in it, encircles, encloses, seals itself up in itself—constitutes the being of its self [selbstig] that is monadic, separated from all others. In acting in spirit, however, it now offers again this embodied being, pours itself out, is wholly given out of and from itself, outside itself, free from itself and from the secured and delimited burden of its own self.—Thus what it touches and surrounds with spirit, must it not touch and embrace it in precisely this radically selfless manner, which showed itself to us to be a characteristic of intellectual having, of understanding and discerning? {216} P: But if every natural entity must possess “spirit” in this sense, as you taught me, then must not each also have “understanding”—even the animal, even the plant, even… the stone? M: Oh really, Psilander, you should know better! If something is an organ for a being, then surely it must first of all in some way “have” it… P: And not have it in an objective sense as the plant has its embodied figure, with which it nevertheless does not sense, but in a personal subjective sense as the animal its body—I understand and am blushing. M: Did we not say that the spirit rises up out of the animal and beyond it, unreachable for it itself, which remains left submerged into the soul-center of its self? And thus it also has no mastery over this its own soul-center, in which it nevertheless lives immediately, and no free knowledge of it…

Concerning the Human

145

P: That consequence had been drawn long ago… I know. We already saw that the human, in contrast to the animal, in order to become just as free of its souled self as the animal is of its bodily self in contrast to the plant, must be placed out of this soul-center in the same way as the animal is placed out of its bodily figure. In both cases there must be a standpoint “beyond.” Indeed, we already determined that in the case of the human this new standpoint can be only the spirit and nothing else. {217} M: Though still in a somewhat questioning manner. But now we saw that the human is able, precisely in and with this spirit, to enter selflessly into all things that the spirit is able to reach in and for itself and to “have” them, without being intermingled or burdened with them in itself. The human departs from itself with and in this spirit and attends everything the spirit embraces by viewing and comprehending it. Or is it not like that? Or do you want to object now that it is not at all the case that we are just borne and carried along, inhale so easily and obviously and passively all we know and see, but, to the contrary, must ever anew raise ourselves up to the things, go to them, and plow them up only through laborious and highly active acts of thought, in order to snatch even just the scarcest morsel from them? P: Indeed, I was about to voice a similar objection. And maybe this is connected to another point that still confuses me. The animal becomes master over the body by gaining its standpoint beyond the body in the soul-center; yet precisely here, where it now has its standpoint, it is—as the plant in its bodily being—submerged and not master and possessor. And would not humans in the same way, even if they became master and personal possessor of the soul via their elevation above it, appear all the same just as imprisoned and drowned into their spirit as the animal into its soul—unless yet a new standpoint beyond it has been won? {218} M: If we only want to draw analogies rather than looking at the matter itself and the modifications it brings with it, then that can certainly disconcert us a bit. But maybe, Psilander, this rising up into spirit is different than the submerging into the soul-center—even if both times it concerns a change of standpoint and in this one point the analogy so far served us well. P: Even the different forms of expression already suggest a solution. The shifting of the standpoint into the spirit appears in itself as an elevation, while the one into the soul-center appears as a sinking down. M: Not just simply an elevation, but, as we know, an undoing of the self [Entselbstung] as such, a radical becoming free and detaching from the fixity in the enclosing and binding self. How could someone who has gained this personal standpoint in the heights appear again tied up in one’s self, given that the nature of this standpoint consists in undoing the self [entselbstet] and being free in it?

146

Metaphysical Conversations

{219} P: Thus if humans are elevated into the spirit they become not only free and master in regard to their own soul-center but also in regard to their own spirit? M: Though this being free obviously only relates to the ability to master one’s given and as such inalienable nature! P: Still, the actual capacity of mastery, Montanus, would be in a shaky position? M: My dear friend, do you really have to stir up this dark point already? Into what direction of its being can we speak of the human without encountering this crude fact of corruption? That’s what it’s like with the spirit. Instead of going in and out with it freely and “blissfully” [selig]—free in the possibility, to turn whenever and wherever or to allow oneself to be carried by it wherever the blissful pleasure of viewing and comprehending desires at the moment—we lag behind it everywhere in dark toil and can barely with greatest effort snatch a tiny light here and there. P: As if we had actually sunk back into ourselves and behind ourselves into the darkened self? {220} M: Indeed. A real downfall even inside ourselves. P: Yet this isn’t the downfall that robs us of the freedom of thought, of that standpoint in the heights as such? M: You are right, in that case we would be animals again. No. Our formal standpoint is now as ever the height of the spirit… P: That’s what turns us into a person! M: That turns us into a person. It seems to me that we have now managed it. What makes the person a person is the formal constitutively being elevated in terms of being into the self-less [entselbstet] heights of the spirit. P: And this brings with it the aspect of uprightness and nakedness that we grasped immediately as a characteristic. M: It seems to me that we will come back to this happily reached and most essential goal. But now, Psilander, pay attention once more to this particular issue that can be grasped only with difficulty: although in a formal sense we have certainly remained persons, have certainly not sunk back in terms of standpoint into the wholly enveloping “water” of ensouled life, into the waters from which the animals seem to groan upward in vain—and yet are sunk back into it! Yet we no longer dwell or can dwell self-evidently, freely and blissfully—if you will once again permit me this so distinctive expression—on these heights, on which all the same we have remained standing as it were empty and incapable. {221} P: We still stand on it, but we can no longer spread out into it… M: Yes, like that… or something similar. But how is this possible? How should one grasp and understand this doubled situation? That would really be a special task someday, my friend.

Concerning the Human

147

P: May I bring in something that preoccupies me already the whole time and that maybe, possibly, can also in this serve as a small clarifying contribution? In this case I will bring up your demons. What about them now? Did it not seem to us as if they also had a sort of understanding? Yet have we not now reckoned the possession of the understanding to the aspect of freely being elevated above the being tied to itself? But according to our reckoning the demons are still the drowned, the unredeemed, the quintessentially unelevated? M: Those who are not yet even embodied! P: It almost seems as if you wanted to indicate something already with this pronounced “not yet”… M: Did we not call the demons “spirits”? P: Spirits of hunger, spirits from lack, spirits without substantiality. M: Quite right. And although they are spirits from lack, spirits that not only do not elevate themselves out of the fullness of the substantiated self but that cannot even reach this self, they are still precisely spirits. That means they have an undetermined, unembodied, selfless being! {222} P: Albeit a selflessness from lack and not one that has overcome fullness… M: And thus a selflessness that is eternally hungering, not a selflessness blessed in contentment. P: And so you think that because they are spirit, therefore in themselves they also have the possibility of understanding? M: Something like that, yes. The possibility of becoming aware of an issue without being materially wrapped up with it is given in itself with the constitutive lack of embodiment and determination of spirit. That’s how it seems to me. One thing has to be presupposed, though: the aspect of internalizing, of centering that really alone makes an entity a personal one… P: But not already a person… M: Quite right. The demon is a personal being but not a person. It can never be or become a person because, eternally starving for its self, it is denied it to elevate itself above its, as it were, secured self and, leaving it behind itself, to live in and with the things in free selflessness. Thus free of an embodied and fixed self, because before all substantivation and thus in itself, if I may say so, endowed with spirit, the demon is still indissolubly tied to this its selfless and bodiless self, to this shadow-self. As it cannot even elevate itself to itself, how could it elevate itself out of itself and beyond itself out in free dedication? No, only what falls into the personal circle of its craving and starving selfhood, what personally touches it, arouses and concerns it, can be experienced, had and comprehended. {223} P: We called that earlier an understanding of “soul.” And the animal doesn’t even have one like that?

148

Metaphysical Conversations

M: In either case the actual animal does not. And tied and fixed into its material embodiment it is also in this regard quintessentially a sensing and sensorily experienced being, but not an understanding one. Still, my friend, at times it seems to me that it would not be an essential impossibility in the circle of animal constitution, if a pronounced internalization of soul, that is, one that in presupposing the soul as living abode does not relate to the body, is now in turn constituted inside this “soul” in personal centralization. P: Thus even a kind of “understanding of soul” would not be impossible. M: Nevertheless, it would and could never be one of spirit. It would never turn the animal into a person. {224} P: The possibility of an animal really speaking is comprehensible really only from here. M: You mean a speaking, in which not only the nature of the animal becomes objectively made known, but one where the animal itself personally forms and pronounces the words. P: Yes. M: And hence the animal could pronounce from out of its personally internalized being what it is and desires, what moves it and distresses it? And we aren’t making up fairytales here? P: Unless the fairytales harbor truths that actual existence denies. M: What remains most important is not to wipe out the insuperable difference in nature between human and animal. Not to engage in anthropomorphizing. P: This is a new insight for me that “understanding” and understanding, speaking and “speaking” are not the same. And that one cannot reckon the human solely in terms of understanding and speaking, but… M: In terms of the freedom of the understanding and the freedom of speaking. P: Here the same distinction is relevant that became clear to me about the difference of bodily movements at the very beginning of our conversations: in this case the animal would have to speak what it speaks and hence would be radically unfree; yet it would speak personally and itself what it speaks! {225} M: Internalized into itself it could personally speak what it speaks, but it could not be elevated beyond itself, could not be master over this speaking itself breaking forth with the violence of its urging life and nature. P: Yes. M: Its word would stem from the dark enclosure of its unredeemed self… P: As in the most cases also our own word! M: Yes, Psilander. And yet ours should stem from the luminous being disclosed of this redeemed self. For we could say that humans live according to their real determination and formal nature of being [Wesenheit] in their own light. P: Now you are again identifying light and spirit…

Concerning the Human

149

M: Not all light is spirit, but all spirit is light. P: Insofar as spirit presents and reveals a being in selfless and entirely undetermined form? {226} M: “Reveals in selfless form”! It reveals it precisely because here the nature of being is no longer given from itself in self-owning delimitation, enclosing, and weighing down. Yet when the element breaks forth luminously from itself, then is it not downright and really moved to ecstasy? Opened all the way through and freed from itself, does it not now radiate out of itself? Has it not broken through all the barriers of darkened embodiment, so as to pour itself out, offer itself, share itself freely and “blissfully”? Without thereby losing itself? P: But when you spoke earlier of a possible “acting in spirit” of material entities, did you not mean a “becoming light” limited to the level of the material? M: Certainly not. You are right to speak of a becoming light limited to this level of the material. It is and remains a “spirit” in the material and thus precisely not yet a real [reel] one, but the symbolic preliminary step for it. But now pay attention to the way in which the material light or the material that has become like light thanks to its selfless nature is able to enter into all material things, in a sense can fold itself into them and exit them again, without materially becoming wrapped up with them, without letting itself be weighed down by them or hindered by them. On its path of going in and coming out it only takes along, as it were, the particularity of its form, because it is precisely an always differently fashioned totality of form of its constitutive being, through which it goes in and out! Yet must it with and within its revealed function, which it cannot lose on its ways, now also reveal in its formal essence that with which it was thus selflessly wedded, as it were? {227} P: I have an approximate inkling of how it can become clear here, why light precisely “lights up,” that is, why it itself reveals the things on which it falls. M: And we do not require more than this inkling in order to see this analogy very clearly. For it is precisely this going in and going out that selflessly takes along only the form of things, without materially becoming tied up or weighed down by them, which is, as we saw, what is particular to the having of spirit. P: But in that case not for the light itself, but instead for everyone who sees the things; here precisely for the spirit itself, which, however, through its grasping of the things in spirit does not without further ado also reveal them to others! M: The light, however, cannot “see” the things that it nevertheless reveals, because it does not “have” itself. And others see the things lit up still only in and with this light, in which they participate with their bodily eyes without further ado! If we were to participate in the spirit of another in the same way, as we participate with our bodily eyes in any kind of material light, then our eyes of spirit would be just as open to the objective spirit; we would see the things not only through our-

150

Metaphysical Conversations

selves and as we see them ourselves, but also with that other spirit and through it. But, as it is, we are monadic and selfishly enclosed in our own spirit… {228} P: That is also a result of that “downfall” into the selfishly burdening deep? M: Perhaps. P: Yet what you wanted to say is that we live all the same in our own light, “have” it in personally internalized fashion and accordingly can with it and in it participate in everything in spirit that it is able to reach in itself. M: Thus, how could we, for example, not see and grasp ourselves in this our own light! P: In this way the nature of self-consciousness becomes much clearer. M: Surely. But, Psilander, let us not forget the presupposition for all of this— the ontic presupposition, which in its most wonderful manner remains the most important thing that has to be comprehended here: this personal being elevated [Erhobensein] itself, the possibility of this true being lifted from [Enthobensein] selfish enclosure. This selfish enclosure nevertheless remains what it is and in no way becomes resolved, which leads to the curious reality that humans not only live in their final depths but also above themselves. By living above themselves they leave themselves underneath themselves. And precisely themselves or their “self,” that is, their entire being that is at the same time—or precisely through it!—personally experienced and had, fixed in selfish enclosing! Dwelling in their own depth, they are still enthroned above themselves. {229} P: Is it like that with every person as person? M: You mean, for example, also with one that is pure spirit? P: Yes, for example. M: Indeed, the formal-constitutive decisive aspect of the person is this personal being lifted up from self-owned embodied delimitation, this free being enthroned above the “self ”—and in this alone the strange and formally decisive paradox of being is already given. But with persons that dwell entirely in and as such in the spirit this possibility does not seem materially entirely incomprehensible, for “everything is possible to the spirit.” The spirit is in and for itself radically free, lifted up, in and for itself stemming from the height and the light and enclosing itself in the heights and in light. Obviously here we are speaking only of substantial spirits, of spirits from fullness, not from lack. P: Because the latter can never elevate themselves to themselves, much less above themselves. {230} M: Quite right. Thus, it seems easier for us to grasp in the case of those substantial spirits, how they dwell at the same time in themselves and above themselves, can at the same time be themselves and yet be above themselves. But now for the human! Here we are on the ground of an in and for itself abysmal nature.

Concerning the Human

151

Here the self does not constitute itself from the fullness of spirit, but from the fullness of natural and subterranean powers! We have here darkness, depth and weight of the constituting native soil, not height and light. P: Now you are touching on the opposition that seemed to us to secure in the earlier conversation precisely the necessary possession of a soul in the case of the human in contrast to the essential lack of soul of any pure spirits? M: Certainly. But you’ve got to understand that one can take “soul” also in a broader and in a narrower meaning. In the broader sense it is the qualifying ground of any living being—and in this sense the spirits would also have a soul, even if just a soul of “spirit.” Yet soul in the more precise and narrow sense applies to that natural ground and center that takes its fullness and its life from the depths and the darkness. P: And here, in turn, we distinguish between impersonal and personal soul… M: Only with the latter have we reached the real meaning, the quintessential meaning. {231} P: In regard to that, one can then really say, as we said back then, that only the human has a soul. The other beings of nature or the pure spirits do not. The former because their soul is impersonal, the latter because it is one of spirit. M: Quite right. And now you see the human—rooted in abyssal depths and freely raised above itself! Growing from darkest native soil and enthroned in light! The demon at its feet and the angel above its head. P: If the demon does not grow above our head and the angel vanish. M: As is the case by the same token in the case of fallen humans. But we already said: the formal-constitutive being elevated remains the same… P: This is the sole reason why redemption might be possible…? M: The sole reason why a rebirth would be possible. As a material being reborn of humans there where they formally and as persons always have their location of birth. P: Their location of birth? Should one not speak of that precisely in regard to the depths? In regard to the dark native soil, as you called it? M: It seems to me that humans are born twice. Maybe that’s precisely the secret of their nature. {232} P: When we talked about the “soul,” you said—I remember it very clearly —that the human, as necessarily all beings, is posited and constructed from a single locus. M: Did I say that? Oh, Psilander, we are searching and developing. But maybe we meant something there and something else here—despite the apparent contradiction. Remember what we said about the evolution of plants and of animals. Remember the configuring logos that—almost as pulling them or standing above them—allows them to become what they are supposed to become.

152

Metaphysical Conversations

P: Guiding the plant up to the light, breaking open in the animal the abyss of its being in the soul. And now in turn it raises up and guides up the human from this abyss into the light? M: Yet this light is now a wholly different one, a true light, the light of the spirit! P: And it thus becomes at the same time our personal light, because we are precisely guided up toward it. Do I correctly understand this point? M: That’s what I wanted to say. But does not something happen here that cannot be compared with anything discussed so far? Does not the line necessarily break off here from below, in order to make place for something new and unheard of? P: I do not quite understand yet. {233} M: The evolution of plant and animal required a forming, guiding power of the word that worked in it through and through and always anew, so that the abundance of figures could push up and become what is given. But it pushes up precisely from below; it grows up entirely and ultimately from the soil of nature craving upward and encloses itself in it as such. Encloses itself necessarily in it! For nature—in the earthly, no longer in the subterranean sense—is what is embodied, fixed, closed, and enclosed: it can certainly exhale “spirit,” but it will never become itself and personally spirit. For that would mean to dwell personally in freedom, to be no longer just fashioned and enclosed in configuration, but a free self and thus no longer “nature.” P: But the human grounds in nature and yet dwells [west] in freedom, is a free and only thus a wholly personal self… M: Yes. And we say that for this humans must be in themselves elevated to it, must in themselves be elevated beyond themselves. But how is this elevation possible without precisely a personal “fastening,” as it were, into this height, into this realm of spirit? Without a “birth” also from here? In order to grasp it entirely, Psilander, one must keep in mind the point of the “becoming I” [Ichwerdung] that cannot be compared with any other being or positing. For being a spirit in a personal sense or having a spirit in a personal sense, is not possible without being an I. And that’s what requires this curious absurdity of a personally radically new and free “beginning.” A self without selfhood, a beginning without content, an existing without being, and with all of this emptiness and vacancy and freedom just the quintessentially personal! {234} P: This brings up infinite attempts in the history of philosophy of trying to grasp this—all the way to Fichte who maybe conceptualized it with the greatest genius. M: Infinite attempts! But you understand that it is closely connected with what we said about the nature of spirit. For what except solely such an “I” can be personal spirit and also in radically selfless form dwell personally?

Concerning the Human

153

P: This relationship is now entirely clear to me. M: Do you also see that such a beginning cannot be created, posited or formed out of nature and with it? That only the progenitor himself can elevate himself from the unfathomable primordial grounds of his nature to the radical freedom of himself from eternity to eternity, can generate himself for free primordial beginning in himself? And that now everything that should dwell and live in the same freedom as spirit, is able to do so only in the personal participation in this one substantial primordial spirit and primordial beginning? For how should a finite, a creaturely being, be able to stand and exist for itself alone as beginning, [exist] for it alone in radical freedom? No, it is an I only by immediately coming forth from the primordial I [Ur-Ich]—not as created, but as abidingly generated or birthed from it or dwelling in it; it is impossible otherwise. {235} P: I grasp it as if from afar. M: And I no differently. Let us leave all of that in suspension for now. But we have to touch on it, if we want to reach even a first shadowy attempt at a sketch of the ontic foundations of the human. For now it is somewhat clearer, what it might mean when we speak of a twofold birth. Generated and formed from the qualifying unfathomable primordial grounds of nature, the human is also at the same time born of “spirit”—personally dwelling from below and from above. P: But when you said that humans as human live in their own light, that is, in their own spirit, didn’t you mean by this the spirit of their being that is qualified from below, their selfish being… M: The spirit that proceeds by the same token from them as living beings of nature… P: Yes. M: Certainly. {236} P: But just now it almost seemed as if this spirit could be constituted only in the immediate and personal participation in the spirit of God! M: Here you touch in fact on the most particular and most difficult point. We can live in our own spirit personally only inasmuch as we—first formally—live in the spirit of God. We can dwell as a free I only beyond ourselves and in our own spirit, if we dwell formally in the “primordial I.” P: You want to say something decisive with this “formally”? M: Yes. Namely that the human is formally fastened “in the heights” and from there takes the possibility of grasping and possessing itself as person in radical freedom, elevation, and self-glorification. Yet, at the same time, in our entire material being we stem from the depths and are generated out of it. P: Earlier it seemed as if this opposition of formal elevation that is lacking material content were taking place only in the “fallen” human. By contrast, the integral human would materially and formally live on and from the heights.

154

Metaphysical Conversations

M: Are we not confusing two different contrasts of “formal” and “material” here? It seems to me a primary and basically essential insight that regarding the entire personal matter of his or her being the human stems from the depths, is qualified and “born” from there. That the human qua human is born of nature, not a being born of spirit! {237} P: And that was what you wanted to determine especially in our former conversation about the soul? M: The only thing we had in view back then—and were solely permitted to have in view and fix as a first strong insight. Humans take themselves wholly and entirely from below; but in order for them to be able to take themselves from below as persons, they have to take their freedom in the spirit from above. Only in this way does not only their spirit, but also their soul become their own free personal possession. Thus they become enabled to guide everything that lives and urges in the darkness of their soul up to light and into freedom. P: Accordingly their birth “from the spirit of God”—may one put it like this?— first of all has to be thought only as a formal one? M: Yes, that’s how it seems. But there are evidently two things in play here: this truly real living “in the heights” in the case of the integral human and the still merely shadowy one of those gliding and sinking down. This is the second contrast of formal-material, which has an entirely different sense. You see, Psilander, this locus of absolute freedom, this locus of free birth of the I or constitution of the I is necessarily the metaphysically open gate through which the spirit of God can freely pass. Humans have their own spirit stemming from the depths of their personal individual being; but the human can be transfigured and raised into the absolute through God’s spirit. And can do so only through God. Or the reverse: God’s spirit will have to be reflected and exhaled only through the human spirit in the particular coloring and refracting, which is precisely conditioned by the grounds of nature in the specific form of the qualifying being of the human. {238} P: Yet the spirit of God is darkened and disfigured in this way in a terrifying manner! But this is what you just called the consequence of this “downfall,” its “punishment”? M: At the moment when humans wanted to absolutize themselves in their own spirit, no longer wanted to offer it up and return it as everlasting gift, they necessarily lost also the possibility of living on the freely and radically selfless heights of their own spirit substantially. Sunk down in this way into the selfish depths and unfathomable deep of their embodied being, they can now also only exhale a selfish spirit, no longer a free and pure spirit. Instead of being the clear and merely tinting mirror of the spirit of God, they no longer allow this spirit to penetrate the smoldering, impure, materialized flame of their spirit at all. {239} P: You bring humans and God into a rather close personal relationship!

Concerning the Human

155

M: Do not all the mystics say that the triune Godhead lives personally in the soul of the human, that the blessed can feel it, see it, even touch it? P: In the soul? Does that not contradict all our specifications? M: Because we seemed to determine the spirit as the abode of personal participation in the Godhead? P: Yes. M: The Godhead cannot be present in this highly personal manner in the natural soul, insofar and as long as it is just natural! That’s how it seems to me. It is only possible where the soul of the human goes forth or is fastened in spirit and from spirit, as a second birthplace! Maybe this is what mystical reports mean when they speak of the “most tender” or “outermost tip” of the soul, in which these experiences take place. Yet, as a whole, my friend, in all of what we have dared to say here, the totality of the human in his or her true unity and unification is not even touched upon. Let me just hint at one thing for now: several times already we have spoken of the words that the being endowed with spirit can pronounce with a kind of internalizing, embodying and fixing itself accomplished in spirit. “In spirit”— and yet the words of the human come “out of the heart.” At least all substantial, all true words. {240} P: Out of the heart? What is the heart? M: Does it not seem to you as if it would be an absurdity to speak of humans “without heart”? In that case, they would be without this middle into which their entire being is taken and placed, as it births, unfolds and pours itself into soul, body, and spirit. They are, as it were, centrally knotted and fastened into this center. All the “blood streams,” all the paths of personal life run together in it, in order to go out again from there. The human can say, desire, and do nothing as a whole, wholly personally, that does not stem from this middle of the self, in which alone precisely one’s whole being is posited in one. Everything else is empty, unsubstantial, and in a personal sense without being. P: Did you not once earlier—I think it was according to a word of Jakob Böhme —call the Son of God the heart of the Father? M: Oh yes. For the Son of God is just the glowing being of the Father posited in one. Pay attention to how curious this is: that here at the highest and final place, that here in the center finally everything falls together, what is set apart in the creature in regard to configuration; that the Son of God can be called the word, the body and the heart of the Father in the same precise sense of the word and yet is himself person in the highest and truest meaning of the word. But now, Psilander, it seems to me, that we have in a sense talked ourselves to the end and that we would have to start over from the very beginning if we wanted to snatch something new out of the infinity of possible disclosures.

German Original Texts

Phänomenologie und Spekulation {1} Man kann heute von Phänomenologie in einem dreifachen Sinne sprechen. Husserl war transzendentaler Idealist. Das Sachgebiet, auf das sich die phänomenologische Forschung nach Husserl allein beziehen kann, beschränkt sich auf die Gegebenheiten des reinen Bewußtseins. Nur das reine Bewußtsein besitzt nach ihm das eigentümliche Signum der Absolutheit, das die Wissenschaft der Phänomenologie gewährleisten kann, weil es nach Husserl nulla re indiget ad existendum. Dem Bewußtsein steht die reale Welt – als reale – gegenüber. Ihre Realität mußte eingeklammert werden, um das reine Bewußtseinsphänomen der Welt zu gewinnen. {2} Mit diesem grundsätzlichen Ausgangspunkt der Husserlschen Lehre wurde der seit Kant herrschende transzendentale Idealismus einem nicht mehr überbietbaren Höhepunkt zugeführt. Wenn jedoch die Wirklichkeit der Welt eingeklammert wird, dann ist meiner Meinung nach das Vollphänomen „Welt“ in seinem Zentrum gestört. Denn Seinsrealität gehört zum Wesen der Welt unabtrennbar dazu. Damit ist die erkenntnistheoretische Frage, ob es eine solche wahre, nämlich reale Welt gibt und ob die sinnlich wahrnehmbare Welt, in der wir leben, eine de facto reale Welt darstellt, nicht beantwortet, ja nicht einmal angeschnitten. Für Husserl war nun freilich – und das war sein großer säkularer Durchbruch – diese Welt des reinen Bewußtseins, deren Realität eingeklammert werden sollte, nicht mehr nur psychologische Gegebenheit. Es gab für ihn zwei Stufen notwendiger Einklammerungen¹, die zur Phänomenologie führen: 1. die erwähnte Einklammerung der Realität Welt, so daß als thematisches Sachgebiet nur das reine Bewußtsein übrigbleibt; und 2. eine weitere „Einklammerung“, die aus den psychologischen Fakten das Eidos derselben gewinnt. Ich halte nun weder den in diesem zweiten Falle benutzten Begriff der Ideation noch den der Einklammerung für sehr glücklich. Was aber Husserl damit im Auge hatte, war in einer Weise grundlegend, wie es kaum genügend charakterisiert werden kann. Es war eben der Schritt zur echten Phänomenologie. D. h. es war der Schritt von einem bloßen zufälligen Faktum, das nach seiner empirischen Feststellung so, aber auch anders sein kann, zu dem, was eine Gegebenheit zu einer wesenhaften macht und deshalb nicht von ihr abgetrennt werden kann. Ich komme darauf zurück. {3} Jetzt nur dieses. Husserl hatte durch jene erste Einklammerung der Realität das Forschungsgebiet der Phänomenologie auf das reine Bewußtsein eingeengt. Innerhalb dieser Einengung hatte er den entscheidenden Schritt getan vom bloßen Faktum einer Sache zum Wesen derselben. Das ist bis heute grundlegend. Wo aber  Nach den ‚Ideen zu einer reinen Phänomenologie und phänomenologischen Philosophie‘, Bd. I, Halle 1913. https://doi.org/10.1515/9783110763096-006

160

Phänomenologie und Spekulation

blieb die Welt? Nur innerhalb des reinen Bewußtseins gab es echte Phänomenologie. Dort gab es sie wirklich! Aber die unendliche Fülle der Gegebenheiten, die kraft ihrer Realität das reine Bewußtsein transzendieren, wurde ausgeschlossen. Die reale Welt stellt aber doch ein unerschöpfliches Areal von Wirklichkeitsbeständen dar, die auf ihr realitäts-gegründetes Wesen hin zu befragen sind und der phänomenologischen Forschung erst den unerhörten Reichtum geben, den sie rechtens besitzt. {4} Wir haben eine erste Art von Phänomenologie kurz umgrenzt, die transzendental-idealistische Husserls². Wir kommen zu einer zweiten Art, die ebenfalls von derjenigen, die ich im Auge habe, abzutrennen ist. Heidegger ist ein Schüler Husserls. Er ist es bis heute unverkennbar. Aber er ist einen philosophischen Weg gegangen, der ihn weit vom transzendentalen Idealismus abführte – in eine Richtung, die bekanntlich von ungeheurer historischer Wirkung bis heute war und ist. Vom reinen Bewußtsein ist bei Heidegger nicht mehr die Rede. Heidegger hat die reale Welt an einer ausgezeichneten Stelle wiedergefunden und an eben dieser Stelle den transzendentalen Idealismus überwunden. Dieser Punkt ist die menschliche Person oder vielmehr das Zentrum der menschlichen Person, das „Dasein“. {5} Ich möchte einige Sätze aus einem Aufsatz über Heidegger zitieren, den ich 1933 veröffentlichte³. Sie standen dort in einem Zusammenhang, in dem ich auch damals ausführte, daß die idealistische Philosophie das reale Sein der Welt destruiert. Ich fügte hinzu, daß Heidegger – auf einem paradoxen Wege – diese Destruktion bis zu einem Punkt führte, von dem aus es nur noch eine Peripetie geben könnte, oder die eigentlich an diesem Punkt schon eine Peripetie ist. Ich sagte damals: „Heidegger setzt als echter Ontologe das Sein zunächst und zuerst in seine vollen und ganzen Rechte ein. Wenigstens an der einen Stelle, die im Mittelpunkt seines philosophischen Interesses stand: am Ich. Man kann wohl ohne Übertreibung sagen, daß in der ganzen Geschichte der Philosophie das Ich noch nie in seinem der Existenz aufs tiefste verflochtenen Wesen so geradeaus, so rücksichtslos unidealistisch ergriffen und begriffen worden ist wie von Heidegger…“ „Hier wird nicht mehr, wie in der ganzen idealistischen Philosophie, Sein aus Bewußtsein verstanden und Bewußtsein als letzte unauflösliche Urgegebenheit genommen, sondern es wird umgekehrt die Wesensart der ‚res cogitans‘ (des ichhaften Seins) als eine letzte Weise des Existierens oder des Seins gefasst …“⁴

 Vgl. hierzu auch ‚Schriften‘ I, S. 19 ff. und im vorliegenden Band S. 399 ff. (d. H.).  ‚Heideggers Sein und Zeit‘ in: Deutsche Zeitschrift, München 1933. (‚Schriften‘ I, S. 185 ff., vgl. dort zu Heidegger auch S. 25 ff. (d. H.)).  A.a.O. in ‚Schriften‘ I, S. 186 (d. H.).

Phänomenologie und Spekulation

161

{6} Das Existieren wurde nach Heideggers Sein und Zeit als ein „sich auf sein eigenes Sein Verstehen“ bestimmt, als ein „sein eigenes Sein Können“. Genau das ist aber, so meine ich, der tiefste Sinn von „Wirklichkeit“. Ich hatte schon früher in meiner ‚Realontologie‘⁵ Realität in analoger Weise bestimmt, damit aber nicht etwa nur, wie dann Heidegger, das personhafte Sein bzw. das „Dasein“ gemeint, sondern alles wirkliche Sein schlechthin, alle Realität. Damit wollte ich nicht etwa die gesamte Wirklichkeit personalisieren oder psychisieren. Nichts liegt mir ferner. Es gibt im Gegenteil so viele grundlegend verschiedene Stufen der Wirklichkeit, grundlegend verschiedene Stufen des ‚sein eigenes Sein selber Könnens‘ als es grundlegend verschiedene Arten von naturhaften Entitäten gibt: anorganische, vegetative, animalische, menschlich personhafte. Was aber diese wesensverschiedener Arten sämtlich zu wirklich Seienden macht, ist eben dieses „sich in seinem Sein selber Können“. Daß das auch in impersonaler, ja schlechthin unpsychischer Weise, beim Anorganischen und rein Vegetativen, möglich ist, scheint mir eins der wichtigsten philosophischen Fakten zu sein⁶. {7} Heidegger hatte mit seiner Bestimmung des ichhaften, personhaften Seins als eines „sich selber könnenden Seins“ eben dieses im Kernpunkt der Realität getroffen. Nicht das Bewußtsein, sondern das „sein eigenes Sein selber Können“ macht nach ‚Sein und Zeit‘ das Wesen der menschlichen Person aus. Aber diese Einschränkung nun eben, die im gesamten Existenzialismus – so tief divergent die Richtungen immer sind – implizite enthalten ist, diese Einschränkungen des Daseins auf die Person entkleidet zugleich die ganze nicht- oder vor-personhafte Welt von derem wahren Realitätscharakter. Nur das Ich, nur der Mensch hat noch Dasein oder ist vielmehr „Dasein“. Alles andere soll nurmehr noch „vorhanden“ sein. Was für ein Grad von Seinsabwertung in diesem allgemein existenzialistischen Ausdruck der„nur Vorhandenheit“ steckt – gegenüber dem wahren personhaften Existieren – ist jedem klar, der etwas vom Wesen des Existenzialismus geschmeckt hat. Das „nur Vorhandene“ ist das objektiv-gegenständlich Gehabte – aber ohne alles wirklich eigenständige Existieren. Höchstens geht man mit den Gegenständen um, besorgt sie, entwirft sie usw. Aber ihre Existenz, ihr Dasein? Das tief in sich selbst hineingesenkte Dasein der ganzen geschöpflichen Welt? {8} Um nun auf unsere eigentliche Frage zurückzukommen: Heidegger hat am persönlichen Ich den Idealismus radikal überwunden. Das ist klar. Das personhafte Ich ist nicht mehr Bewußtsein, sondern Existenz, selbsthaftes Sein. Das Tor scheint  Jahrbuch für Philosophie und phänomenologische Forschung VI, Halle 1923 (vgl. dazu auch ‚Das Sein‘ München 1957, und ‚Schriften‘ I, Erster Teil (d. H.)).  Hierzu viele meiner späteren Schriften, besonders: ‚Die ‚Seele‘ der Pflanze‘, Breslau 1934 (jetzt in ‚Schriften‘ I, S. 276 ff.); ‚Der Selbstaufbau der Natur‘, Hamburg 1944 (2. Aufl. München 1961); ‚Bios und Psyche‘, Hamburg 1949.

162

Phänomenologie und Spekulation

weit geöffnet zu einer neuen, wahren Ontologie. Es war weit geöffnet. Dann wurde es von Heidegger selbst wieder zugeschlagen, verriegelt, verrammelt (so sagte ich damals), – so sehr, wie es durch den transzendentalen Idealismus niemals geschehen konnte. Denn dieser hatte überhaupt keinen Begriff von wahrer Realität. Heidegger aber hatte ihn und mit ihm der ganze heutige Existenzialismus. Aber eben nur an dieser einzigen, nämlich menschlich-personhaften Stelle. Was dabei an philosophischen Einsichten, an wahren realistischen Früchten herausgesprungen und der Philosophie nicht nur, sondern auch der Geschichtswissenschaft, der Soziologie, der Kunst, der Theologie zugeflossen ist, weiß jeder entsprechende Wissenschaftler in seiner Weise. Es ist ein Reich von neuen, im seinshaft personalen Sein eingewurzelten Phänomenen, die da entdeckt wurden und werden. Eine wahre Phänomenologie der menschlichen Person, auch in Begegnung mit anderen Personen⁷. {9} Zwei Arten von Phänomenologie, die transzendental idealistische und die existenzialistische stehen vor uns. Sofern sie je zu Metaphysiken ausgebaut sind, verstehen sie einander nicht. Sie sprechen verschiedene Sprachen. Es brauchte nicht so zu sein. Soweit es hier und dort um echte Phänomene geht, die in ihrem Eidos ergriffen sind, könnten sie von jedem, der überhaupt einen Wesensblick besitzt, verstanden werden. Die im Bereich des reinen Bewußtseins entdeckten Phänomene behalten ihren Wesensort und ihre Gültigkeit. Die im Bereich der wahrhaft existierenden Person entdeckten Phänomene behalten ihren Wesensort und ihre Gültigkeit. Beide Bereiche mit ihren Beständen widersprechen einander nicht. Wenn sie es tun, sind sie falsch gefaßt oder wesensmäßig überinterpretiert. {10} Was ist es mit der dritten Art von Phänomenologie? Mit derjenigen, auf die ich abziele? Es gibt ja nicht nur das reine Bewußtsein, es gibt nicht nur die existierende menschliche Person. Es gibt nicht nur das, was relativ auf das intentional ausgerichtete reine Bewußtsein ist, nicht nur alles das, was relativ auf das existenziell die Welt besorgende, entwerfende und erlebende personale Dasein ist. Es gibt auch die Welt selber in ihrer eigensten Seinsunabhängigkeit von Bewußtsein und vom existierenden Ich. {11} Ja, „gibt es“ diese? Können wir menschliches Bewußtsein und Welt trennen? Ist es nicht eben das menschliche Bewußtsein nur und allein, das diese Welt

 Hierüber vermittelt F. J. J. Buytendijk in seinem Artikel ‚Zur Phänomenologie der Begegnung‘ in: Eranos-Jahrbuch, 19 (1950) im besonderen tiefschürfende Einsichten. Übrigens ebenso innerhalb der Ausführungen seines Werkes ‚Die Frau‘, Köln 1953. Man möchte sagen, daß seine meisten physiologischen bzw. psychologischen Konzeptionen und Veröffentlichungen früherer Zeit die radikale Klärung dieser ontologisch-phänomenologischen Herzstelle (das Wesen der „Begegnung“ nicht nur von Menschen untereinander, sondern auch zwischen Menschen und Tieren sowie Tieren untereinander) vorbereiten.

Phänomenologie und Spekulation

163

„hat“? Oder ist es das sich in der Welt und mit der Welt entwerfende personale Ich, von dem die personal entworfene Welt nicht mehr abgelöst werden kann? Heißt es nicht sehr altertümlich, vorkantisch, vor allem vorexistenzialistisch denken, wenn wir uns getrauen, wiederum von einer „absoluten“ Welt, einer an und für sich bestehenden zu reden? Haben nicht sogar die Ergebnisse der neuen Physik, der Relativitätstheorie und der Quantentheorie, diese Nichtdurchschneidbarkeit von Subjekt und Objekt, von subjektivem Untersuchungs- und Beobachtungsergebnis und objektivem An-sich in ihrer Weise nachgewiesen? {12} Was das Letztere betrifft, nämlich die philosophische Deutung der neuen Physik, so habe ich darüber meine eigenen, wie ich glaube, durchaus sachlich zu begründenden Gedanken, – die selbstverständlich die heutigen mathematisch und experimentell gesicherten Ergebnisse der Physik in keiner Weise anrühren. Im Gegenteil, sie sind es ja gerade, die neue philosophische Interpretationen fordern, nur eben, wie ich glaube, gerade nicht idealistische oder existenzialistische⁸. {13} Bleiben wir zunächst auf rein philosophischem Boden: Wie steht es mit der möglichen Seinsunabhängigkeit der Welt von Bewußtsein und Ich? Vorhin schon wurde gesagt, daß solche Seinsunabhängigkeit ⁹ zum Wesen einer wirklichen Welt gehört! Wenn die Welt, in der wir leben, keine Seinsselbständigkeit besäße, sondern z. B. nur eine Art indischer Maja darstellte, dann wäre sie eben keine wirkliche Welt, sondern nur eine vorgetäuscht wirkliche. {14} Wir kommen hier gleich zu dem innersten, tiefsten Punkt dessen, was Phänomenologie ist. Gibt es ein erforschbares Wesen der Wirklichkeit, der Realität, ganz unabhängig davon, ob sie irgendwo de facto realisiert ist? Ist das nicht reine Phantasie? {15} Es gehört zu den methodischen Grundlagen der Phänomenologie, wie sie von Husserl entdeckt wurde, daß man zur Erkenntnis des Wesens einer Sache diese Sache nicht in vielen empirischen Fällen vor sich zu haben braucht, sondern daß ein einziger beispielhafter Fall genügt, um ihr Wesen zu analysieren. Dieser einzige exemplarische Fall braucht außerdem nicht wahrnehmungsmäßig gegeben zu sein – er kann in reiner Anschauung (phantasmatisch) vor Augen stehen. {16} Um Wesenserkenntnis allgemein zu illustrieren, möchte ich woanders anfangen. Man kann an und für sich mit allem, was es gibt, wie es auch immer beschaffen sein mag, theoretisch und praktisch umgehen: nicht nur mit den Dingen

 Vgl. ‚Der Selbstaufbau der Natur‘, a.a.O., Dritter Teil; ‚Naturwissenschaftlich-metaphysische Perspektiven‘, Hamburg-Heidelberg 1948; ‚Der Raum‘, München 1958; ‚Schriften‘ II (d. H.).  Diese „Seinsunabhängigkeit“ der wirklichen Welt ist nach ontologisch-phänomenologischer Einsicht ein zur immanenten Konstitution des Kosmos dazugehöriges Phänomen. Sie widerstreitet einer tiefsten, allseitigen geschöpflichen Seins- und Wesensabhängigkeit dieser Welt von Gott in keiner Weise. (Vgl. hierzu bes. ‚Schriften‘ I, Erster Teil (d. H.).)

164

Phänomenologie und Spekulation

und Verhältnissen dieser empirisch erfahrbaren Welt, sie seien physisch oder psychisch, indem man sie wahrnimmt, erkennt, mit ihnen experimentiert, sie wissenschaftlich analysiert usw., man kann auch mit Zahlen rechnen, neue Zahlarten entdecken, geometrische Gebilde konstruieren, Lehrsätze aufstellen und beweisen, Allgemeingegenstände im Abstraktionsverfahren erfassen, Ideen (die der Gerechtigkeit, die der Schönheit) in einer Art Transzendierungsakt erschauen, soziale oder rechtliche Gebilde zur Existenz bringen (z. B. durch ein Versprechen eine Verpflichtung zu einem bestimmten künftigen Tun in die Welt setzen, ob dies Versprechen nun erfüllt, abgeleugnet oder vergessen wird¹⁰); man kann Sachverhalte entdecken, ihr Bestehen behaupten oder in Zweifel ziehen, Urteile fällen oder bestreiten usw. usw. Dies alles aber können wir, ohne das eigentliche Quale, das wesenhafte Wiesein aller dieser entia explizit vor Augen zu haben. {17} Wie gelangt man zur Sicht dieser Qualia, dieser Wesensqualia? Man muß das Großartige vollziehen, daß jeder Bestand der Welt einen eigenen, ihm wesentlichen Seinsgehalt besitzt, welcher Seinssphäre oder welcher Seinsschicht er immer angehören mag¹¹. Auch z. B. etwas Irrationales, Imaginäres, Negatives, Paradoxes, auch das Nichts, wie ebenso natürlich das Sein. Sie alle haben einen wesenhaften Gehalt. Dieser eigenste Gehalt gibt dem Betreffenden zugleich eine letzte Seinsbedeutung, seinen Seinssinn. Es ist das ein Sinn, der in der Sache selbst liegt, mit der sie, unabhängig von jeder menschlichen Erkenntnis, steht und fällt. Deshalb sage ich Seinssinn oder Seinsbedeutung. Allerdings muß man, um diese Bedeutung sehen zu können, ein geistiges Organ für das Wesen der Dinge haben, das ihnen analog so entspricht, wie der Gesichtssinn den Farben und der Gehörssinn den Tönen. Auch εἴδη sieht man, oder man sieht sie nicht. Streng genommen gibt es übrigens nicht nur keine philosophische, sondern überhaupt keine Erkenntnis, die nicht irgendwie und letztlich durch das Wesen der Dinge bestimmt wird. Jede echte sprachliche und begriffliche Unterscheidung, auch wenn etwa der Naturwissenschaftler von Energie oder Kraft oder Masse, von Leben oder Organismus, von Farbe oder Licht spricht, schließt ein mindestens unbewußtes Sich-Richten nach dem Wesen der Sache ein. {18} Wir sprachen soeben von einem Seinssinn, einer Seinsbedeutung aller Gegebenheiten, die nicht vom Menschen in die „Dinge“ hineingelegt werden, sondern die sie auch an und für sich besitzen. Es gibt nämlich einen objektiven Logos der Welt und alles Seienden in seinem Sein. Das ist eins der wunderbarsten Geheimnisse. Die Welt, das Sein sind an sich selbst voller Sinn. Sie sind sinndurchwaltet. Die Gesamtheit aller res, aller entia, aller Gegebenheiten bilden einen  Adolf Reinach, ‚Zur Phänomenologie des Rechts. Die apriorischen Grundlagen des bürgerlichen Rechts‘, München 1953.  Hierzu und zum folgenden im vorliegenden Band XXI mit den dort angegebenen Hinweisen (d. H.).

Phänomenologie und Spekulation

165

Kosmos, einen Kosmos des Sinnes, einen κόσμος νοητός. Innerhalb seiner hat alles seine bestimmte und unverrückbare Sinn-Stelle, selbst das Sinnlose; denn letztlich ist alles mit allem anderen sinnvoll verbunden und besitzt daher an seiner Sinnstelle ein unauslöschliches Sein. So hat z. B. jede einzelne Zahl wie ebenso das gesamte Reich der Zahlen eine ganz bestimmte ausgezeichnete Sinn-Seins-Stelle, ebenso das Urteil, der Sachverhalt, überhaupt das ganze Reich des Logischen, der Werte, dann wieder die Transzendentalien, wie das Gute, die Schönheit, das Sein, dann die Urdimensionen des Raumes und der Zeit usw. usw. Dies sind nur ein paar willkürlich herausgegriffene Beispiele zur Illustration. {19} Natürlich ist dieser Sinnkosmos von der wirklichen Welt, die ja auch einen Kosmos bildet, völlig zu unterscheiden – die letztere sei Natur, Übernatur, Unternatur, sie sei physisch oder psychisch, sie sei irdisch, himmlisch oder unterirdisch. Aber umgekehrt ist die wirkliche Welt, wenn sie als solche oder ihrem Wesen nach genommen wird, in den Sinnkosmos einordenbar – wie alles Seiende seinem Wesen nach. {20} Meistens bedarf es einer langen und sehr exakten philosophischen Arbeit, bei der das geistige Auge unablässig auf die vorerst nur dunkel geahnte Sinnstelle des wesensmäßig zu Untersuchenden gerichtet sein muß, um allmählich das Wesen der betreffenden Sache herauszuarbeiten. Das ist Phänomenologie im umfassenden und radikalen Sinne. Phänomenologie gleich Wesensforschung! Phänomenologie ohne jene thematische Einschränkung, die wir bei der transzendental-idealistischen und bei der existenzialistischen Phänomenologie feststellten. Wir können deshalb dieser dritten Art eigentlich keinen Sondernamen geben, wie wir es in den beiden ersten Fällen taten. Eben deshalb, weil es Phänomenologie oder Wesensforschung schlechthin ist, ohne Abstrich und Einschränkung. {21} So kann alles, was es gibt, mit dem Blick auf das reine Wesen untersucht werden. „Wesen“ ist hierbei nichts Mystisches, auch nichts spekulativ Konstruiertes oder Erdachtes. Es ergibt sich aus dem genauen, alle Konstruktionen gerade vermeidenden Anpeilen, wenn ich so sagen darf, der betreffenden Gegebenheit selber. Daß das möglich ist, beweist die tatsächliche Wesensforschung. Es wird bewiesen durch die nicht geringfügigen Ergebnisse früherer und heutiger phänomenologischer Untersuchungen auf allen Gebieten des Seins und der Wissenschaften. Es wird vor allem demjenigen bewiesen, der es lernt, auf solche Weise zu forschen bzw. sich von dem in phänomenologischer Forschung Kundigen zum Wesen der Sache oder zur Sache selbst hinleiten zu lassen. Das Einleuchtende, Evidente, Verständliche, das Durchleuchtete, das eine Gegebenheit durch die Wesenserkenntnis gewinnt, kommt aus dem Umstand jener eindeutigen Stelle im Gesamt der Sinnbezüge. Eine Wesenserkenntnis hat deshalb ihre Verifikation in sich selbst oder gewinnt sie aus sich selbst.

166

Phänomenologie und Spekulation

{22} Man kann in einem sehr präzisen Sinne Wesensforschung mit Ontologik gleichsetzen; Onto-Logik = Ontologie. Nur muß dabei 1. das „on“ (das Seiende, das ens) in dem allerallgemeinsten Sinne des „es gibt“ genommen werden, 2. die hier gemeinte „Logik“ von dem objektiven Logos des Seienden abgeleitet werden. Der Kosmos noetós ist der logoshafte Kosmos alles Seienden seinem Wesen nach. {23} Wie aber verhalten sich die übrigen, die sogenannten eigentlichen Wissenschaften zu dieser Wesensforschung, dieser Ontologik, dieser Phänomenologie? Wie vor allem die Naturwissenschaft? Gehen wir z. B. in phänomenologischer Sicht dem nach, was Kraft zu Kraft, Energie zu Energie, Licht zu Licht, Materie zu Materie macht, so wird jeder heutige Mensch zunächst die physische Kraft, die physische Energie, das physische sichtbare Licht usw. vor sich haben. Er wird für die Erforschung dieser Dinge außerdem allein die Physik für zuständig halten. Was soll eine Wesensforschung in bezug auf solche Gegebenheiten bedeuten? Was hat hier der Philosoph zu tun? Es sieht gerade so aus, als wollten wir wieder einmal mit apriorischen Methoden das zu erfassen versuchen, was der Naturwissenschaftler in der mühseligen und so überaus erfolgreichen Arbeit ungezählter Experimente und mathematisch-physikalischer Berechnungen mit eindeutigen Definitionen und exakten Funktionsgleichungen festzustellen in der Lage ist. Als ob wir wieder die Gefahr verfälschender Spekulationen heraufbeschwören wollten, mittelst deren die Antike (hauptsächlich Aristoteles) bis tief ins Mittelalter hinein und dann wieder die romantische Naturphilosophie so grundverkehrte physikalische Angaben gemacht haben. {24} Das ganz gewiß nicht. Wer könnte das heute noch wagen. Zunächst: Wenn der Phänomenologe nach dem allgemeinen Wesen der Kraft oder des Lichtes fragt¹², so sieht er zunächst gar nicht oder höchstens beispielhaft auf die physischen Realisationen derselben. Es gibt doch auch seelische Kraft, es gibt die Kraft eines Gedankens, Kraft einer Aussage, einer Symphonie, einer Landschaft, einer Beweisführung. Es gibt die Kraft Gottes. Vielleicht wenden Sie ein: das seien alles bildliche Wendungen. Ist es aber nicht eigenartig, daß man einerseits die Verwendung eines solchen Begriffs auf physischem Gebiet durch bildliche Übertragung aus dem Psychischen erklären will – ebensooft aber auch genau umgekehrt die Verwendung des gleichen Begriffs im Psychischen durch Übertragung aus dem Physischen. Im Grunde sei, sagt etwa der Physiker, die Rede von „Kraft“ in physischen Verhältnissen nur eine bildliche Übertragung von subjektiv erlebten Muskelempfindungen auf eine physische Sachlage, die in ihrem An-sich überhaupt nicht zu begreifen ist. Dieses An-sich ist allerdings dem Physiker völlig gleichgültig, wenn er

 Er kann natürlich auch nach dem speziellen Wesen der physischen Kraft oder des physischen Lichtes fragen.

Phänomenologie und Spekulation

167

überhaupt einen Sinn damit verbindet. Er will nur für die verschiedenen Kraftoder Energierelationen eine mathematisch exakte Funktionsgleichung aufstellen. Denn nur mittelst solcher Funktionsgleichungen kann er die Natur theoretisch beherrschen, was dann letzten Endes auch zur praktischen Beherrschung derselben führt. {25} Wie ist es nun aber mit der psychischen Kraft, der psychischen Energie? Sie sind unmittelbar erlebt, sind selbstgegeben. Aber sie werden nun ihrerseits als etwas genommen, was man nicht eigentlich wissenschaftlich fassen kann – höchstens, wenn man es in physikalisch definierbare Grundlagen einzubetten vermag. Ist es aber nicht möglich, nach dem allgemeinen Quale von so etwas wie Kraft und Energie zu fragen, mögen sie physisch oder psychisch oder was immer sein? Nach dem, was sie in sich selbst, ihren eigensten Wesen nach sind? Nehmen wir ein anderes Beispiel. Es gibt nicht nur physisches Licht, es gibt auch das Licht des Verstandes, es gibt eine Freude, die lichtvoll aus den Augen strahlt, es gibt lichtvolle Ausführungen, eine lichte Landschaft, es gibt das Verklärungslicht, es gibt göttliches Licht. Sind das alles nur Bilder? Hinübergenommen vom physischen Licht? Weshalb aber, wenn wir schon so sprechen wollen, wäre eine solche Übertragung überhaupt möglich? Sie muß doch ein objektives Recht haben, ein fundamentum in re, eine sinnvolle Grundlage in der Sache selbst. Auch das physische Licht „ist“ eben nicht nur eine elektrische Wellenbewegung, entstanden aus einem energetischen Quantensprung im Atom, das nur dem menschlichen Auge subjektiv so erscheint, wie wir es eben sehen. Es ist ein „Mehr“, es ist ein eindeutiges Quale, auf dessen Wesen wir unsern geistigen Blick gerichtet halten können. Bei einer lichtverklärten Freude, beim lichtvollen Verstande ist ja ohnehin nicht von elektromagnetischen Wellenbewegungen verschiedener Frequenz und deshalb verschiedener Farbigkeit die Rede. Und doch ist und bleibt Licht eben Licht und ist nicht Finsternis – hier wie da und dort und dort. Wann ist etwas „licht“? Wann stellt es Licht dar? Durch welche Wesensmomente ist etwas in sich selbst als Licht konstituiert? Daß man so fragen kann, und daß es hier einen Weg sachgemäßer phänomenologisch-ontologischer Untersuchung gibt, ist zweifelsfrei und wird aus den bisher vorliegenden Ergebnissen phänomenologischer Forschung bewiesen.¹³ {26} Jetzt kommen wir zur entscheidenden Frage.Was haben Feststellungen der Wesensforschung mit physikalischen Feststellungen zu tun? Im Grunde ist das sehr einfach auszudrücken. Licht, physisches, naturhaftes Licht „ist“ zwar nicht elektromagnetische Wellenbewegung, die aus einem energetischen Quantensprung entstanden ist. Aber wohl sind das alles physische Fundierungsbedingungen für die Möglichkeit seines realen Auftretens in der Natur. Ganz bestimmte Bedingungs-

 Siehe ‚Realontologie‘, a.a.O., 3. Kap. IV. Abschnitt, auch S. 275 ff. im vorliegenden Band (d. H.).

168

Phänomenologie und Spekulation

verhältnisse, die in ihren funktionellen Zusammenhängen durch exakte Gleichungen faßbar werden, bringen physisches Licht zu naturhafter Inkarnation, wenn ich so sagen darf – physisches Licht, das nach seinem allgemeinen Wesen genau dem entspricht, was „Licht“ immer und überall, weil wesenhaft ist. {27} Das, was die phänomenologische Wesensforschung feststellt, kann dem, was die Naturwissenschaft feststellt, unmöglich widersprechen und umgekehrt. Beides liegt auf ganz verschiedenen Ebenen. Die beiden Feststellungsreihen können aber auch einander in keiner Weise ersetzen. Sachliches Ziel und Methode sind auf beiden Seiten vollständig verschieden. Trotzdem brauchen sie sich gegenseitig – wenn das auch den Naturwissenschaftlern wie überhaupt jedem Fachwissenschaftler merkwürdig klingen mag. Allerdings nicht braucht die Naturwissenschaft selber irgendwelche Bezugnahme auf die Wesensforschung. Sie geht auf die geistige Beherrschung der Natur aus. Das gelingt ihr vollständig durch Aufstellung funktioneller Abhängigkeitsverhältnisse. Sogar ist ihr das eindrucksvollerweise in bezug auf Verhältnisse gelungen, die sich klassisch physikalischen Bestimmungen entziehen. Ganz anders aber liegt es, wenn die physikalischen Feststellungen auf ihre realen Grundlagen hin interpretiert werden sollen. Sobald der Physiker anfängt, seine merkwürdigen Ergebnisse auf ein Weltbild hin zu deuten, wenn er also anfängt zu philosophieren – und welcher von den Großen tut das heute nicht? – dann wird die Sache anders. {28} Nunmehr einige Worte über Spekulation. „Spekulation“ – dieses gefürchtete Wort, diese gefürchtete Sache¹⁴. Thomas von Aquino sagt einmal in der ‚Summa theologica‘, daß entsprechend einer Glosse von Augustinus, die sich auf den 2. Korintherbrief bezieht¹⁵, das speculare nicht von der specula (einer Anhöhe zum Umherspähen), sondern vom speculum (dem Spiegel) abgeleitet sei. „Etwas im Spiegel sehen“ heiße aber: die Ursache durch die Wirkung sehen (causa per effectum). In der Wirkung strahle die Ähnlichkeit der Ursache zurück (relucet). Hier sei Spekulation das gleiche wie Meditation. Im ersteren Fall, wenn speculare von der Anhöhe oder dem Wachtturm abgeleitet ist, heißt speculare: genau und vorsichtig beobachten, umherspähen. Der speculator ist dann der Späher.Wer also nicht gerne mit Spekulieren im ersten Sinn (dem Zurückgehen von den unmittelbar gesehenen Wirkungen auf die nicht sichtbaren, nur in den Wirkungen sich spiegelnden Ursachen) zu tun haben möchte, der kann sich an das vorsichtige, wachsame, skeptische speculare halten. (Griechisch: die σκεπτικοί, die Skeptiker kommen von σκοπέω und das von dem σκόπελος, dem Spähort. Also genau ebenso.)

 Zum folgenden auch die vorhergehende Abhandlung (d. H.).  Soviel ich weiß, auf die Stelle: Wir aber spiegeln mit aufgedecktem Angesicht die Herrlichkeit (die doxa) des Herren wider…

Phänomenologie und Spekulation

169

{29} Im Grunde und sachlich gesehen brauchen wir jedoch beides: Wir müssen bei jeder realistischen Interpretation von den empirisch sichtbaren Wirkungen auf die zunächst nicht oder grundsätzlich nicht sichtbaren Ursachen zurückgehen, aber mit aller gebotenen Vorsicht, einem immer neuen, sachlich gebundenen Umherspähen. Was heißt hier „sachlich gebunden“? Es ist eine zweifache sachliche Bindung von sehr verschiedener Artung notwendig. Erstens handelt es sich grundlegend, wie ausgeführt, um die Übersteigung empirisch festgestellter Verhältnisse zu sachlich vollgültigen Ursachen, die nicht unmittelbar gegeben sind. {30} Zu den „sachlich vollgültigen Ursachen“! Innerhalb der Naturwissenschaft geht es nicht um sachlich vollgültige Ursachen, was man darüber auch für eine Meinung haben mag. Die Naturwissenschaft stellt bloße Bedingungsverhältnisse auf: wenn so – dann so… Nur ein post hoc, nicht ein propter hoc. Das ist das gute und bedeutungsvolle Recht der Naturwissenschaftler. Damit vermögen sie die Natur zu beherrschen. Aber hierdurch ist an keiner Stelle der wirkliche volle Ursächlichkeitszusammenhang auch nur befragt! Es geht gar nicht um ihn. Aber dem Philosophen geht es um ihn. Und so allmählich fangen auch die Naturwissenschaftler, besonders die Physiker an, wieder philosophisch zu fragen. Deshalb nämlich, weil sie plötzlich so merkwürdige Dinge entdeckt haben. Die Diskussion um die behauptete oder bestrittene „Akausalität“ in mikrophysischen Bezirken ist ein solches thematisch philosophisches Fragen und – horribile dictu – spekulatives Entwerfen. {31} Spekulationen sind immer Vorentwürfe – Vorentwürfe hinein in ein vorläufig oder grundsätzlich unbekanntes Land. „Vorläufig“: d. h. im Verhältnis zu den zur Zeit allein bekannten empirischen Tatsachen, die einmal auch empirisch begründet werden könnten, was dann die spekulativen Vorentwürfe bestätigen oder widerlegen würde. „Grundsätzlich“: Wenn es empirisch experimentell aufgewiesen werden kann, daß das „unbekannte Land“ prinzipiell nicht in empirisch zu Sichtendes und zu Bestimmendes umzuwandeln ist – wenigstens nicht mit dem klassisch naturwissenschaftlichen Erfahrungsmethoden und -kategorien. So liegt es bei den mikrophysikalischen Verhältnissen, was bekanntlich nicht gehindert hat, sie in exaktester Weise mathematisch-physikalisch zu fassen. {32} Ich sprach von dem Suchen nach der vollen Wirkursächlichkeit. Auch in bezug hierauf herrscht eine eigentümliche Blindheit in unserer Zeit, die durch die einseitige naturwissenschaftliche Erziehung entstanden ist. Ein gutes Beispiel ist die physikalisierte Biologie. Lebendige Entwicklungs-, Gestaltungs-, Umgestaltungsphänomene werden niemals vollursächlich erklärbar durch funktionelle Abhängigkeitsrelationen, wenn sie auch noch so exakt stimmen. Der Biologe hat aber empirisch nichts vor sich als materiell physische Vorgänge. Wollte er vollursächlich erklären, dann muß er von den sichtbaren Wirkungen auf die unsichtbaren Ursachen hin transzendieren oder zu ihnen zurückgehen. Er muß spekulativ entwerfen. Er muß hindurchschauen auf die mögliche Vollursächlichkeit, die der bekannten

170

Phänomenologie und Spekulation

Wirkung nicht nur quantitativ, sondern auch qualitativ kommensurabel ist. Da kommt er dann wie Driesch auf so etwas wie „Entelechie“, d. h. eine Zielursächlichkeit, die allerdings von Driesch selbst noch weitaus zu eng und einschichtig bestimmt wurde. Genau so liegt es bei der realistischen Interpretation der quantenphysikalischen Verhältnisse. Auch hier muß spekulativ entworfen werden, durchgesichtet werden in ein gegenüber den klassischen Oberflächenverhältnissen grundsätzlich unbekanntes Land. {33} Wie kann aber dabei wildes Spekulieren, können phantastische und nur phantastische Deutungen vermieden werden? Zunächst natürlich dadurch, daß man niemals das empirisch Gegebene und experimentell Gesicherte als Ausgangslage übersieht, verfälscht, gänzlich verläßt. Dieses soll ja gerade gedeutet werden. Aber nun kommt die zweite Bedingung, die bei fast allen naturphilosophischen Interpretationsversuchen heute nahezu gänzlich fehlt. Die entworfenen Deutungen der gegebenen empirischen Verhältnisse dürfen ebensowenig jemals dem Wesen der zu deutenden Sache oder Sachlage widersprechen. Ja mehr als das: Der Interpret muß das Wesen der Sache ebensogut im Blick behalten wie die zu deutende empirische Gegebenheit. Es ist z. B. nicht möglich, lebendige Formbildungsprozesse oder gar das organismische Leben als Ganzes vollursächlich zu begründen (so viel gutes empirisches Material man auch haben mag), wenn man nicht in das Wesen des organismischen Lebens oder spezieller eines lebendigen Gestaltungsprozesses einen maßgebenden Blick getan hat. Die funktionellen Beziehungen, die der Biologe herausarbeitet, was sein ausgezeichnetes wissenschaftliches Recht ist, geben die Sache nur in einem einzigen, aufs Ganze gesehen armseligen Querschnitt wieder. Sie können nicht das volle Wesen der Sache geben. Genau so liegt es in der Physik und in einem geradezu aufregenden Sinne in bezug auf die Deutungsversuche der neuen Physik. Wieviele Irrwege – hier bei der Deutung, nicht in den Naturwissenschaften selber – schon gegangen wurden und noch werden, weil dieser Wesensblick fehlt und deshalb die zu interpretierende Sache von vorneherein verfälscht wird, ist schwer auszusagen. Jedenfalls hat das schon ebensoviel Unheil angerichtet wie der mangelnde sachliche Kontakt mit der Empirie. Die spekulativen Vorentwürfe bedürfen eben beider Sachkontakte: der empirischen und der wesensmäßigen. {34} Ich bin übrigens überzeugt, daß alle produktive, alle schöpferische wissenschaftliche Arbeit (natürlich auch die geisteswissenschaftliche in weitester Bedeutung) spekulativ eingebettet ist. Allen wirklichen wissenschaftlichen Entdeckungen geht eine mehr oder minder dunkle Visio des zu Findenden wie ein zielursächlich wirkender Leitstern voran. Dabei ist der in erfolgreicher Weise produktiv Forschende immer begleitet von einem gewiß oft ebensowenig bewußten Wesensblick, mindestens einem eigentümlich sicheren Instinkt für das Wesen der Sache. Sie sehen hier deutlich, daß der Wesensblick und die spekulative Visio streng

Phänomenologie und Spekulation

171

zu unterscheiden sind, wie ebenso die reine Wesensforschung und die spekulative Forschung. Wesensforschung zielt auf das Wesen ab, das ist aber eine zum Sinnkosmos gehörige ausschließlich „ideale“ Gegebenheit. Spekulative Deutungsforschung dagegen zielt auf einen (zur Zeit noch oder grundsätzlich) unbekannten Zusammenhang ab, der dieselbe (in der Naturwissenschaft reale) Seinsart haben muß wie der zu deutende Tatsachenkomplex. Sachlich fruchtbare Spekulation schließt aber, wie ausgeführt, Wesenserkenntnis ein¹⁶.

 Ergänzend Anhang S. 497 ff. (d. H.).

Die transzendentale und die ontologische Phänomenologie {1} Es ist wohl eine einzigartige geistesgeschichtliche Situation, daß von einem großen philosophischen Meister nicht nur die verschiedensten, ja fast einander entgegengesetzten philosophischen Bewegungen ausgegangen sind, deren Vertreter sich alle auf diesen Meister als ihren ursprünglichen Lehrer berufen, sondern daß diese Bewegungen je für sich selber ein noch gar nicht zu übersehendes Ausmaß an geistesgeschichtlichem Gewicht gewonnen haben. Schon hieran sieht man, daß es sich hier und dort nicht um ein bloßes Mißverstehen der originären Lehre handelt, die aus sachlicher Unzulänglichkeit stammt. Das hat es immer gegeben. Die unmittelbaren Schüler bedeutender Lehrer sind oft die schlechtesten Repräsentanten der betreffenden Lehre geworden. Nein, wir haben drei Strömungen, die einen einzigen Ursprung besitzen, und von denen doch jede einzelne eine in ihrer Art großartige und in sich geschlossene philosophische Gesamtkonzeption vorstellt. Ich spreche von den drei bekannten, von Husserl ausgegangenen Richtungen: der transzendental-philosophischen, deren Hauptvertreter Eugen Fink und Ludwig Landgrebe waren und sind; der sog. München-Göttinger Schule, zu der ich mit vielen anderen gehöre; und von der Existenzphilosophie Heideggers. Es ist nicht zu bezweifeln, daß die an erster Stelle Genannten die wahre philosophische Intention von Husserls gewaltigem Werk im ureigentlichen Sinne verstanden und fortgeführt haben. Von Heideggers Ruf und Ruhm ist hier nicht zu sprechen. Heidegger und die große sich an ihn anschließende Bewegung hat sich schließlich, wenn auch nicht anfänglich, am weitesten von Husserls Intentionen entfernt. Über die Göttinger Schule lesen wir immer wieder, daß sie nur einzelne von den Hauptmotiven ihres Meisters aufgenommen und außerdem – weitgehend mißverstanden habe (die sog. Wesensschau, die Evidenz, das „Zurück zu den Sachen“, die Abwehr jeder Art von Psychologismus u. a.) und daß sie daher nicht eigentlich als eine historisch bedeutsame Gruppe in der wahren Nachfolgeschaft Husserls genannt werden könne. Es kommt hier äußerlich hinzu, daß die Göttinger Bewegung, die in ausgesprochenstem Maße eine „Schule“ während Husserls Lehrtätigkeit in Göttingen bildete, durch den ersten Weltkrieg, Husserls Berufung nach Freiburg, und schließlich – nach seinem Tode – den zweiten Weltkrieg mit allen politischen Voraussetzungen und Folgen völlig auseinandergerissen und dezimiert wurde¹. Jedenfalls verschwand sie in Deutschland von der Oberfläche der Öffentlichkeit. In Freiburg hat sich keine eigentliche Schule mehr gebildet. In den letzten zwei Jahrzehnten seines

 S. Vorwort zu Adolf Reinach ‚Was ist Phänomenologie?‘, München 1951 (d. H.). https://doi.org/10.1515/9783110763096-007

174

Die transzendentale und die ontologische Phänomenologie

Lebens vereinsamte Husserl mehr und mehr, von einzelnen, zum Teil schon genannten Repräsentanten und Schülern abgesehen. {2} Husserl spricht am Schluß seines Nachworts zu den Ideen I, das erst 1930 im Jahrbuch für Philosophie und phänomenologische Forschung veröffentlicht worden ist², von „dem unendlich offenen Land der wahren Philosophie“, dem „Gelobten Land“, das er ausgebreitet vor sich liegen sehe und wohl selbst nicht mehr als schon durchkultiviertes erleben werde. Er meinte hiermit selbstverständlich die von ihm mit immer tieferer Erschütterung entdeckte transzendentale Phänomenologie, durch die auf Grund der transzendentalen Reduktion der gesamte Sinn- und Geltungsbereich alles und jeden Seienden in seiner ursprungshaften Konstitution erklärt werde. Merkwürdigerweise ist uns Göttinger Phänomenologen, die wir nichts weniger als transzendentale Phänomenologen waren, die von Husserl ebenfalls entdeckte, aber von ihm weitaus geringer bewertete rein-eidetische ontologische Phänomenologie (Wesensforschung) ebenfalls immer wie ein unendlich offenes, ja – philosophisch gedacht – „gelobtes Land“ erschienen. Und erscheint sie so heute noch, nicht nur den wenigen, die aus jener Zeit übrig geblieben sind, sondern auch all denjenigen, denen plötzlich „der phänomenologische Star gestochen ist“. Die auf solche Weise in den Blick tretende Phänomenologie scheint nichts, aber auch gar nichts mit der Husserlschen Transzendentalphilosophie zu tun zu haben. Was ihre letzte philosophische Zielrichtung betrifft, erscheint sie als ihr direktes Gegenteil. Für Husserl bildete das „Zurück“ in die letztkonstituierenden Ursprungsgründe des transzendentalen Bewußtseins, das „Zurück“ also in die „absolute Subjektivität“, das Zentrum einer alles klärenden und begründenden prima philosophia. Für uns bedeutete und bedeutet das, wie es scheint, vollkommen entgegengesetzte „Hin zu den Sachen selbst“ den Durchbruch zu einer völlig neuen und endgültigen philosophischen Grundeinstellung und mit ihr die Erlösung von allen kritizistischen, erkenntnistheoretischen, psychologistischen, historizistischen und sonstigen durch Tradition festgelegten Vorurteilen, ja die Erlösung von allem Vor-geurteilten schlechthin. Husserl selber betont zwar oft, daß der wahre Philosoph ein „Anfänger“ sein und bleiben müsse, weil er immer wieder die „Sache“, um deren Klärung es geht, mit eigenen Augen zu sehen verpflichtet ist und sich in seiner Wesensdeutung derselben nicht auf irgend eine eigene oder fremde vorgefaßte Meinung verlassen darf. Von ihm stammt also diese Devise: „Zu den Sachen selbst!“ Ist und bleibt es aber nicht eine vollkommen gegensätzliche Intention, einerseits zu letzter transzendentaler Subjektivität zurückzuführen, andererseits an jeder Seinsstelle und im Ganzen des Seins selber zu höchster, nicht überbietbarer, weil wesensgegründeter Objektivität hinaufzuführen? Doch müssen hier irgendwelche Interpre-

 Bd. XI, S. 149 ff.; jetzt auch Husserliana V, S. 238 ff. (d. H.).

Die transzendentale und die ontologische Phänomenologie

175

tationsirrtümer auf einer der beiden oder allen beiden Seiten obwalten – sonst könnten wir alle, Transzendentalisten wie Ontologen, nicht dennoch Phänomenologen sein. Man hat es oft so auffassen wollen, als ob es sich einfach um verschiedene Phasen in Husserls eigener Philosophie handelte. In der Tat: Schon der 2. Band der ‚Logischen Untersuchungen‘, erst recht aber die ‚Ideen zu einer reinen Phänomenologie und phänomenologischen Philosophie‘ erschienen uns unmittelbaren Schülern als eine unverständliche Rückkehr Husserls zum Transzendentalismus, Subjektivismus, wenn nicht gar Psychologismus. Wir waren so hingerissen vom Husserlschen Durchbruch zur reinen Objektivität und Sachlichkeit, daß unsere damaligen Seminare in einem fast beständigen, von unserer Seite her oppositionellen Disput mit dem großen Lehrer bestanden. Was von uns in so negativer Weise bewertet wurde, wurde auf der Seite des kritischen Idealismus (Neukantianismus, Rickertschule usw.) durchaus positiv bewertet. Endlich schien Husserl den Eingang zu einer wahren erkenntniskritischen Philosophie gefunden zu haben. Allerdings wurden die letzteren verwirrt durch die anscheinenden Reste von Ontologismus und Intuitionismus, welche „Reste“ uns gerade die Hand des Meisters wieder mit Freude spüren ließen. Gab es doch keinen Satz in seinen mündlichen und schriftlichen Ausführungen, der nicht aus voller Evidenz wahrer, anschaulicher Selbstgegebenheit zu fließen und jede bloße Konstruktion sorgfältig zu vermeiden schien. In seinen späteren Freiburger Jahren verloren viele von uns, schicksalsmäßig gezwungen, Husserl aus den Augen. Jedenfalls ging es mir so. Aber es kam bei mir – und wohl auch bei anderen – hinzu, daß ich bei einem gelegentlichen Zusammentreffen mit Husserl gegenüber dem immer tieferen Ausbau und der immer reineren Begründung von Husserls Transzendentalismus immer ratloser wurde. Es erschien mir wie eine Spekulation, die ihn ständig mehr umgarnte und gerade das verloren hatte, was uns alten Phänomenologen das philosophisch Teuerste war: die radikale Sachlichkeit, um welche Gebiete es sich immer handeln mochte, das unbeirrbare, stets neue Anfangen angesichts irgendeiner aufgegriffenen Problematik. Mein eigenes Philosophieren wandte sich dabei immer intensiver einer Thematik zu, die mich vom Anfang meines selbständigen Philosophierens her gefangengenommen hatte: der Wesensfrage nach dem realen Sein als solchen, im speziellen der Natur. Natürlich hielt ich mich dabei streng im Rahmen der Wesensforschung. Was ist überhaupt Realität? Was ist das Wesen von Natur? Was folgt wesensmäßig daraus, wenn empirische Welt und empirische Natur mit allen ihren möglichen Beständen als real vorhandene angesetzt werden?³ {3} War es aber nicht gerade diese Realität, die in Husserls berühmter Reduktion eingeklammert werden sollte? Gewiß nicht negiert oder auch nur bezweifelt.

 Vgl. ‚Realontologie‘, Halle 1923, und weiterhin (d. H.).

176

Die transzendentale und die ontologische Phänomenologie

Husserl hat niemals an der Realität von Welt, Natur, ja Übernatur gezweifelt. Aber innerhalb des unter stets neuen Aspekten durchforschten gewaltigen Gebiets der wie auch immer noetisch-noematisch dahinströmenden intentionalen Sinnfülle des Bewußtseins mit ihren unendlich vielen Schichtungen, Implikationen und Einwurzelungen sollte die Frage, ob diese noematische Welt auch wirklich wirklich ist, völlig dahingestellt bleiben. Dabei sollte es sich um das „wirkliche“ Sein in jeder Beziehung, nicht nur um das reale der konkreten empirischen Natur handeln. Das Wort Epoché drückt das hierbei Gemeinte am besten aus. Es handelte sich nicht um eine erkenntnistheoretische Frage oder gar Behauptung. Es handelte sich auch nicht, wie ich lange gedacht habe, um eine thematisch-phänomenologische Einengung: so als ginge es eben bei Husserl allein um die Wesensdurchforschung des Bewußtseins in allen seinen möglichen Bezügen, während die reale oder auch in sonstigem Sinn seiende Welt ausgeschaltet bleibt. Denn in der universalen Sinnverflechtung und Sinneinheit des Bewußtseinsstromes liegt ja doch das Seiend-sein der Welt mit darin. Etwas für wirklich zu halten, zu sehen, zu vermuten, an die Wirklichkeit zu glauben, sei es bewußt oder unbewußt, sei es in schlichter Lebenshaltung oder wissenschaftlicher Abstraktion, sind selber Vermeintheiten, sind Noemata mit ihrem je eigensten Sinn. Wie sollte das Noema des Seiend-seins nicht zum Gesamtsinn des absoluten Bewußtseins gehören? Wie ist es möglich, den Verzicht auf das vielgestaltige Seinsnoema zur Voraussetzung einer universalen phänomenologischen Philosophie zu machen? {4} Es geschah das auch keineswegs. Die Husserlsche Urteilsenthaltung (Epoché) bezieht sich nicht auf die zu irgendeinem noematischen Sinn gehörige Seinsvermeintheit. Sie bezieht sich nur darauf, ob solcher wie auch immer gestalteter Seinsvermeintheit ein wirkliches Sein, eine wirkliche Wirklichkeit entspricht. Es ist nicht möglich, die eigentümliche Problematik anders als in terminologischer Verdoppelung des Ausdrucks zu kennzeichnen: „wirkliche Wirklichkeit“! Husserl benutzt sie öfter, wenn auch nicht in explizit geklärter Weise. In meinen eigenen ontologischen Wesensanalysen habe ich sie seit langem eingeführt. Ihre sprachliche Notwendigkeit ergibt sich aus dem Mangel an immer neu differenzierenden Kategorien. In unserem Fall geht es um die „Wirklichkeit“ als einen noematischen Bestand einerseits, um die bewußtseinstranszendente Wirklichkeit des noematischen Wirklichkeitsmomentes andererseits. Das letztere ist eben die wirkliche Wirklichkeit. Sie kann niemals zum noematisch-phänomenalen Gesamtbestand der Welt gehören, weil es sich in ihr um das faktische „Auf-sich-selber-Stehen“ oder um das seinsmäßige „In-sich-selber-Gegründetsein“ der Welt und aller ihrer Bestände handelt. Hierin liegt die wirkliche Wirklichkeit der Welt, mag es sie faktisch geben oder nicht. Bei Husserl kommt das merkwürdigerweise nirgends klar zum Ausdruck. Aber ich glaube nicht, daß man das hier liegende Problem anders lösen kann als dadurch, daß man das Wesen von Realität (wirklicher Wirklichkeit) als solcher in

Die transzendentale und die ontologische Phänomenologie

177

den Blick bekommt. Husserl sagt oft mit Nachdruck, daß ein bewußtseinsunabhängiges Sein und Seiendes einen Nonsens darstelle. Das ist gewiß wahr, solange es um Sein und Seiendes geht, das zum noematischen Bewußtseinsbestande selber gehört. Ja, dann ist es eigentlich eine Tautologie. So wie die Bewußtseinsunabhängigkeit eines seinsmäßig in sich selbst Gegründeten – wesensmäßig! – eine Selbstverständlichkeit ist. Etwas ganz anderes aber ist hier und dort die Frage, ob es eine auf sich selber stehende Realität, die als solche eine bewußtseinstranszendente Realität ist, wirklich gibt. Diese erkenntnistheoretische Frage, ob dem noematischen Sein ein faktisches Sein entspricht, wurde von Husserl ganz auf die Seite geschoben. Es ging ihm fast ausschließlich um die wesensmäßige Durchforschung des riesenhaften Gebietes sinnhaft geeinter, sich wechselseitig begründender und aus letzten originären, deshalb absolut evidenten Gegebenheiten, das universale Phänomen „Welt“ konstituierenden Intentionalitäten selbst. {5} Es scheint mir, daß der ebenfalls benutzte Ausdruck „Reduktion“ (anstatt Epoché) die transzendentale Stellung Husserls noch viel stärker zum Ausdruck bringt: Die Welt wird als eine von jeder Seinssetzung reduzierte gesehen. Das ist um eine Nuance mehr als Enthaltung von allen Urteilen über Sein und Nichtsein. Im Fall der Epoché bleibt die Welt innerhalb ihrer universalen Gegebenheitsweise genau dieselbe, die sie vorher war, während sie durch die Reduktion zu einem Weltphänomen wird – ganz abgesehen davon, ob ihr faktisch eine Wirklichkeitswelt entspricht oder nicht. Man kann aber von der Epoché aus einen ganz anderen, entgegengesetzten Weg gehen. Es wird in diesem Fall die Welt mit allen ihren Beständen als hypothetisch seiende angesetzt. Auch hier ist Urteilsenthaltung geübt. Auch hier wird über Sein und Nichtsein in keiner Weise entschieden. Auch hier bleibt die erkenntnistheoretische Frage außer Betracht. Aber anstatt das wirkliche Sein hypothetisch einzuklammern und dadurch die Welt (in der Reduktion) der wirklichen Wirklichkeit enthoben zu sehen, wird nunmehr das wirkliche Sein der Welt hypothetisch gesetzt und sie dadurch mit der selbsthaften Eingesenktheit ins Sein vorgestellt.Wenn wir aber in solcher Weise zwar Epoché, aber nicht Reduktion üben, so ergibt sich die schon erwähnte folgenreiche Frage in bezug auf alles empirisch Gegebene: was folgt daraus für die nähere ontische Konstitution der zunächst durch die Epoché nur phänomenal gegebenen Welt? Das ist kein einfach zu beantwortender, ebenfalls universaler Fragekomplex. Es läßt sich zeigen, daß eine empirische Natur in wirklicher Wirklichkeit gar nicht bestehen kann ohne ontische Selbstverwurzelung in einer über- und unterphysischen Potenzialitätssphäre, in der die aktuelle Welt vorgegeben ist. Der Raum, um ein anderes, mir im Augenblick naheliegendes Beispiel zu nennen, so wie er uns in unmittelbarer Lebensempirie

178

Die transzendentale und die ontologische Phänomenologie

gegeben ist, kann ebenfalls nicht als seiend seiender bestehen ohne ontologische Zurückführung in einen Unter- und Überraum⁴. {6} Das entscheidende Wort ist gefallen. Transzendentale und ontologische Phänomenologie haben sich geschieden. Beide haben es nur mit Wesensforschung zu tun. Beide stellen die erkenntnistheoretische Frage beiseite, üben Epoché in Bezug auf die Faktizität der phänomenal gegebenen Wirklichkeit und überhaupt alles Seienden. Beide behalten alles, was es gibt, schlechthin alles, im Auge, ohne irgend etwas an thematischem Gehalt abzuziehen. In beiden Fällen geht es nicht um einen Gegensatz von Objektivität und Subjektivität, bzw. um einen Gegensatz von Empirie und Transzendentalismus. Bei der ontologischen Phänomenologie (Wesensforschung) selbstverständlich nicht. Bei der transzendentalen Phänomenologie hat diese irrtümliche Auffassung allezeit sehr nahe gelegen. Dadurch gerade wurden Husserls Intentionen völlig verfälscht. Fink erwähnt in seinem ausgezeichnet orientierenden Artikel ‚Die Phänomenologie Husserls in der gegenwärtigen Kritik‘⁵, daß die Husserlsche Phänomenologie unter dem Gegensatz von „mundan“ und „transzendental“ stehe, nicht wie die kritische Philosophie unter dem Gegensatz von „empirisch“ und „transzendental“, erst recht nicht unter dem Gegensatz von „objektiv“ und „subjektiv“. Für Husserl gebe es eine notwendige Bezogenheit auf eine „innerweltliche“, sei es auch apriorisch subjektive Immanenz überhaupt nicht. Es gibt für ihn nur eine Weltvorgängigkeit der durch die Reduktion überhaupt erst entdeckten und in einem völlig neuen, „metaphysischen“ Sinne zu nehmenden Subjektivität. „Welt“ heißt hier alles: auch das Psychische in jeder Form, auch die menschliche Person, auch die letzte positiv-wissenschaftlich zu erreichende Subjektivität. Wir befinden uns vor dem tiefsten, vor allem von uns ontologischen Phänomenologen fast nie verstandenen Punkt des Husserlschen Transzendentalismus. „Transzendental“ im Sinne der transzendentalen Kritik und „transzendental“ im Sinne der Husserlschen Phänomenologie haben völlig verschiedene Bedeutungen. Die ganze physische und psychische, empirische und ideale bzw. kategoriale Welt muß in der Husserlschen Phänomenologie nach rückwärts ins – sei es individuell oder gemeinschaftlich – Subjektive unterstiegen werden, um zu dem geheimnisvollen „Ego“ zu gelangen, aus dessen lebendigem „Fungieren“ die gesamte Seins- und Sinngeltung der Welt schlechthin ableitbar ist. Deshalb heißt die Hus-

 S. Conrad-Martius ‚Der Raum‘, München, 1958, auch ‚Schriften‘ II, u. a. (d. H.).  In den Kantstudien 1933, 38. Husserl sagte von diesem Finkschen Aufsatz, den er selber noch redigierte und mit einem Vorwort versah, daß in ihm kein Satz sei, den er nicht ausdrücklich als seine eigene Überzeugung anerkennen könne. Übrigens ist das beste Belegstück für die nahe Übereinstimmung der Finkschen Ausführungen mit Husserls eigenen Anschauungen die letzte große Arbeit Husserls: ‚Die Krisis der europäischen Wissenschaften‘, deren Hauptmanuskript 1935/ 36 entstand und als Bd. VI der Husserliana von W. Biemel herausgegeben wurde (Haag 1954).

Die transzendentale und die ontologische Phänomenologie

179

serlsche Philosophie: „Ursprungsphilosophie“. Wir können hinter dieses Ego nicht zurück. Es gibt für die in ihm liegenden Momente nicht einmal „Namen“, da alle Namen aus einem Bewußtseinsfluß stammen, in dem schon „Zeit“ konstituiert ist. Das Ego aber ist dasjenige, was alles und jedes, so auch die Zeit, allererst konstituiert. Es selber ist also „zeitlos“⁶. {7} Ich habe die zwei großen, einander entgegengesetzten Richtungen der Husserlschen Phänomenologie von der Wegscheide der Epoché aus andeutend zu charakterisieren versucht. Mehr als kürzeste Andeutungen kann ich natürlich hier nicht geben. Aber eine wesentlichste Frage steht vor uns auf. Ist es denn möglich, daß die gesamte Sinn- und Seinsgeltung der in weitester Bedeutung genommenen Welt des Seienden sowohl aus einer nach rückwärts nicht untersteigbaren egologischen Subjektivität wie auch aus einer nach vorwärts nicht übersteigbaren ontologischen Objektivität entspringen kann? „Entspringen“ nicht im theologischen, sondern im philosophischen Sinne? Noch dazu, da beides den wohl zu rechtfertigenden Anspruch erhebt, keinen Schritt ohne Verifizierung in anschaulicher Evidenz zu tun. Widerspricht sich beides nicht radikal? Ich glaube es nicht. Der gleiche Logos, der, in denkbar universalstem Sinne gedacht, nach Wesen und Sein die Welt durchwaltet, liegt mit gleicher Universalität auch in der menschlichen Vernunft verborgen. Hier kann sich nichts widersprechen, nur in wunderbarer Weise entsprechen⁷. Das letztere ist die metaphysisch-egologische oder metaphysischtranszendentale „Objektivation“ (Husserl) der Welt; das erstere ist die metaphysisch-ontologische oder metaphysisch-transzendente Objektivation (Aktualisierung) derselben. Ich spreche von einer „transzendenten“ Objektivation. Hier liegt eine fundamentale Problematik, die zu Husserls Zeit kaum schon in den philosophischen Blickbereich treten konnte. Husserl kannte – wie seine ganze Zeit – nur die „klassische“ Welt empirischer Aktualität. Für ihn war diese aktuelle Welt einfach empirisch gegeben. Sie ursprungsmäßig zu „hinter“-steigen – es sei denn in einem außerphilosophischen Sprung zu Gott hin – lag nicht innerhalb der Möglichkeit wissenschaftlich philosophischer Problematik. Man kannte nur den Rückgang ins Transzendentale. Heute ist die gesamte Sachlage völlig verändert. Die neue Physik

 Vgl. L. Landgrebe, ‚Husserls Phänomenologie‘ in: Revue Internationale de Philosophie, 1939, den ein Jahr nach Husserls Tode erschienenen ergreifenden Gedenkband für ihn. Landgrebe weist hier mit Recht darauf hin, daß Husserls Schrift ‚Vorlesungen über das innere Zeitbewußtsein‘, an deren Vorarbeiten er sofort nach dem Erscheinen der ‚Logischen Untersuchungen‘ ging und die im Jahrbuch für Philosophie und phänomenologische Forschung IX, 1928 von Heidegger herausgegeben wurde, schon vieles vorgedeutet liegt, was seine endgültige Transzendentalphilosophie später ausmachte. Und daß die wesentliche Vertiefung, die Husserl damals dem Begriff der Intentionalität gab (als eines Leistungsbegriffs), von keinem seiner „ontologischen“ Schüler verstanden wurde.  S. im vorliegenden Band S. 295 ff. und die folgenden Abhandlungen (d. H.).

180

Die transzendentale und die ontologische Phänomenologie

hat Türen aufgebrochen, die zu den weiten (real‐)potenziellen Begründungsbereichen der Welt führen. Auch für die Kennzeichnung dieser ontischen (transphysischen) Begründungsbereiche bedarf es neuer, nichtklassischer, vorläufig noch „namenloser“ Kategorien⁸. Auf solche Weise können sich erst ontologischer und transzendentaler Logos nach ihrem universalen Umfang entsprechen. {8} Noch einmal: sowohl die transzendentale wie die ontologische Phänomenologie stehen in der Haltung der Epoché. Sie haben beide nichts mit einer Behauptung oder Bezweiflung des Seins dieser Welt zu tun. Denn die wirkliche Wirklichkeit kann niemals evident erkannt werden. Allerdings gibt es hier eine wesentliche Ausnahme. Das cartesische Cogito hat tatsächlich seine Seinsevidenz in sich selbst. Ich kann nicht daran zweifeln, daß ich bin. Immer aber ist es möglich, am wirklichen Wirklichsein der Welt oder ihrer Bestände zu zweifeln. Diese erkenntnistheoretische Einsicht war in der Tat der ursprüngliche Ausgangspunkt für Husserls Transzendentalismus, weshalb er auch immer wieder auf Descartes zurückkam. Daß es Husserl jedoch thematisch allein mit der ursprungshaften Konstitution der Welt von der subjektiven Vernunftseite her zu tun hatte, besitzt seinen Grund wohl auch in diesem Tatbestand. Aber seine faktischen Analysen waren dann doch niemals erkenntnistheoretisch orientierte, sondern einzig und allein eidetisch durchgeführte. Im Grunde war ihm die Erkenntnistheorie ebenso gleichgültig, wie sie uns ontologischen Phänomenologen seit eh und je gleichgültig war. Auch das hatten wir von unserm Meister gelernt.

 Vgl. Conrad-Martius ‚Der Selbstaufbau der Natur‘, 2. Aufl. München 1961; ‚Naturwissenschaftlichmetaphysische Perspektiven‘, Hamburg-Heidelberg 1948; ‚Der Raum‘ a.a.O.; ‚Schriften‘ II (d. H.).

Metaphysische Gespräche Meinem Mann gewidmet

Unterredende: Montanus und Psilander.

Pflanze und Tier. {1} M o n t a n u s : Sie zerpflücken da, lieber Freund, so harmlos eine Blume und doch hörte ich Sie gelegentlich äußern, die Frage, ob wir den Pflanzen eine Art niederen Bewußtseins oder eine Art Empfindungsfähigkeit zuschreiben dürfen, würde wohl stets zu dem Bereich des „Ignoramus“ menschlichen Wissens gehören. P s i l a n d e r : Ich muß gestehen, daß sich mir diese Einsicht noch nicht in ein lebendiges, praktische Konsequenzen forderndes Bewußtsein umgesetzt hat. M o n t . : Und doch würden Sie ganz gewiß nimmermehr eine Pflanze in dieser Weise zerstückeln, wenn faktisch auch nur die geringste Möglichkeit bestünde, Empfindungs- und Schmerzfähigkeit in sie hineinzulegen. P s i l . : Sie bezweifeln diese Möglichkeit? Und die epochemachenden Entdeckungen der Botanik? M o n t . : Entdeckung der „pflanzlichen Sinnesorgane“ und dergleichen? {2} P s i l . : Steht doch jetzt nicht nur fest, daß die Pflanze, wie man es ja schon vorher wußte, auf Lichtreize, mechanische Reize, Schwergewichtseinflüsse mit eigentümlichen Eigenbewegungen lebendig reagiert, sondern auch, daß die Möglichkeit solcher Reizwirkungen und Bewegungsauslösungen – genau wie bei den Tieren – durch spezifisch ausgestaltete und den Reizarten auf das Vollkommenste angepaßte Organe geschaffen wird. Sollten aber nicht der gleichen äußeren Sachlage gleiche innere Vorgänge entsprechen können? M o n t . : Die Pflanze soll also nicht nur als lebendig und zweckvoll in sich selbst geordnete Einheit auf die äußeren Einwirkungen in einer durch ihre spezielle Organisation bedingten Weise reagieren, sondern sie soll diese Einwirkungen auch überdies in sich selbst s p ü r e n ? P s i l . : Die M ö g l i c h k e i t wenigstens darf man wohl nicht von vorne herein negieren. M o n t . : Jene durch mühevolle Experimentalarbeit gefundenen Tatsachen verschaffen uns merkwürdigste Aufschlüsse über den faktischen Aufbau des pflanzlichen Wesens. Mit ihrer Ausdeutung aber, die in der Richtung einer vollkommenen Grenzvernichtung von tierischem und pflanzlichem Sein liegen, durch die die „scholastischen“ Wesensgrenzen nunmehr endgültig ausgerottet sein sollen, https://doi.org/10.1515/9783110763096-008

182

Metaphysische Gespräche

dürfen wir uns, so meine ich, keineswegs einverstanden erklären. Mir scheint im Gegenteil, daß gerade diese neuen Entdeckungen die l e t z t l i c h u n v e r g l e i c h l i c h e Eigenart spezifisch pflanzlichen Seins nur noch anschaulicher hervȯrtreten lassen. Könnten wir denn nicht, Psilander, gemeinsam den Punkt aufzufinden suchen, an dem das Sein des Tieres und der Pflanze sich durch keine wie auch immer denkbaren Übergänge ineinander überführen lassen? Hier müßten wir zugleich an die konstitutive Wurzelstelle ihres beiderseitigen Charakters stoßen. {3} P s i l . : Sie sprechen von einem prinzipiellen Bruch zwischen Pflanze und Tier, der durch keinerlei Übergänge ausgleichbar ist? Und die niederen Lebewesen, die in ihrer Erscheinungs- und Lebensweise so nahe zueinander gehören, daß es unmöglich erscheint, sie der einen oder anderen Klasse ausschließlich zuzuordnen? Daß man es ablehnt, jene eigentümlichen Erscheinungen an ausgebildeten Pflanzen, die Eigenbewegungen, die lebendigen Reaktionen, das Auftreten von förmlichen Sinnesorganen, als Anfänge tierischen Seins zu bewerten, kann ich verstehen. Aber es steht doch fest, daß im Bereich der niedersten Lebewelt die Unterschiede zwischen Tier und Pflanze sich bis zur vollkommenen Unkenntlichkeit verlieren. M o n t . : Besagt denn Unkenntlichkeit ohne weiteres Nichtvorhandensein? Kann denn nicht auf diesen Stufen die Ausbildung der Gestaltstypen so keimhaft noch und rudimentär sein, daß der prinzipielle Bruch zwischen ihnen einfach noch nicht zutage treten kann? Aber dann ist es ja auch sehr wohl möglich, daß es Entwicklungsvorstufen gibt, auf denen sich die Natur sozusagen noch nicht „entschieden“ hat: ob „Pflanze“ oder „Tier“ – auf denen weder von dem Einen, noch von dem Anderen schon die Rede sein kann. Spricht das aber gegen die Möglichkeit einer radikalen Aufbaudifferenz dort, wo die Scheidung einmal vollzogen ist? {4} P s i l . : Ich habe bisher immer als eine der fundamentalsten naturwissenschaftlichen Errungenschaften die Einsicht angesehen, daß es in der Natur keine absolut abgrenzbaren Typen gibt – eben wegen der eigentümlichen Übergangsformen, auf die man überall stößt. M o n t . : In der Dimension, in der sich die Naturwissenschaften allein bewegen, gehen die Merkmale allerdings stetig und allmählich ineinander über. P s i l . : In was für eine Region also muß man sich begeben, um diese Ihre absoluten Typen zu finden? Ist es denn nicht ganz eigentlich Aufgabe der naturwissenschaftlichen Forschung, die natürlichen Klassen lebender Wesen durch möglichst fest umrissene Eigenschaftsgruppen voneinander abzusondern? M o n t . : Die Wesensunterschiede oder die Unterschiede in den letzten Seinsgrundlagen werden schließlich in der äußeren Ausgestaltung auf irgendeine Weise zum Ausdruck kommen – und es müssen sich so durch die dem Naturwissenschaftler zugänglichen Differenzen in der körperlichen Konstitution wirkliche, den Wesensgrundlagen entsprechende Klassen von Typen finden lassen. Aber die Wesensschnitte selbst lassen sich auf diesem Wege nicht finden.

Pflanze und Tier

183

{5} P s i l . : Und die Psychologie? Die naturwissenschaftliche Forschung beschränkt sich doch nicht auf die Feststellung rein körperlicher Merkmale. Gerade die Frage, die uns jetzt interessiert, die Frage nach der Empfindungsfähigkeit der Pflanze, gilt als eine spezielle des Physiologen oder auch des Psychologen. Geht hier nicht wirklich der einzig mögliche Weg über das sachgemäß angestellte Experiment? M o n t . : Wo es sich um die Frage handelt, ob diese oder jene Pflanzenart so etwas wie Empfindungsfähigkeit besitzt oder nicht, da könnte prinzipiell genommen das Experiment, da könnte vor allem die direkte und eingehende Beobachtung den Weg und das Mittel darstellen, die entsprechenden Einsichten zu gewinnen. Darin haben Sie vollständig recht. Wenn ich vorhin sagte, wir kämen mit der entscheidenden Frage notwendig in eine andere sachliche Dimension, so hängt das vor allem mit der ganz andersartigen Problemstellung zusammen, die die Frage nach dem prinzipiellen Unterschied zwischen Pflanze und Tier mit sich bringt. Es ist nämlich zunächst ganz gleichgültig, ob sich dieser oder jener Seinstypus hier oder dort faktisch vorfindet, ob er in diesem oder jenem lebenden Wesen eine Realisation gefunden hat. Es gilt zunächst und vor allem, die beiden möglichen Seinstypen selbst, den pflanzlichen und den tierischen, in ihrer spezifischen Abgegrenztheit zu fassen, ganz allgemein und abgelöst von jeder Realitätsfrage. Es gilt das eigne Wesen der ontischen Grundstrukturen zu finden und zu fixieren. Diese Untersuchung ist aber, wie wir sofort sehen würden, eine ganz und gar unnaturwissenschaftliche und typisch philosophische. {6} P s i l . : Mit der ontischen Grundstruktur meinen Sie jene letzten Seinsgrundlagen – so drückten Sie sich vorhin aus? M o n t . : Die letzten Seinsgrundlagen, ja. Aber hier nicht in einem transzendentmetaphysischen Sinne, sondern im Sinne des immanenten Gegebenheitsfundamentes selbst. Aber lassen Sie mich gleich hinzufügen: h a t man erst einmal diese beiden Gestaltstypen sich vollständig scharf voneinander abheben und in sich abschließen sehen, dann kommt man schwerlich noch in Versuchung, in Pflanzen einen „Keim von Sensibilität“ oder „Bewußtsein“, oder von wirklicher Eigenbewegung auch nur theoretisch zu suchen. Dann werden Experiment und Beobachtung in dieser speziellen Frage ganz und gar überflüssig. Denn die beiden Gestaltsarten sondern sich in so wunderbar reinlicher und prägnanter Weise, daß es nicht mehr anders möglich ist, als in dem typischen „Kleid“ der Pflanze wie auch in der typischen Gestaltungsart des Tieres einen unmittelbaren und notwendigen Ausdruck des allgemeinen Wesens zu sehen. {7} P s i l . : So bitte ich Sie denn, mir das, was Sie die ontischen Grundstrukturen des Tieres und der Pflanze nennen, näher zu charakterisieren. M o n t . : Ah, Psilander, jetzt wollen wir beginnen, gemeinsam zu arbeiten. P s i l . : Denn alles Bisherige hat Sie ein wenig gelangweilt.

184

Metaphysische Gespräche

M o n t . : Wenn man über einen See setzen will, so wird man es überdrüssig, am Ufer herumzuspazieren. P s i l . : Aber wie beginnen? Noch nie war ich so ratlos. M o n t . : Fangen wir vor allem mit konkreten Beispielen an. Vielleicht solchen, bei denen die tierische Ausgestaltung hier, wie die pflanzliche dort so ausgeprägt schon gegeben sind, daß wir ohne weiteres die Zuordnung zu den beiden Reichen lebendiger Wesen vollziehen können. Bei denen aber andrerseits gewisse analoge Lebensäußerungen und Erscheinungsweisen Phantasie und oberflächliche Überlegung reizen mögen, Übergänge anzunehmen und Wesensgrenzen zu verwischen. Ich denke etwa an die Mimose einerseits und so etwas wie einen Polypen andrerseits. P s i l . : An die Mimose eben wegen ihrer eigentümlichen Eigenbewegungen, die sie zu vollziehen scheint? {8} M o n t . : Ja, und die auf eine keimhafte Anlage tierischer Sensibilität und Reaktionsweise hinzudeuten scheinen. Und der Polyp wiederum macht in seiner blumenhaften Erscheinungsform den Eindruck, als habe er die Hüllen und Fesseln der Pflanzennatur noch nicht ganz abgestreift. Stellen Sie sich also die Blätterbewegung der Mimose vor, die in dem allmählich und rhythmisch sich vollziehenden Zusammenlegen der Blätter besteht, und vergleichen Sie dieses Phänomen mit den ununterbrochen blind umhertastenden und -suchenden Bewegungen des Polypen, wie man sie in jedem Aquarium beobachten kann.Versuchen Sie dabei bitte – unter vorläufiger Zurückstellung aller Bedenken – die Mimose rein und ganz als Pflanze aufzufassen, den Polypen dagegen als Tier. Denn auf die theoretische Typenunterscheidung an möglichst anschaulichen Beispielen kommt es an! Nicht auf die Frage, ob die Mimose wirklich noch eine reine Pflanze, ob der Polyp wirklich schon ein reines Tier ist! Was würden Sie in dieser Einstellung etwa als unterscheidendes Merkmal der spezifisch pflanzlichen Bewegung von der spezifisch tierischen angeben? P s i l . : Ihre direkte Frage setzt mich etwas in Verlegenheit. Denn ich weiß weder, worauf Sie eigentlich hinauswollen, noch ob ich die von Ihnen gewünschte Einstellung schon besitze. Was den spezifischen Fall betrifft, so fällt mir auf, daß die pflanzliche Bewegung auf einen bestimmten äußeren Reiz hin geschieht, die tierische dagegen auf Grund eines inneren Reizes, der vielleicht von einer Hungerempfindung oder dergleichen begleitet ist. Aber ein prinzipiell unterscheidendes Merkmal kann das doch nicht sein, da auch das Tier, wenn ich es berühre oder verletze, zusammenzuckt, und es andrerseits jene höchst eigentümlichen, gleichsam suchenden Bewegungen der Rankengewächse gibt, durch die sie eine gleichgültig ob hierhin oder dorthin gestellte Stütze zu finden vermögen. Diese scheinen doch ebenso wie die umhersuchenden Bewegungen des Polypen ihren Grund in einem inneren Reiz zu haben.

Pflanze und Tier

185

{9} M o n t . : Die beiden Fälle, die ich gewählt habe, stehen nicht unter ganz gleichen Bedingungen. Sie haben recht! Ich hatte allerdings nur die verschiedene Art der Bewegung i n s i c h s e l b s t im Auge und diese bleibt in genau demselben Sinne spezifisch verschieden, ob sie nun, wie Sie sagen, durch einen inneren oder durch einen äußeren Reiz hervorgerufen werden. Aber machen wir einmal – um der größeren Anschaulichkeit willen – die äußere Erscheinungsweise in den beiden Fällen möglichst gleich. Stellen wir wirklich der umhersuchenden und tastenden Bewegung des Polypen die „gleichsam“ umhersuchende Bewegung der Rankengewächse gegenüber und der „gleichsam“ zusammenzuckenden Bewegung der Mimose die zusammenzuckende Bewegung eines Tieres, das man heftig berührt. Ist es Ihnen nicht auffallend, wie sehr verschieden wir zum Beispiel in diesem letzteren Fall die Bewegungen – gleichsam vom Inneren des lebenden Wesens her – f ü h l e n ? P s i l . : Ich sehe vorläufig wiederum nur das Eine, daß die Bewegung der Mimose, solange ich sie ganz und nur als Pflanze auffasse, von keiner auch noch so keimhaften Empfindung begleitet erscheint. Aber weshalb scheide ich bei der Mimose von vorne herein aus, was ich bei dem Polypen einfach annehme – das ist wieder dieselbe Frage. {10} M o n t . : Gewiß, an diesem Punkt kommen Sie nicht weiter. Sie dürfen nicht darauf achten, was die Bewegungen möglicherweise begleitet oder nicht, sondern darauf, was sie in sich selbst und rein für sich genommen voneinander unterscheidet. Der Grund, weshalb Sie hier immer wieder und ohne weiteres Empfindung zuschreiben, dort ausschalten, liegt eben darin, daß Sie ohne deutliches und explizites Wissen darüber die ganze Pflanze und mit ihr die Einwurzelung der Bewegung in ihr anders „haben“ als das Tier. Um Ihnen einen ersten Anhaltspunkt zu geben: sehen Sie nicht die Bewegung der Pflanze als eine in irgend einem Sinne „unfreiere“ an? P s i l . : Sie meinen, daß das Einziehen der Fangarme des Polypen schon eine Art freier Willensäußerung darstellt, während die Blätterbewegung der Mimose einer unbedingten und gewissermaßen naturgesetzlichen Notwendigkeit untersteht? Aber das ist ein gefährliches Thema. Gibt es überhaupt so etwas wie freie Willensäußerung? Und wenn auch – der Polyp mit seiner sicherlich ganz primitiven psychischen Organisation wird wahrscheinlich ebensowenig die Möglichkeit haben, sich der durch den Reiz ausgelösten Zuckungsbewegung zu entziehen wie die Mimose. {11} M o n t . : Der Wille ist, so meine ich, seinem Wesen nach frei. Aber glücklicherweise brauchen wir uns hierüber jetzt nicht zu streiten. Sicherlich kann beim Polypen von einem Willen im strengen Sinne, von einer freien Willensäußerung keine Rede sein. Und nehmen wir einmal an, daß bei jenem Einziehen der Fangarme infolge einer schmerzhaften Berührung von außen her das Tier überhaupt n i c h t a n d e r s k a n n , als die Reaktionsbewegung und gerade diese zu vollziehen, es also

186

Metaphysische Gespräche

von hier aus betrachtet dem gleichen Zwang unterliegt wie die Pflanze, so ist doch auch die Unfreiheit hier und dort noch von radikal verschiedenem Charakter oder auch der Grund der Unfreiheit. Dort liegt eine nur f a k t i s c h e Unfreiheit, hier eine p r i n z i p i e l l e vor. P s i l . : „Nur faktische“ – weil die Bewegung des Tieres hier und da auch einmal frei sein könnte? Aber die Frage nach der Willensfreiheit, dachte ich, kann ausgeschaltet bleiben? M o n t . : Bewegungsfreiheit ist ja nicht ohne weiteres gleichbedeutend mit Willensfreiheit! Aber wenn Sie nun einmal doch einen Moment auf Willensfreiheit und ihre Möglichkeit hinblicken könnten: die Pflanze vermöchte von einem solchen Willen – selbst wenn sie ihn hätte – gar keinen Gebrauch zu machen! Das Tier aber wohl. Beim Tier fehlt nur eben dieser freie Wille – bei der Pflanze aber fehlt überdies die Möglichkeit, eine Bewegung überhaupt aktiv zu v o l l z i e h e n . Sie, die gar nicht eigentlicher Träger und eigentliches S u b j e k t einer Bewegung sein kann. Es fehlt ihr die ontische Möglichkeit, das körperliche Sein von innen her zu beherrschen. {12} P s i l . : Weshalb nennen Sie diese Möglichkeit eine ontische? Ist sie nicht einfach gebunden an gewisse von der Naturwissenschaft längst festgelegte Bedingungen? Die Pflanze besitzt kein Muskel-, besitzt kein Nervensystem. M o n t . : Erstlich verhindert die Kenntnis dieser naturwissenschaftlich fixierten Bedingungen für tierische Eigenbewegungen nicht, daß analoge Bewegungen auch bei Pflanzen auf Grund eben a n d e r e r äußerer Bedingungen auftreten könnten. Denn diese sind ja nur zufällige Gegebenheiten, sind ja nur Fakta. Sie sind aber auch andrerseits nicht mehr als sinnreiche und zweckentsprechende Hilfsmittel, um einer vorgegebenen ontischen Sachlage für das ihr spezifisch eigentümliche Ziel zu d i e n e n : keinerlei Muskel- und Nervensystem, keinerlei physiologische Apparatur für sich allein genommen würde einem körperlichen Wesen dazu verhelfen können, Eigenbewegungen auszuführen.Würde ihm dazu verhelfen können, wenn es nicht eben in der Weise in seinem Leibe „steckte“, wenn es nicht persönlich in der eigentümlichen Weise mit seinem Leibe verbunden wäre, wie es bei einem tierischen Wesen tatsächlich der Fall ist. Auf dieses „personale“ Moment trifft man aber weder in der Anatomie, noch in der Physiologie, kann in ihnen nicht darauf treffen. Daß man heutzutage die tierischen Bewegungen für vollkommen aufgeklärt und erklärt halten kann, wenn man die rein körperlichen Hilfsmittel aufgefunden hat, ist allein daraus zu verstehen, daß man die Bewegungsart, um die es sich handelt, hier also die Eigenbewegung, gar nicht vor Augen hat – daß man, in naturwissenschaftlicher Einstellung ausschließlich befangen, n u r noch ihren körperlichen Vollzug, nicht aber ihre höchst wunderbare ontische A r t u n g sieht. Ontisch darum, weil es sich um das Ganze des betreffenden Lebewesens handelt: um die lebendige Einheit der Pflanze, um die zu einer Art „personalen“ Einheit

Pflanze und Tier

187

zusammengefaßte Einheit des Tieres, nicht aber um die naturwissenschaftliche Dimension der körperlichen Grundlagen. Doch Sie würden mich am besten verstehen, wenn wir mit unserer direkten Analyse fortführen. {13} P s i l . : Ich bin ganz zufrieden, Sie noch einmal zu einer kleinen theoretischen Auslassung verführt zu haben. Mir ist doch Ihre Problemstellung wiederum um einiges klarer geworden. Wenn ich jetzt endlich Sie recht verstanden habe, so meinen Sie, daß der Pflanze die Möglichkeit für eine „freie“ Bewegung fehlt, weil sich die Bewegung eben nur an ihr vollzieht und sie daher nicht wie das Tier eigentlicher Träger und eigentliches Subjekt der Bewegung ist. Daß die Bewegung der Pflanze eine sozusagen passive, die des Tieres eine aktive ist, nicht wahr? Aber immer noch vermag ich nicht recht einzusehen, wieso gerade die Bewegung, von der wir sprachen, jenes Zusammenzucken des Polypen, eine prinzipiell freie, weil eben aktive sein soll. Es erscheint mir viel eher so, als ob solche Reaktionsbewegungen, die eine unmittelbare Folge des Reizes darstellen, sich ebenfalls nur an dem Tiere vollziehen – so wie die Blätterbewegung der Mimose an der Mimose; nicht aber aktive Bewegungen des Tieres sind. {14} M o n t . : Die Fassung, daß sich die Bewegung das eine Mal an dem betreffenden Lebewesen, d. h. a n der Pflanze vollzieht, das andre Mal v o n ihm vollzogen wird, ist trefflich. Jetzt aber hat sich Ihnen das glücklich Gesehene durch eine Doppeldeutigkeit des Ausdrucks „Passivität“ und „Aktivität“ wiederum verdunkelt. Könnte es nicht, Psilander, eine aktive Passivität und eine passive Passivität geben, wenn ich mich so ausdrücken darf? P s i l . : Noch verstehe ich nicht. {15} M o n t . : Denken Sie daran, daß es auch beim Tier und beim Menschen selbst zwei ganz verschiedene Arten Reaktionsbewegungen gibt: die eine, bei der z. B. mein Bein zuckt oder in die Höhe schnellt, wenn mir mit der Hand unter das Knie geschlagen wird; und die andere, wenn ich unmittelbar und unwillkürlich den Fuß zurückziehe, auf den man mir tritt. Unmittelbar und unwillkürlich – denn von Freiheit in dem Sinne, daß ich ihn zurückzöge auf Grund eines freien Willensaktes, von Aktivität in dem Sinne, daß ich das Zurückziehen gleichsam in der Hand hätte, es zwar aktiviere, aber ebensogut unterlassen könnte, kann gewiß hier die Rede nicht sein. Das Zurückziehen ist eine unmittelbare Reaktionsfolge des Schmerzes und ich bin an ihr insofern nur aktiv beteiligt, als ich der Notwendigkeit, meinen Fuß zurückzuziehen, einfach ausgesetzt bin. Und doch, welch ein fundamentaler Unterschied zwischen jenem unwillkürlichen Zucken des Beinmuskels und diesem unwillkürlichen Akt des Zurückziehens! Es ist eben ein von mir ausgehender Akt des Zurückziehens; es ist zwar ein durch den Schmerz e r z w u n g e n e r, ein r e a k t i v e r Akt; ein Akt, dessen Vollzug ich nicht umhin kann zu vollziehen – aber der Aktcharakter selbst wird dadurch nicht zerstört und kann nicht zerstört werden. Das andere aber ist und bleibt nur ein Zucken i m Bein. Ich selbst ziehe den Fuß

188

Metaphysische Gespräche

zurück, obzwar gezwungen, obzwar reaktiv, obzwar ich nicht anders kann – während dort nur eben mein Bein zuckt. Der Polyp selbst zieht seine Fangarme ein, wenn auch gezwungen, wenn auch nur reaktiv, wenn er auch nicht anders kann, wenn auch jede Spur von Willensfreiheit, ja von Bewußtheit fehlt – während die Blätter der Pflanze, der Mimose, sich nur eben a n i h r bewegen.Verstehen Sie, daß zwischen dieser Passivität und jener ein Abgrund liegt, daß wir hier eine in sich selbst aktiv vollzogene Bewegung vor uns haben, mag sie immer als diese aktive dem Vollzieher, dem wirklichen T r ä g e r der Bewegung aufgenötigt sein, daß dort aber schon die Bewegung in sich selbst eine passive ist, weil sie gar nicht von dem betreffenden Wesen a u s g e h t , sondern dieses Wesen gleichsam nur Schauplatz des Bewegungsvollzuges ist? {16} P s i l . : Der Unterschied zwischen einem erzwungenen Sichbewegen und einem erzwungenen Bewegtwerden ist mir in der Tat plötzlich herausgesprungen. Und es scheint mir jetzt, als ob man ihn in den Lehrbüchern der Physiologie nicht genug beachtete. Und doch: wenn ich mir vorzustellen versuche, in welchem Sinne das Tier Subjekt eines „Sichbewegens“ sein könnte – ohne daß noch Willensfreiheit in Betracht kommt – dann entgleitet mir wieder alles. Wenn man von der körperlichen und physiologischen Apparatur absieht, so ist es doch im Grunde das der Pflanze inwohnende L e b e n oder, wie man sich da vitalistisch ausdrücken soll, das die Auslösung lebendiger Bewegungen möglich machen muß. Dieses Leben wohnt dann ebensowohl der Pflanze wie dem Tier inne. Und ich sehe daher nicht recht, wie ein Unterschied zustande kommen soll, wenn anders Sie nicht die Pflanze zu einem ganz mechanischen Substrat ihrer Bewegungen machen wollen. Oder erklären Sie mir näher, was Sie mit dem e i g e n t l i c h e n Träger der Bewegung hier und dem uneigentlichen dort meinen. {17} M o n t . : O ja – Sie drängen zu dem entscheidenden Punkt. Denn auch der Ausdruck „Träger“ ist noch doppeldeutig. Erlauben Sie mir ein kleines Anschauungsexperiment: es gibt, wie man es nennen kann, eine sachliche und eine sentimentale Auffassung des pflanzlichen Lebens und Seins – ohne daß ich übrigens mit letzterem Ausdruck eine Abwertung im Auge habe. Nach der ersten kann man etwa einen kräftigen und hoch gewachsenen Baum als Urtypus echt pflanzlichen Seins vor sich haben: wir sehen ihn nach dem eigentümlichen Formgesetz des ihm einwohnenden Lebens zu dieser Gestalt heraus- und emporgewachsen; wie er mit seinen weit hinausragenden Ästen und seiner Krone vor uns steht, ist er das durch jenes lebendige Formgesetz von innen her bis in die äußersten Zweigspitzen und Wurzelendigungen hinein plastisch Gebildete, aber auch aktuell noch diesem inneren Gestaltungsgesetz lebendig Unterworfene: in dem fortschreitenden Wachstum und der regemäßigen Abfolge der Lebensstufen von der Blüte zur Frucht. Ganz anders bei sentimentaler Betrachtungsweise: seine Krone und seine Äste sind nicht mehr nur die von innen herausgewachsenen, sondern nun vor allem kraftvoll von

Pflanze und Tier

189

ihm selbst getragene und herausgestreckte; er steht – als „Baumperson“ gleichsam – hoch aufgerichtet da; e r klammert sich mit seinen Wurzeln tief in das Erdreich; e r erhebt sein Haupt über den Wald empor; e r greift mit seinen Ästen gebieterisch oder suchend in die Weite. Wo vorher nur Bildung, Formbestimmtheit, Gestalt und Wachstum war, ist jetzt Tragen, Ausgreifen, Einklammern und Emporstrecken. Nicht als ob hier eine wirkliche, aktuell vollzogene Bewegung nötig wäre – wie wenn wir etwa das leise Schwanken der Äste im Wind als ein Neigen und Verneigen auffassen; nur auf die Art und Weise, wie seine Körperlichkeit das eine und das andere Mal zu dem Baum als ganzem steht, kommt es an: das eine Mal als nur lebendig gewachsene und gebildete, das andere Mal als von innen her in dieser aktuellen und zufälligen Haltung faktisch b e h e r r s c h t e . Sie brauchen auch keineswegs schon an Empfindung, an Bewußtsein, an wirkliches seelisches Sein, etwa an Stolz, an Sehnsucht oder dergleichen zu denken. Diese Hineinprojizierung eines bewußten seelischen Seins ist erst eine weitere Stufe möglichen Heraushebens des Baums aus seinem baumhaften Sein. Es kommt hier noch einzig und allein auf das innere Verhältnis zu dem gegebenen körperlichen Sein an. {18} P s i l . : Wobei es auch nichts ausmacht, wenn der Baum immer in einer und derselben Haltung verharrt – verstehe ich recht? M o n t . : Sehr recht. Der Baum könnte ja – so gesehen als „Baumperson“ – in dieser seiner aktuellen Haltung durch irgendeinen Zauber festgebannt worden sein; wie der Küchenmeister im Dornröschen mit der zur Ohrfeige ausgestreckten Hand. In diesem über ihn gekommenen Schlaf, in dieser Unbewußtheit seiner selbst, in dieser inneren Fesselung, weil Unfähigkeit sich zu regen, in dieser Unerlöstheit von einem ihn bannenden Zauber würde er i m m e r noch die sein eigenes körperliches Sein prinzipiell von innen her beherrschende, mit dieser Beherrschungsmöglichkeit seinsmäßig konstituierte, nur eben momentan „gelähmte“ Baumperson darstellen. Als Baum qua Baum ist er aber nicht gelähmt und deshalb, sozusagen a posteriori, bewegungsunfähig, sondern er ist es a priori: er k a n n gar nicht „gelähmt“ werden, weil er keine eignen Glieder hat, die er als solche von innen her besitzt. Das Wesentliche ist, daß Sie gewissermaßen den Wurzelpunkt fassen, an dem letztlich das Umspringen aus der einen Anschauung in die andere geschieht.Wenn Sie den Baum als Ganzes haben und betrachten, was muß dann hier und dort so prinzipiell anders gefaßt werden? {19} P s i l . : Sie sagten selbst, daß es das Verhältnis des Baumes als ganzen zu der ihm gegebenen „Körperlichkeit“ ist. – M o n t . : Wohl – aber was ist es nun a n diesem Verhältnis? P s i l . : Das Vorhandensein oder das Fehlen einer prinzipiellen Beherrschungsfähigkeit von innen her – {20} M o n t . : Gewiss – aber noch fehlt uns der positive Inhalt der Beherrschungsmöglichkeit dort, ihrer Unmöglichkeit hier. Wir stellten die gefühlte Tatsa-

190

Metaphysische Gespräche

che fest, aber wir explizierten sie noch nicht nach ihrem eignen wesentlichen Gehalt. Hängt jener Unterschied nicht daran, daß die pure pflanzliche Einheit gleichsam nur v o n i n n e n n a c h a u ß e n geht, die tierische dagegen noch einmal von außen nach innen h i n e i n oder z u r ü c k genommen erscheint? P s i l . : Noch verstehe ich nicht ganz. Sie sagten doch eben selbst, daß gerade dieses Tragen, dieses Beherrschenkönnen der Körperlichkeit als von innen her geschehend aufgefaßt werden müßte. M o n t . : Aber damit es eben so von innen her geschehen kann, muß die Körperlichkeit nicht nur eine von innen nach außen gewachsene sein, sondern eine von außen nach innen wieder zurückgegebene oder genommene: was ich beherrschen will, muß mir e r r e i c h b a r sein, muß ich b e s i t z e n . Die Pflanze ist nur eine lebendig gewordene und gestaltete Einheit; das Tier aber hat sein körperliches Sein noch einmal „zum Geschenk“ erhalten. Wenn die Körperlichkeit in das lebendige Wesen zurückgewendet und zurückgegeben ist, b e s i t z t dieses Wesen seine Körperlichkeit von innen her und die seinsmäßige Möglichkeit der Beherrschung ist vorhanden. {21} P s i l . : So kann der Polyp seine Fangarme einziehen, weil er sie eben beherrschungsmäßig besitzt – mag dieses Einziehen auch ein ihm reaktiv abgenötigtes, unwillkürliches und unbewußtes sein. Ich fange an zu erfassen. Erst hier kann man wohl eigentlich von einem L e i b e im prägnanten Sinne sprechen. M o n t . : O gut. Sehen Sie, daß die Konstitution der Pflanze sozusagen eine ganz und gar e i n s c h i c h t i g e ist? Weil sie eben nur dieses lebendig herausgewachsene Gebilde darstellt? Hier löst sich die Körperlichkeit nicht von einem „Inneren“, von einem persönlichen Zentrum los. Sobald sich aber die körperliche Lebenseinheit selbst besitzen soll, muß sie von ihrer Körperlichkeit in sich selbst „losgelöst“ werden! Erst das zunächst Abgelöste kann sodann zurückgegeben, kann besessen werden. Da ist dann eine Zweischichtigkeit eingetreten, die körperliches Sein und personales Wesen, wenn auch in einem primitivsten, einem sozusagen embryologischen Anfang, einander gegenüberstellt. Und mit dieser Zweischichtigkeit erst ist, wie Sie richtig sagen, Leib als „Leib“ gegeben und gesetzt. P s i l . : Sie setzen mit Ihrer Anschauungsweise offenbar die Möglichkeit einer direkten Wechselwirkung zwischen Leib und Seele ohne weiteres voraus? {22} M o n t . : Wenn Sie damit meinen, was wir eben sahen, daß das Tier als solches eben selbsteigner, personaler Vollzieher seiner Bewegung, weil selbsteigner, personaler Besitzer seines Leibes ist – ja. Mit einer Seele hat das allerdings so gut wie gar nichts zu tun. In dem traditionellen Streit – ob Wechselwirkung, ob Parallelismus – wird Leib und „Seele“ künstlich getrennt, und man versucht sodann natürlich vergeblich, sie wieder zusammenzubringen. Während es faktisch so liegt, daß zwar zunächst nicht Leib und „Seele“, aber doch Leib und personale Wesenheit ein ontisches Ganzes bilden – von vornherein in ihrer Abgelöstheit voneinander

Pflanze und Tier

191

aufeinander orientiert. Sie sind nur, was sie sind, in ihrer ontischen Zusammengehörigkeit. Es hat gar keinen Sinn mehr zu fragen, ob ich oder ein Tier s e l b s t und d i r e k t meine Glieder bewegen kann oder nicht – wenn man einsieht, daß meine Glieder eben die m i r personaliter anheimgegebene Körperlichkeit und mein personales Wesen, in dieser einen Rücksicht, eben das seine Körperlichkeit B e s i t z e n d e ist! P s i l . : Wo aber hat die Seele denn ihre Stelle? M o n t . : Sollen wir jetzt einfach so weiterrasen? Und noch dazu nach einem so flüchtigen Vogel wie der Seele. Aber vielleicht fangen wir ihn wirklich einmal gemeinsam ein. Es scheint mir fast, als hätten Sie heute ein wenig Lust an dergleichen gewonnen. P s i l . : Sie haben recht, jetzt ist eine gewisse Begierde in mir erwacht. Aber eines darf ich heute noch fragen: wie steht es nun mit der Sensibilität? Denn das war ja eigentlich unser Ausgangspunkt! Ob die Pflanze so etwas wie Empfindungsfähigkeit haben kann oder nicht. Davon aber sprachen wir bisher eigentlich noch nicht. {23} M o n t . : Und können auch jetzt diese Frage unmöglich ganz ausschöpfen. Die allgemeine Frage nämlich nach dem Wesen von Sensibilität und ihrer Stellung im personalen Erleben. Aber an der Einsicht, daß pure pflanzliche Wesenheiten nicht empfinden können, sind wir ganz nahe. Und alles war nur Vorbereitung hierauf. Empfinden heißt doch zunächst ganz gewiß, unmittelbar am Leibe und mit dem Leibe spürend erleben, was an oder in ihm vor sich geht, seine Schicksale unmittelbar erlebend mithaben! Wie aber soll das möglich sein, wenn ich nicht eben diesen Leib als Leib personaliter wirklich z u e i g e n h a b e .Wenn er nicht in jenem Sinne in mich hinein- und zurückgegeben ist, wie wir es zu fixieren versuchten? P s i l . : Dasselbe also, was Eigenbewegung allererst möglich macht, macht auch Sensibilität möglich? M o n t . : Als einer Conditio sine qua non – ja. Denn es ist nicht gesagt, daß bei „Besitz“ des Leibes in diesem Sinne nun auch Sensibilität faktisch ohne weiteres vorhanden sein müßte! P s i l . : Ebensowenig wie Eigenbewegung. M o n t . : Sehr richtig. Eine Pflanze aber ist s i c h s e 1 b s t ä u ß e r l i c h – wie also sollte sie sich spürend haben und beherrschend sich selbst bewegen können? P s i l . : Ich begreife jetzt auch, daß Sie zu Anfang sagten, die Realitätsfrage verlöre an Sinn und Schwergewicht, wenn man einmal die prinzipiellen Typen hat auseinandertreten sehen. {24} M o n t . : Die Frage, ob nun die wirkliche Pflanze eine pure Pflanzeneinheit in dem gekennzeichneten Sinne ist? P s i l . : Ja. Es scheint mir jetzt ebenfalls, daß sie es schon in ihrer Erscheinung ausdrückt – ohne daß ich genauer sagen könnte, was es eigentlich ist.

192

Metaphysische Gespräche

M o n t . : Der leichte und lockere Strukturaufbau der Pflanze, ihr ganz und gar nur zur gefälligen Erscheinungsweise nach außen hin gewendetes und entfaltetes Wesen – ist das nicht der notwendige Habitus jener einschichtigen Wesenheit? Ist nicht die Pflanze dazu geschaffen, daß sich in ihr einmal die p l a s t i s c h e oder wenn man so will auch künstlerische Seite der Natur frei und erschöpfend ergehen kann – die beim Tier und beim Mensch andern, personalen Zwecken untergeordnet werden muß? Hier noch ist die Gestaltung Selbstzweck; beim Tier und Mensch wird sie zum Mittel und zur Basis. Die Pflanze ist gleichsam n u r „Gestaltung“. P s i l . : Und alles was an ihr auftritt, ist Prozeß, nicht Akt. M o n t . : Prozeß, ja. Das gerade ist ein entscheidender Ausdruck. Was gibt stärker das Gefühl eines unpersönlichen Prozesses als die Blätterbewegung der Mimose in ihrer geheimnisvollen lebendigen Rhythmik. Und anders wird es mit jenen „suchenden“ Bewegungen der Rankengewächse auch nicht stehen. {25} P s i l . : So stark wird mir jetzt dieser Eindruck des Unpersönlichen und Selbstlosen der Pflanze, daß sich mir wirklich ein Abgrund auftut zwischen ihr und der „fressenden Eigensucht“ des Tieres. M o n t . : Jetzt, Psilander, ergreift mich die Begierde, mit Ihnen weiter zu sprechen. Aber ich denke, es ist vernünftiger, heute abzuschließen. Wenn es Ihnen recht ist, treffen wir baldigst wieder zusammen.

Die Seele. {26} M o n t a n u s : Sie treffen mich bei einer Überlegung, Psilander, die Ihnen wahrscheinlich ein wenig lächerlich erscheinen wird. P s i l a n d e r : Um so begieriger bin ich zu hören, was es sein mag. M o n t . : Ich dachte darüber nach, weshalb wohl Nixen, Elfen und dergleichen Wesen, die zur Region der Elementargeister gehören, keine Seele haben. P s i l . : Allerdings muß ich gestehen, daß ich noch wenig persönliche Bekanntschaft mit solchem Gelichter gemacht babe. M o n t . : Ich ertrage Ihren Spott, wie Sie sehen. Ja ich behaupte kühnlich, daß ich um einiges besser wissen würde, was denn die Seele wahrhaft sei – vermöchte ich mir nur auf jene Frage eine Antwort zu geben. P s i l . : Aber weshalb wollen Sie ihnen durchaus die Seele verweigern, wenn Sie ihnen schon, wie es fast scheint, eine Art von Existenz zuzusprechen gewillt sind? Was verstehen Sie dann unter einer Seele? Wäre nicht eine Elfe ein ebenso geistig freies Wesen wie Sie und ich? {27} M o n t . : Das sind gar zu viele Fragen und Irrtümer auf einmal, Psilander, als daß ich sie alle ohne weiteres beantworten könnte. Ich spreche den Elementargeistern weder Existenz zu, noch spreche ich ihnen die Seele ab. Ob sie existieren

Die Seele

193

oder nicht, ist mir vorderhand ganz gleichgültig. Und nicht ich spreche ihnen irgend etwas zu oder ab, sondern – um mich philosophisch auszudrücken – in ihrer „objektiven Idee“ scheint es mir beschlossen zu liegen, daß sie keine Seele besitzen, daß sie keine besitzen können. Was unter einer Seele zu verstehen ist, das ist es eben, was ich noch nicht weiß und gar zu gerne finden möchte. Und gerade deshalb versuche ich, alle möglichen Wesen, die, wie es scheint, keine Seelen besitzen, in ihrer nach dieser Richtung eigentümlich andersartigen Seinsstruktur mit dem Menschen oder auch den höheren Tieren zu vergleichen. Sollten wir nicht leichter erkennen können, was der Seele notwendig zugehört, wenn wir sehen, wo sie jedenfalls nicht zu finden ist und weshalb? P s i l . : Halten wir uns doch dabei lieber an die immerhin etwas „wirklichere“ Pflanze, Montanus, als gerade an dieses zweifelhafte Geistervolk. {28} M o n t . : Ich bin nur froh, daß Sie der Pflanze wenigstens keine Seele zuzuschreiben scheinen. Wir wollen sie keineswegs vernachlässigen. Aber sie steht mir den wahrhaften „Seelenwesen“ noch zu fern. Gerade daß jene Geister – der ihnen zugrunde liegenden Idee nach – frei bewußte Wesen wie wir selbst sind, daß sie überdies wie wir eine leiblich-irdische Gestalt besitzen und uns also in diesem allen so nahe wie möglich scheinen und dabei doch das für den Menschen so entscheidende „Etwas“ nicht aufweisen, was wir „Seele“ nennen, – gerade das hat meine philosophische Neugierde so außerordentlich erregt. P s i l . : Verstehen Sie hier unter „objektiver Idee“, was sich aus Sage und Dichtung an einheitlicher Gestaltung dieser Wesen ergeben hat? M o n t . : Glauben Sie denn nicht, Psilander, daß man einem schlechten Dichter vorwerfen kann, er habe das wahrhafte Sein solcher Kreaturen ganz und gar nicht getroffen? P s i l . : Das ist allerdings eine Antwort auf meine ziemlich unbesonnene Frage. Wenn Dichter und Sage diese Gestalten nach ihrer Willkür geschaffen hätten, so könnte es keine sachliche Angemessenheit oder Unangemessenheit geben. Aber, Montanus, ich würde jetzt gar zu gerne von Ihnen hören, wie Sie diese objektive Idee der Elementargeister bestimmen – obgleich doch auch Sie ihnen gewiß noch nicht begegnet sind. {29} M o n t . : Sie sind immer noch ein schlechter Philosoph, Psilander. Meinen Sie denn nicht, daß der Philosoph einem jeglichen Wesen zwischen Himmel und Hölle „begegnen“ kann, wann er ihm nur ernstlich begegnen will? Wenn zwar nicht auf der Wiese, im Wald oder im Himmel selbst, so doch in jenem so wunderbar unerschöpflichen „Reich der Anschauung“? Ich bin aber ganz und gar nicht geneigt, Ihnen hier etwas vorzutragen. Ich sagte Ihnen ja schon, daß ich selber noch ernstlich auf der Suche bin. Wollen wir uns jedoch gemeinschaftlich auf den Weg machen, so wäre ich gar sehr erfreut. P s i l . : Auf den Weg zu den Elfen und Nixen?

194

Metaphysische Gespräche

M o n t . : Nein, auf den zur Seele. Und diesen Weg sollen uns jene ein wenig weisen helfen. Aber beginnen wir bei der Pflanze, Psilander – nun Sie schon einmal auf sie hingewiesen haben. Sie beabsichtigen also nicht, der Pflanze eine Seele zuzuschreiben? P s i l . : Wie könnte ich das nach dem, was wir erst neulich besprochen haben. M o n t . : Wir sahen damals, daß die Pflanze keine Empfindung haben kann, weil sie keinen „Leib“ im echten Sinne besitzt, nicht wahr? Aber wenn Sie auch darin recht haben, daß man wohl einem empfindungslosen Wesen schon von vorne herein die Seele absprechen muß, so sind doch beide Fragen ganz und gar voneinander verschieden und sorglich zu trennen. P s i l . : Aristoteles geht ja allerdings so weit, der Pflanze eine „Seele“ zuzubilligen, die Empfindungsfähigkeit indeß zu verweigern. {30} M o n t . : Auf den Seelenbegriff des Aristoteles wollen wir uns auch in keiner Weise festlegen, Psilander – so fruchtbar er nach gewisser Richtung ist.Wenn wir von der Seele im prägnanten Sinne sprechen, so haben wir sicherlich dabei zunächst etwas völlig andres, wir haben etwas Eigenartiges im Auge, was der Pflanze ihrem Wesen nach nicht zukommen kann. P s i l . : Mir ist schon immer die aristotelische Seelenbestimmung eigentümlich „formal“ erschienen. M o n t . : Ich vermute, es wird sich noch manche Gelegenheit finden, auf sie und ihren wertvollen Sinn hinzuweisen. Jetzt aber, Psilander, lassen Sie uns direkt auf unserm Wege vordringen. Sie werden doch zugeben, daß man eine Pflanze, eine Blume etwa oder einen Baum, sagen wir in der Einstellung des Dichters als beseelt sehen kann – obwohl man weiß und völlig einsieht, daß diese vegetativen Gebilde in Wahrheit nicht beseelt sind? Genau so wie man eine Pflanze als „quasi“ empfindungsfähig sehen kann, trotzdem sie es doch nicht ist und nimmermehr sein kann? P s i l . : Sie unterschieden neulich die sachliche und die sentimentale Auffassung der Natur. In der sentimentalen vollziehen wir eben jene sachlich nicht letztlich zu rechtfertigenden Projektionen. M o n t . : Gut. Man kann also eine Blume „gleichsam“ so sehen, als hätte sie eine Seele. P s i l . : Ich glaube wohl. {31} M o n t . : Und wenn wir das herauszuholen vermöchten, was wir bei dieser Einstellung hineinprojizieren, so würden wir doch notwendig etwas in die Hand bekommen, was uns eben so recht eigentlich als Seele gilt? Denn sonst hätten wir ja nicht gerade das hineingelegt? P s i l . : Das ist einleuchtend. M o n t . : Nehmen Sie etwa diese Narzisse vor uns, Psilander, und geben Sie ihr – als ein wahrer Dichter – eine Blumenseele, eine Narzissenseele.

Die Seele

195

P s i l . : Ich glaube fast, Montanus, die Narzisse sieht mich jetzt wie aus einer Seele heraus an. M o n t . : Und damit sagen Sie zugleich etwas Wesentliches. Die Narzisse scheint Sie „wie aus einer Seele heraus“ anzusehen – sie geht gleichsam vor Ihnen auf aus dieser ihrer Seele, nicht wahr? Ihr ganzes eigentümliches Sein, wie es sich da vor Ihnen in Reinheit und Anmut gibt, scheint die unmittelbare „Spiegelung“ oder „Projektion“ eines eigentümlichen immanenten, gleichsam „geistigen“ Zentrums zu sein, aus dem sie also „hervorstrahlt“ – so ungefähr könnte man sich vielleicht ausdrücken? P s i l . : Eine ähnliche Anschauung habe ich auch. Sie läßt sich aber doch schwer prägnant fassen. M o n t . : Das fühlen Sie allerdings richtig heraus, daß wir hiermit noch nichts Ernsthaftes und Solides in der Hand haben. Auch befürchte ich, Psilander, daß wir doch schließlich auf diese Weise nicht so sehr viel weiter kommen. {32} P s i l . : Wenn wir bei der Pflanze bleiben? M o n t . : Wenn wir der Pflanze durchaus eine Seele aufdrängen wollen, um zu sehen, was an dieser Seele ist. Denn die Pflanze widersteht im Grunde der Aufnahme einer wahren Seele. Wir können sie nicht eigentlich in sie hinein verankern und gelangen so nur zu einem gewissen Aspekt von Seelenhaftigkeit, zu einer puren „Oberflächenseele“. Die Pflanze widersteht der eigentlichen Beseelung im Grunde weit mehr als der Aufnahme von Sensibilität. P s i l . : Aber andrerseits, Montanus, schien es mir gerade, daß die spezifische „Blumenhaftigkeit“ durch das Hineinlegen einer Seele in sie – darnach, wie Sie es eben zu fassen und zu schildern versuchten – viel reiner und unverfälschter bewahrt wird als durch den Versuch, sie mit Sensibilität zu versehen, sie zu einem „leibbesitzenden“, sich im Leibe regenden und bewegenden Wesen zu machen. {33} M o n t . : Das widerspricht sich nicht. Reell oder ontisch steht die Pflanze dem nur empfindungsfähigen Wesen, dem niedern Tier, entschieden näher als dem beseelten; rein seinsmäßig ist sie für diese Art Ausgestaltung „aufnahmefähiger“. Aber Sensibilität und Leibbeherrschung bleiben immer Sensibilität und Leibbeherrschung, wo man sie auch hintun mag: die Pflanze wird eben notwendig „Tier“ durch dieses Spezifikum des tierischen Daseins. Bei der Gestaltung und Ausgestaltung der Seele dagegen können wir uns nach dem Wesen, das diese Seele besitzen und von ihr aus leben soll, richten. Und so figurieren wir uns eben in Anlehnung an das Wesen der Blume – eine wirkliche „Blumenseele“, mag das auch aus fundamentalen Gründen noch so wenig „eigentlich“ gelingen.Wir werden vielleicht später noch besser sehen, was es mit dieser Blumenseele in Wahrheit für eine Bewandtnis hat. Lassen wir jetzt jedenfalls alle poetischen „Projektionen“ und Verwandlungskünste. Nur dieser eine Punkt, Psilander, der mit dem Vorigen schon einigermaßen deutlich herausgetreten sein dürfte, könnte vielleicht doch von Wichtigkeit sein:

196

Metaphysische Gespräche

daß nämlich die Sphäre des Leibbesitzes und der Sensibilität gar nichts oder doch wenig mit der Sphäre, in der sich die Seele eigentlichst abgrenzt, zu tun hat? P s i l . : Wenn die Sache wirklich so liegt, Montanus – ich sehe es noch nicht klar –, dann müßten doch auch beim Menschen diese beiden Sphären auseinandertreten. Da der Mensch ebensowohl – und zwar im reellen und eigentlichen Sinne – ein leiblich-sinnliches wie auch ein seelisches Wesen ist, so würden wir es hier vielleicht besser sehen. M o n t . : Gut, Psilander. Lassen Sie uns das untersuchen. Würden Sie zugeben, daß wir in unsern gesamten Leib „persönlichst“ hineingegeben sind – daß wir genau dort auch „persönlichst“ anwesend sind, wo wir einen körperlichen Schmerz empfinden, etwa im Finger? {34} P s i l . : Ich glaube wohl. Jedenfalls schien es mir immer, daß alle jene Theorien die Sachlage erheblich verfälschen, die uns glauben machen wollen, wir erlebten einen leiblichen Schmerz, Druck und Wärme und dergleichen „im“ Bewußtsein oder „in“ der Seele, nicht aber an und in der betreffenden Leibesstelle selber. M o n t . : Und wo wir Schmerz empfinden können, müssen wir doch auch sein – wir persönlich? P s i l . : Allerdings. M o n t . : In irgend einem Sinne bin ich also meinem Leib, bin ich ihm bis in die „äußersten Fingerspitzen“ hinein wahrhaft „ausgeliefert“ oder vielmehr: „mein“ Leib reicht eben so weit, als ich ihm in dieser Weise ausgeliefert bin? P s i l . : Das sehe ich. Aber die alte Frage, Montanus, wie es doch sein kann, daß „ich“ räumlich ausgebreitet sein soll? M o n t . : Lassen Sie uns die Seele nicht aus dem Auge verlieren! Wie das Ich mit dem Leibe zusammenhängt, ist eine Frage für sich. Und wie ich glaube, unter Voraussetzung gewisser Einsichten keine so absolut unlösbare.Wir wissen jetzt nur und brauchen auch nur zu wissen, daß das Ich am gesamten Leibe reell teilnimmt, daß es aber doch weder sein „Geist“ ist, noch seine „Seele“ ist, mit denen es also in den Leib hineingegeben erscheint. Oder wollen Sie das behaupten? {35} P s i l . : Man spricht doch aber von einer „Beseeltheit“ der Hände? M o n t . : Wenn Sie dabei die schlichte Ichbelebtheit im Auge haben, die eben den „Leib“ vom „Körper“ unterscheidet, dann geht diese Wendung auf das, was wir eben besprachen. Aber dabei ist doch gewiß von der Seele im prägnanten Sinne die Rede nicht. P s i l . : Nein – ich meinte es in dem ganz andern Sinne, wie man ebenfalls von einer beseelten Gebärde oder davon redet, daß „die Seele in die Augen tritt“. M o n t . : Hierbei gibt es einen Gradunterschied, Psilander, nicht wahr? Die Hände des einen Menschen sind beseelter als die des andern?

Die Seele

197

P s i l . : Ja – und ich sehe jetzt, daß sich schon dadurch die eigentliche Beseeltheit aufs Deutlichste von der blossen Inwohnung des Ich im Leibe unterscheidet; denn diese muß immer ein und dieselbe sein, soweit es sich eben um einen Leib handelt. Auch wohne ich ja in meinem gesamten Leibe, während doch nur einzelne Leibesteile in jener Weise „beseelt“ sein können. Aber wie verhält es sich nun mit dieser Beseeltheit, Montanus? Es scheint sich uns jetzt gerade ein ganz enger Zusammenhang zwischen „Seele“ und Leib herausgestellt zu haben. Es sieht ja nun fast so aus, als ob ich in doppelter Weise in meinem Leib wäre – einmal „ich schlechthin“, oder wie man sich da ausdrücken soll, und andrerseits ich durch meine oder mit meiner Seele. {36} M o n t . : Allerdings besteht nach gewisser Richtung ein sehr enger Zusammenhang auch zwischen der Seele im prägnanten Sinne und dem Leib. Aber dieser Zusammenhang ist eben ein fundamental andrer, als der zwischen Leib und „Ich schlechthin“, wie Sie sagen. Die Beseeltheit meiner Hände besteht doch gewiß nicht in meinem reellen Innewohnen meiner Seele „in“ den Händen, so wie man es in bezug auf das leiblich konstituierte Ich sagen konnte? P s i l . : Es scheint allerdings nicht. M o n t . : Denken Sie einmal daran, Psilander, wie sich seelische Erregungen, wie sich eine die Seele durchzitternde Freude oder ein aus der Tiefe der Seele aufsteigender Groll im Leibe, wie wir sagen, zu „malen“, wie er sich in ihm niederzuschlagen pflegt; „wohnt“ hier der Groll oder wohnt hier die Freude – sie selbst – im Leib oder im Gesicht? P s i l . : Wenn Sie von einem „sich Niederschlagen“ dieser Seelenzustände im Leibe sprechen, so scheint mir das jetzt ein besonders treffender Ausdruck zu sein. Es ist, als wenn die Seele in den Leib hinein gleichsam ausstrahlte oder besser noch: sich in ihm spiegelte. M o n t . : Das ist eine ausgezeichnete Wendung, Psilander, und gibt genau das wieder, was ich gerade suchte. Einerseits „wohne“ ich in meinem Leibe schlechthin, bin ihm faktisch und reell ausgeliefert; aber meine Seele andrerseits oder ich, sofern ich „Seele“ bin, strahle nur in diesen Leib aus oder spiegle mich in ihm wieder. Aber werfen Sie jetzt einen Blick auf unsre „Blumenseele“ zurück. {37} P s i l . : Ich dachte schon daran: jene Fassung und die Anschauung, die wir jetzt gewonnen haben, stimmen so ungefähr miteinander überein. Die künstlich beseelte Blume, so sagten Sie etwa, scheint wie aus einem immanenten Zentrum heraus vor uns aufzugehen, so daß die eigentümliche Art ihres „Erscheinens“ sich als eine „Spiegelung“ dieses ihres innern Seins darstellt. Und doch muß ich gestehen, daß ich noch keineswegs befriedigt bin, Montanus. Ich dachte mit der Seele recht eigentlich in die „Tiefe“ des Seins hinabzusteigen. – M o n t . : Und dabei haben wir uns bisher nur in „Spiegelungen“ und „Ausstrahlungen“ herumgetrieben, nicht wahr?

198

Metaphysische Gespräche

P s i l . : Ja – so ungefähr. M o n t . : Aber haben wir denn bisher mehr gewollt, als uns in irgend einer Richtung über das Verhältnis von Seele und Leib klar werden oder besser über einen gewissen Unterschied zwischen dem Ich, sofern es ein leibliches Ich ist oder dem Leib innewohnt und ihn wahrhaft beherrscht, und dem Ich, sofern es ein seelisches Ich ist oder eine Seele besitzt? Über die Seele selbst wissen wir damit noch gar wenig. Oder könnten Sie etwa jetzt angeben, weshalb Nixen und Elfen keine Seele haben? {38} P s i l . : Das könnte ich nicht behaupten. M o n t . : Solange aber wissen wir auch noch nichts von der Seele selbst. Aber verachten Sie deshalb das bisher Besprochene nicht. Wir wollen der Seele doch erst einmal einen „Ort“ bestimmen – wollen finden, „wo“ sie eigentlich in der so kompliziert aufgebauten Ichtotalität steckt. Und da, scheint mir, haben wir gar nichts so Geringes gewonnen. Sie müssen nämlich beachten, wie sich uns das Ich in verschiedene Dimensionen hineingestellt oder gespalten hat und wie sich diese so sehr eigentümlich zueinander verhalten. Wir streiften flüchtig das Ich, sofern es sich geistig darlebt; wir sahen, wie eben dieses Ich nach andrer Richtung einem Leibe ausgeliefert ist und ihn beherrscht. Und wir lernten davon das Ich, sofern es eine Seele hat, unterscheiden. Scheint es Ihnen jetzt nicht gerechtfertigt, wenn man etwa sagen würde: das Ich „erhebt“ sich zum Geist oder geistigen Sein; es ist durch den Leib ins äußerliche Sein oder Dasein hinein- oder hinausgestaltet? Und in der Seele – ja, wie nun? P s i l . : Und in der Seele scheint das Ich recht eigentlich „zu Hause“ zu sein. M o n t . : Vortrefflich. Und wenn es sich also zeigt, daß sich das Ich im „Geist“ gleichsam über sich hinaus oder „in die Höhe“ entfaltet, im Leib aber aus sich heraus oder ins äußere Dasein hinein, stellt sich da die Seele nicht als ein rechtes Zentrum oder als eine eigentliche Mitte für die Totalität des gestalteten und aufgebauten Ich dar? {39} P s i l . : Könnte man nicht vielleicht hinzufügen, daß das Ich, wie im Geist in die Höhe und im Leib gleichsam in die „Breite“, so mit der Seele in die „Tiefe“ oder in die eigene Tiefe hinein ausgestaltet ist? M o n t . : Sie führen das von mir angedeutete Bild weiter und obwohl man recht vorsichtig mit dergleichen Bildern sein muß, haben Sie doch in einem Punkt das durchaus Richtige getroffen: wenn ich die Seele die „Mitte“ gleichsam des Ichganzen nannte, so sind wir hiermit immer noch bei der Stellung der Seele innerhalb des Ichganzen stehen geblieben; sie, die Seele selbst, gewinnen wir erst, wenn wir, wie Sie sagen, in die eigene Tiefe des Ich hinabsteigen. P s i l . : Da Sie immer von einer Gestaltung oder Ausgestaltung des Ich in den Geist, den Leib, die Seele hinein sprechen, ist Ihnen also das Ich oder die Ichheit

Die Seele

199

irgend etwas noch Besondres neben oder besser vor diesen ihren möglichen Ausgestaltungsdimensionen? M o n t . : Scheint es Ihnen nicht, daß man so unterscheiden muß? Nicht allerdings, als ob das „pure“ Ich schon eine für sich allein konkrete Einheit bilden könnte. Ein Ich, oder wie man besser sagen kann, ein selbstiges Wesen bedarf der bestimmten Gestaltung oder Figurierung, sonst bleibt es ein „Nichts“. Aber andrerseits ist das Ich sicherlich nicht nur die einfache „Zusammensetzung“ – das Ganze – von „Seele“ und „Leib“. Ein selbstiges Wesen ist aus einer einzigen Wurzel herausgestaltet; hier ist die Stelle, in der das Ich gleichsam „anhebt“, um sich als dieses eine einzige Ich in Seele, Geist und Leib, beim Menschen wenigstens, eigentümlich zu spalten. Aber ich glaube, Psilander, wir dürfen uns nicht in das Eigenartige eines selbstigen Wesens als solchen verlieren. {40} P s i l . : Nein, aber es ist doch gut, eine gewisse Grundanschauung zu haben, auf der sich das Übrige aufbaut. Der herrschenden Ansicht scheint immer die Seele oder auch der Geist (das „Bewußtsein“) mit dem Ich schlechthin zusammenzufallen, der Leib aber dem Ich nur äußerlich anzuhangen, so daß es schon einer gewissen Umstellung bedarf, um Leib, Seele und Geist dem Ich als gleichermaßen zugehörig zu sehen oder als ebenso viele eigentümliche Gestaltungsbereiche dieses einen und selben Ich. M o n t . : Da haben Sie allerdings vollständig recht. Das Ich ist Ich; Seele, Geist und Leib aber gehören ihm zu. Oder auch: das Ich ist es selber; aber es besitzt Seele, Geist und Leib. Hier ergeben sich auch die möglichen Unterschiede in den konkreten Gestaltungseinheiten: nur der Mensch hat Seele, Leib und Geist. Ein niederes Tier ist in seiner Selbstheit nur leiblich-sinnlich gestaltet; ein höheres Tier lebt schon von einem seelischen Zentrum aus, erhebt sich aber nicht zu freier Geistigkeit. Ein rein geistiges Wesen wäre nur geistig figuriert und besäße, wie es mir scheint, ebenso wie keinen Leib, so auch keine Seele: es bedürfte ihrer nicht. Elementargeister aber würden wiederum geistig und leiblich gestaltet sein; doch sie ermangeln der Seele. So also haben wir neben der leiblich-seelisch-geistigen Totalität des Menschen und der leiblich-geistigen Einheit der Elementargeister eine nur leiblich-sinnliche Figuration beim niedern Tier und eine nur geistige bei den höhern Geistern. Aber, Psilander, kann es nun wohl auch ein nur seelisches Wesen geben? {41} P s i l . : Darauf vermag ich keine Antwort zu geben. M o n t . : Weil wir von der Seele und ihrer Stellung im Menschen immer noch gar wenig wissen. Denn wenn auch Seele, Geist und Leib, wie Sie sagten, „gleichermaßen“ dem Ich zugehören, so ist doch ihre Stellung, ihre Funktion, ihre Bedeutung in der Ichtotalität eine fundamental voneinander abweichende. Ich glaube, es könnte uns jetzt bei einem Blick auf die Elementargeister und ihre „Seele“, be-

200

Metaphysische Gespräche

ziehungsweise ihre Seelenlosigkeit manches aufgehen. Was meinen Sie, Psilander, wie sich wohl diese Geister von einem richtigen Menschen unterscheiden müßten? P s i l . : Ich sehe zunächst nur, daß sie allerlei tun könnten, was wir Menschen nicht können – daß sie in wunderbarer Weise verschwinden und wieder aufzutauchen vermöchten, daß sie sich unsichtbar machen könnten, daß sie in gewissem Maße Macht über Zeit und Raum hätten, daß sie über Kräfte der Natur frei verfügen können, die uns gänzlich verschlossen sind und was dergleichen wunderbare Dinge mehr sein mögen. {42} M o n t . : Aber scheint es Ihnen nicht, als ob das alles nur eine sekundäre Folge ihres von der menschlichen Natur so fundamental verschiedenen Wesens sein würde – als ob ihnen das alles nicht nur so ganz zufällig zueignen würde? Wenn ein Mensch alle diese Fähigkeiten erlangte, würde er damit aufhören, „Mensch“ zu sein – würde er ein „Elementargeist“ werden? Und Sie sprechen überdies nur von den „Vorzügen“ solcher Wesen. Sollte aber die Geschichte von der Nixe, der so sehr nach dem Menschentum, vor allem aber nach menschlichen Tränen verlangt, nicht einen bedeutsamen sachlichen Grund haben? P s i l . : Menschen können weinen, weil sie eine Seele haben. M o n t . : Wieviel liegt doch in dieser einfachen Einsicht, Psilander – als wenn wir damit sofort der Seele und ihrem Wesen ganz nahe kommen könnten. Und doch ist es so überaus schwer, sie zu fassen. Übrigens schließt diese Geschichte, was die rein sachliche, oder wir können auch sagen philosophische Fundiertheit betrifft, schon eine gewisse Inkorrektheit in sich – wie es bei jenen poetischen Gebilden der Fall ist, die die gesonderten Gestalten des unendlich reichen Daseins durcheinanderwirren und mischen: eine Nixe, die sich nach dem menschlichen Dasein „sehnt“, hat im Grunde schon eine Seele oder doch das Rudiment einer solchen. Im ursprünglichen Volksmärchen finden wir daher auch diese sentimentale Wendung nicht. {43} P s i l . : Sie meinen, daß ein solcher Geist in der Sphäre, der er nun einmal zugehört, vollständig Genüge finden müßte? M o n t . : Aber nicht, weil er besonders „genügsam“ wäre oder dergleichen. Sondern weil sich sein gesamtes Sein mit dem Dasein und dem Leben in der Sphäre, der er zugehört, erschöpfen müßte. Scheint es Ihnen nicht ein Charakteristikum zu sein, daß diese Wesen im Unterschied zum Menschen in der Aktualität ihres eigentümlichen Daseins in bestimmtem Sinne restlos aufgehen müßten – während der Mensch wie aus einem Grunde, der noch „jenseits“ seines aktuellen Daseins liegt, heraus- oder hervorlebt? P s i l . : Vielleicht fällt das, was Sie meinen, mit einer Vorstellung zusammen, die ich schon die ganze Zeit über habe, aber nicht auszudrücken wußte: der Mensch stellt sich mir gegenüber allen bloßen „Geistern“, auch den leiblich gestalteten – soweit ich überhaupt eine Anschauung von ihnen gewinnen kann – wie beschwert

Die Seele

201

in sich selbst oder auch in seinem eigenen Sein eigentümlich „fixiert“ dar, während jene durch eine gewisse „Leichtigkeit“ oder eben „Unbeschwertheit“ oder auch „Ungebundenheit“ des Seins und Daseins ausgezeichnet sind. Ich weiß nur nicht, wie ich mir diesen Aspekt der Leichtigkeit hier und der Schwere dort erklären und wie ich ihn begründen soll. Was Sie jedoch eben von dem „jenseitigen Grund“ sagten, schien mir die Sache schon faßbarer zu machen. {44} M o n t . : Dieser Hinweis ist trefflich, Psilander. Ich wüßte nicht, was den phänomenalen Unterschied im Charakter dieser beiden Wesen besser fassen könnte. Aber sagen Sie: Sie verstehen doch das Ganze nicht etwa psychologisch? Es gibt natürlich – im psychologischen Sinne – Menschen mit und ohne „Hintergründe“; Menschen, die restlos in ihrem Sein und Tun „aufgehen“ und solche, die immer noch „jenseitig“ bleiben. Hiervon sprechen wir selbstverständlich nicht. Denn der Mensch als Mensch hat eine Seele, und wenn wir also etwas Richtiges mit diesem jenseitigen Grund im Auge hatten, durch den der Mensch, wie Sie so richtig sagten, gleichsam „schwer“ in sich selbst gemacht wird oder in sich selbst hineingebunden oder fixiert erscheint, dann muß dieses Moment notwendig, weil konstitutiv, einem jeden Menschen zukommen – mag es auch bei diesem deutlicher heraustreten als bei jenem; denn es gibt ja gleichsam „seelenlose“ Menschen, und es kann für uns gewiß noch interessant genug werden, diese zu charakterisieren. Auch hat Ihre „Daseinsschwere“, wie ich sehe, nichts mit Schwerlebigkeit einzelner Menschen, ihrer Schwermütigkeit, Schwerfälligkeit, ihrem ernsten und gleichsam „schweren Sinn“ zu tun? {45} P s i l . : Ganz und gar nicht. Ich dachte mir die Sache ungefähr so, wie man einen Stein durch seine Schwere charakterisiert: er ist schwer, weil er gar nicht anders existieren kann – wenn er nämlich als „Stein“ existieren soll; es ist dieses Moment nicht von ihm abzunehmen, ohne ihm sein gesamtes Wesen zu rauben. M o n t . : Genau so verhält es sich also mit jener andern „Schwere“? Denn Sie wollen wahrscheinlich diese und jene nicht auch sonst auf eine Linie stellen? P s i l . : Nein, Schwere hier natürlich in übertragenem Sinne, soweit nämlich ein geistiges Wesen so etwas überhaupt an sich haben kann. M o n t . : Nennen Sie den Menschen ein vornehmlich „geistiges“ Wesen? P s i l . : Ich denke wohl, daß man ihn so nennen kann, daß es eben sein freies, geistiges Sein ist, durch das er sich vornehmlich von andern Wesen unterscheidet. M o n t . : Von den niedrigeren Wesen? Von den Tieren? P s i l . : Ja, hauptsächlich allerdings von den Tieren. M o n t . : Und von den höheren Geistern? Wenn es solche höhere Wesen gäbe, würde es sich da nur um einen Rang- oder Gradunterschied zwischen ihnen und den Menschen handeln, oder würde nicht vielmehr die gesamte ontische Struktur eine andre sein?

202

Metaphysische Gespräche

P s i l . : Meinen Sie also, Montanus, das unterscheidende Wesen des Menschen läge in dem Besitz einer Seele? {46} M o n t . : Das wäre zu voreilig geurteilt. Es könnte ja doch sein, daß der Besitz einer Seele nur eben eine notwendige Folge seines wirklichen, seines eigentlichen Wesens ist.Vielleicht sagten Sie doch eben nicht so ganz unrichtig, daß es vornehmlich seine freie Geistigkeit ist, durch die sich der Mensch als Mensch auszeichnet. Er hat nur vielleicht in und mit seiner Geistigkeit – und wie wir dazusetzen wollen, in und mit seiner Leiblichkeit, da ja auch diese ihm nicht so ganz zufällig anhangen mag – eine ganz und gar andre Stelle und Bedeutung im Dasein als irgendwelches mögliches Geistervolk haben mag, und eben die besondere Stellung macht für ihn einen ganz und gar andern inneren „Aufbau“, macht für ihn auch den Besitz einer Seele notwendig. P s i l . : Ich verstehe wohl rein logisch eine solche Möglichkeit, aber was Sie in Wahrheit damit andeuten wollen, durchschaue ich noch keineswegs. M o n t . : Kommen wir noch einmal zu unserm letzten Ausgangspunkt zurück, Psilander. Könnte man nicht sagen, daß ein Geist immer einer ganz bestimmten Sphäre zugehören muß – daß er dieser Sphäre in seinem Sein und Dasein eigentümlich „verschrieben“ ist? P s i l . : Wenigstens bei jenen Elementargeistern sehe ich etwas Derartiges; sie sind von einer bestimmten Natursphäre unablöslich. Das lag ja schon in dem, was wir vorhin besprachen. {47} M o n t . : Ich meine allerdings, daß alle „Geister“ schlechthin, die Naturgeister wie die höheren, einer solchen bestimmten Sphäre oder Dimension notwendig verbunden sein müßten. Aber lassen wir das jetzt beiseite und halten wir uns zunächst an unsre Elementarwesen. Nicht nur jeder typische Naturbezirk (Wald, Wiese, Berg), sondern auch jede geographisch eigenartige Gegend muß ihre speziellen Naturgeister haben, Griechenland andre als der „neblige Norden“, nicht wahr? Und dazu ein jedes Element wie Feuer, Luft und Wasser einen besonderen? P s i l . : Selbstverständlich. M o n t . : Aber wie ist nun der so sichtlich enge Zusammenhang zwischen einer solchen Natursphäre und ihren Geistern beschaffen? P s i l . : Es scheint fast so, als seien diese Geister aus einer solchen typischen Sphäre herausgeboren, als sei der „ureigene“ Geist dieses Naturbezirkes in einem persönlichen Wesen gleichsam „verdichtet“ worden. M o n t . : „Persönliche Verdichtungen“, man kann auch sagen „Substanziierungen“ des ureignen Geistes einer Natursphäre: der „Geist“ der Natur ist zu einem Geist geworden. Ist aber das nur ein Entstehungszusammenhang? Es schien uns doch vorhin, als bestünde eine immerwährende Beziehung zwischen dem gesamten Sein und Dasein eines solchen Wesens und dem Bezirk, dem er zugehört? P s i l . : Die Geister kommen von ihrer Sphäre nicht „los“.

Die Seele

203

{48} M o n t . : Aus einer Art Anhänglichkeit an sie als die „Mutter“ gleichsam ihres Daseins? P s i l . : Sie können nicht anders. M o n t . : Aber weshalb? Unterliegen sie einem physischen oder psychischen Zwang? P s i l . : Nein – sondern sie können irgendwie nur mit und in der betreffenden Sphäre als solcher bestehen. Es ist wie vorhin mit dem Stein und der Schwere. M o n t . : Die Zusammengehörigkeit bleibt also eine konstitutive? P s i l . : So scheint es mir. M o n t . : Aber wie wollen wir sie nun fassen? Es sind doch bei aller Abhängigkeit selbständige Wesen, für sich und in sich stehende und bestehende? P s i l . : Sonst würden sie allerdings nicht frei aus sich heraus handeln können, was doch zu ihrem Wesen zu gehören scheint. M o n t . : Sie bleiben also jedenfalls dem Geist der Natur oder des betreffenden Naturbezirkes nicht einfach seinsmässig unterworfen, werden in ihrem aktuellen Sein und Tun durch diese äußere Sphäre nicht schlechthin bestimmt und beherrscht. P s i l . : Gehört es nicht gerade umgekehrt zu ihrer besondern Eigentümlichkeit, daß sie ihrerseits die Natur oder das Element, dessen Geist sie sind, beherrschen? Das Element ist ihnen untertan, nicht sie dem Element. {49} M o n t . : Sie scheinen doch mehr von diesem „Gelichter“ zu wissen, Psilander, als Ihrer anfänglichen Verachtung angemessen ist. P s i l . : Sie haben recht, über mich zu lachen. Aber man weiß eben, wie Plato so richtig lehrt, immer mehr als man selber annimmt. Übrigens schwebte mir eben das ganz konkrete Bild des Luftgeistes Ariel aus dem „Sturm“ vor. Er ist Herr über die Winde und das Feuer; er erzeugt in der Atmosphäre jene himmlische Musik; er hat die Leichtigkeit, Schnelligkeit und Verwandlungsfähigkeit eben des luftigen Elements, dem er zugehört. Alles sieht viel eher so aus, als ob in ihn der Geist dieses Elements wahrhaft übergegangen sei, so daß er es sowohl äußerlich beherrschen, als auch frei in sich alles das verwirklichen kann, was diesem „Geist“ entspricht. M o n t . : Prachtvoll, Psilander. Ich glaube fast, Sie haben die Lösung der Sache schon unversehens mitgefaßt. Nicht äußerlich beherrscht wird ein solcher Geist von dem „Geist“ der betreffenden Natursphäre oder des Elements, sondern in ihm selbst lebt dieser Geist. Er, der Elementargeist selber ist der freie, weil eben persönliche Träger oder Manifestator dieses „Geistes“. Er ist nur er selbst, insofern er ihn in freier Weise immerwährend in sich aktualisiert oder ihn in sich „darlebt“. Gebunden an ihn ist der Elementargeist, weil er nichts anderes sein kann als eben der persönliche Träger oder Manifestator gerade dieses „Geistes“; frei aber ist er in ihm und zugleich „Herr“ über ihn – wie über die äußere Sphäre, in der derselbe „Geist“ naturhaft gestaltet und gleichsam „niedergeschlagen“ ist, weil er als persönliches

204

Metaphysische Gespräche

Wesen innerhalb der Grenzen seiner von jenem Geist getragenen Seins-Totalität schalten und walten kann, wie er mag und will. Jetzt versteht man erst richtig, weshalb ein solches Wesen so unabtrennbar an die Sphäre gefesselt ist, der es gleichsam „entstieg“. {50} P s i l . : Weil er eben nur von und in dem Geiste lebt, der in der Natursphäre, wie Sie sagen, äußerlich niedergeschlagen ist? M o n t . : Wohin anders soll er gehören, Psilander, als in das Bereich, in das ihn sein eigener Geist, durch den er und in dem er in sich selbst lebt und ist, in ununterbrochener Aktualität hinweist und hintreibt? P s i l . : Das leuchtet allerdings ein. Aber wie kommt es überhaupt zu dieser Doppeldeutigkeit des Begriffs „Geist“, Montanus? Das drängte es mich schon immerwährend zu fragen. Was heißt es, daß ein bestimmter „Geist“ in der Natur gestaltet ist – ebenderselbe „Geist“, der in dem Elementargeist in persönlicher Substanziierung leben soll? M o n t . : Sie haben recht, Psilander. In diesem Punkt liegt noch sehr viel Unaufgeklärtes. Um so mehr, als wir im Grunde überhaupt noch nicht wissen, was „Geist“ ist, was „geistiges Sein“, was ein „geistiges Wesen“ und so weiter.Wie wir jetzt auf der Suche nach der Seele sind, so müßten wir uns einmal auf die Suche nach dem Geist begeben, wobei uns vielleicht das, was „Geister“ in dem persönlichen Sinne sind, erst völlig deutlich zu werden vermöchte. Jedenfalls brauchten wir – rein phänomenal – den Unterschied zwischen dem in der Natur äußerlich fixierten oder niedergeschlagenen und dem in einem persönlichen Wesen substanziierten Geist. Lassen Sie sich erst einmal mit der gewonnenen Anschauung begnügen. Es war nur eine Station auf unserem Weg zur Seele. Ich hoffe, daß wir gleich eine weitere erreichen. Glauben Sie, Psilander, daß auch der Mensch einer bestimmten Sphäre unveränderlich zugehört? {51} P s i l . : Wenn man nicht sagen will, daß er der Erde, natürlich nicht dem Element, sondern diesem Planeten wahrhaft angehört. M o n t . : Gut. Aber steht der Mensch zu seiner Erde ebenso wie Ariel zur Atmosphäre? P s i l . : Entschieden nicht. M o n t . : Sagten wir nicht, daß jene Geister deshalb ihrem Naturbezirk so eng verbunden sind, weil eben derselbe Geist – als der sie fundamental bestimmende – in ihnen waltet wie in der betreffenden Sphäre? P s i l . : Also müßte wohl der Mensch vom „Geist der gesamten Erde“ ebenso in seinem Sein und Dasein durch und durch bestimmt erscheinen wie Ariel vom Geist der Atmosphäre – wenn der Mensch zur Erde ähnlich nahe gehören sollte. Aber gibt es denn so etwas wie einen „Geist der gesamten Erde“? {52} M o n t . : Das wollen wir jetzt nicht untersuchen, Psilander. In dem, was Sie sagten, war ein für unsre Frage unmittelbar viel wesentlicherer Hinweis enthalten.

Die Seele

205

Ist der Mensch in seinem Tun und Dasein überhaupt in derselben Weise von einem bestimmten „Geist“ aus orientiert wie jene Wesen? P s i l . : Das Sein des Menschen erscheint in dieser Beziehung weitaus „freier“: es ist nicht in sich auf eine bestimmte Dimension von vorn herein festgelegt. M o n t . : Gewiß – aber woran liegt das? Hängt es nicht mit einer von Grund auf andern Seinskonstitution zusammen? Wenn wir davon sprachen, daß ein jeder Elementargeist von einem bestimmten „Geist“ ausschließlich durchwaltet sei, so hat das einen noch fundamentaleren Sinn als der vorhin herausgestellte. Es heißt nicht nur, daß der Elementargeist nichts andres sein kann als der persönliche „Träger“ dieses Geistes, sondern es heißt überdies, daß seine gesamte Figuration, seine eigentümliche Totalgestalt durch diesen spezifischen Geist bestimmt, geformt, substanziiert ist. Es ist nichts an ihm, was nicht durch den ihn in ununterbrochener Aktualität substanziierenden Geist heraus- und heraufgeführt wäre. Man kann ihn deshalb ein im prägnanten Sinne „geistgeborenes“ Geschöpf nennen – ein immerwährend und unaufhörlich, solange es nämlich überhaupt besteht, aus dem „Geist“ herausgeborenes. {53} P s i l . : Jetzt erst, Montanus, begründen Sie so recht eigentlich den ausgesprochenen Charakter der „Leichtigkeit“, den diese Wesen haben. Ist es nicht eben deshalb, weil sie in ihrer gesamten Gestalt vom Geist aus, wie Sie sagen, seinsmäßig orientiert sind? M o n t . : Und „Geist“ etwas wesenhaft Aktuelles, etwas seiner Natur nach sich gleichsam in ewiger „Schwebe“ haltendes ist. Was „Geist“ ist oder „aus Geist“ ist, kommt nie zu eigentlicher Fixation in sich selbst, nie zu starrer seinsmäßiger Festlegung und damit auch noch nicht zur „Schwere“. Die „Leichtbeschwingtheit“ eines puren geistigen Wesens oder eines nur geistgeborenen Wesens beruht vornehmlich auf dieser unaufhebbaren Aktualität des Seins, durch die es „immer und ewig neu“ aus dem Geist, der ihm Leben gibt, ersteht oder aus dem es immer und ewig neu „geschöpft“ ist. P s i l . : Hängt es nicht hiermit auch zusammen, daß der Elementargeist – seiner eigensten Natur nach, wie es scheint – die äußere Erscheinung beliebig wechseln, umtauschen, sie abwerfen und wieder annehmen kann? M o n t . : Ganz gewiß. Wenn auch natürlich nur innerhalb der Grenzen seiner durch gerade diesen „Geist“ bestimmten Gestaltung. Und was noch fundamentaler ist: daß er überhaupt keinen eigentlichen „Leib von Fleisch und Blut“ hat, sondern eine äußere Gestalt, die ihm dieser sein Geist, durch den er ist und lebt, nur eben, wenn ich so sagen darf, „umgeworfen“ hat. Ich wünschte, Psilander, daß Sie dieses höchst eigentümliche „geistgeborene“ oder auch „ substanzialiter geistige“ Wesen der Elementargeister mit rechter Anschaulichkeit vor Augen hätten. Es läßt sich jetzt weit konkreter die Frage nach dem Menschen wiederholen: ist der Mensch auch ein „geistgeborenes“ Geschöpf in diesem Sinne?

206

Metaphysische Gespräche

{54} P s i l . : Offenbar nicht. Er scheint von irgendwo anders her als solcher „innerlich aufgebaut“. M o n t . : Aber war nicht auch am Menschen der Geist das Wesentliche? P s i l . : Sie sagten vorhin einmal, daß der Mensch mit seinem Geist gleichsam über sich hinaus entfaltet oder erhoben sei. Dieser Ausdruck scheint mir jetzt den Gegensatz zu jener geistgeborenen Artung, in der das betreffende Wesen vom Geist her (von ihm „herab“ gleichsam) lebt und ist, besonders gut zu treffen. M o n t . : Der Mensch hat also innerhalb seiner Seinstotalität eine andre „Basis“ oder Verwurzelungssphäre, von der aus er seinerseits ist und lebt? P s i l . : Scheint er nicht in bestimmtem Sinne „tiefer“ in sich selbst zu wurzeln, Montanus? M o n t . : Auch mir stellt es sich so dar. Und sollten wir jetzt nicht gleich die Behauptung wagen, Psilander, daß der Mensch von seiner „Seele“ aus lebt, in ihr seinsmäßig gewurzelt ist? {55} P s i l . : Es war ja ersichtlich, daß Sie hierauf hinaus wollten. M o n t . : Und doch ist das nur ein ganz vorläufiges und bis jetzt recht oberflächlich gefaßtes Resultat. Die volle Einsicht in die Sachlage soll sich uns erst noch eröffnen. Eine Frage zunächst: wenn wir sagten, der Elementargeist „lebe“ vom Geist aus, so hieß uns das zugleich, daß er von diesem „Geist“ her in seiner inneren Gesamtgestalt durchbestimmt ist – läßt sich nun dasselbe von der Seele in bezug auf den Menschen sagen? P s i l . : Damit käme man ja auf die aristotelisch-scholastische Bestimmung, daß die Seele die bestimmende, ja geradezu die durchbestimmende „Form“ des menschlichen Seins – wie überhaupt jedes lebendigen Seins – darstelle. M o n t . : Aber scheint Ihnen das richtig? Oder vielmehr, scheint es Ihnen auf eben die Seele, die wir hier immerwährend im Auge haben, zuzutreffen? P s i l . : Recht eigentlich nicht. M o n t . : Waren wir uns nicht vorhin darüber einig, daß der Mensch von einer einheitlichen „Wurzel“, – von einer einheitlichen Bildungswurzel her sozusagen – in Leib, Seele und Geist hineinformiert oder hineingestaltet sei? Also auch in die Seele hinein? P s i l . : Die Seele ist hiernach nicht das Bestimmende, sondern das Mitbestimmte. Dagegen scheint das, was Sie Bildungswurzel nennen, der scholastischen „Seele“ eher zu entsprechen. {56} M o n t . : Das wollen wir jetzt nicht untersuchen. Aber Sie sagen richtig, daß die Seele – unsere Seele, die Seele im prägnanten Sinne – nicht das Bestimmende oder Formende, sondern das Mitbestimmte, Mitgeformte, Mitformierte sei. Und man muß festhalten, daß jenes einheitlich durchformierende Moment selber – durch das der Mensch als Mensch wie „aus einem Guß“ erscheint – von dieser mit in die ursprüngliche Seinsformation einbegriffenen Seele wohl zu unterscheiden ist.

Die Seele

207

P s i l . : Das glaube ich zu sehen. M o n t . : Liegt denn hierin nicht überhaupt ein Unterschied zwischen Seele und Geist, Psilander, daß die Seele immer „Mitte“, „Zentrum“ oder „Grund“ von irgendetwas schon Formiertem sein muß, der Geist aber für sich und durch sich allein zu bestehen vermag? Deshalb kann wohl der Geist das von Grund auf Bestimmende und Gestaltende in gewissen Wesen sein, nie aber die Seele. P s i l . : Aber in welchem speziellen Sinne läßt sich denn jetzt noch behaupten, – was sich doch vorhin herauszustellen schien – daß der Mensch im Gegensatz zum geistgeborenen Wesen in einer Seele „verwurzelt“ sei, daß sie den „Grund“ seines Daseins bilde? {57} M o n t . : Sollte man hier nicht das ein für allemal gegebene oder von irgendwoher durchbestimmte und das aktuelle Dasein unterscheiden können. Wenn der Mensch einmal ist und lebt, so lebt und ist er von seiner Seele aus; deshalb braucht sie aber nicht – wie dort der Geist – das die seinsmäßige Totalität schlechthin Gestaltende zu sein. Haben Sie nicht überhaupt den Gesamteindruck, Psilander, daß die totale innere Bildung, der gesamte konstitutive Seinsaufbau eines im Geist fundierten und eines aus der Seele heraus lebenden Wesens eine ganz und gar verschiedene ist – ja noch mehr, daß diese zweierlei Gattungen von Wesen, auf Grund ihrer verschiedenartigen Seinsbildung, der Welt und Umwelt in einem fundamental voneinander abweichenden Sinne gegenüberstehen, beziehungsweise in sie eingeordnet sind? P s i l . : Ich sehe nur immer wieder jenen oberflächlichen Aspekt einer beim Menschen – ich möchte sagen – größeren „Versenktheit“ in sein eigenes Sein gegenüber jener schon erwähnten „Leichtbeschwingtheit“ bei den Geistgeschöpfen. Und wenn Sie mir zwar den Grund der letzteren schon einigermaßen deutlich gemacht haben, Montanus, so sind wir doch auf das Moment der eigentümlichen „Schwere“ beim Menschen noch nicht eingegangen, sondern vom Wege wieder abgebogen. Und gerade dieser Punkt erscheint mir so fundamental. Als müßte man die Sache hieran packen können. {58} M o n t . : Sie haben überaus recht, Psilander. Daß Sie vorhin sagten, der Mensch scheine gleichsam tiefer in sich selbst verwurzelt, und jetzt, er sei in einem besonderen Maße in sich selbst „hineingesenkt“, daß Sie wiederum auf den Charakter der Schwere hinweisen, daß der Mensch ein in bestimmtem Sinne „naturhafteres“ Wesen zu sein scheint, als selbst ein Elementargeist, der doch andrerseits in ganz spezifischer Weise zur Natur gehört: das alles drängt nach einer und derselben Grundeigentümlichkeit im ontischen Aufbau des Menschen – einer Wesenseigentümlichkeit, die wir durchaus zu fassen versuchen müssen. Wir sind aber nicht vom Wege abgekommen, sondern aufs beste vorbereitet. Vor allem eine wichtige Einsicht scheint mir jetzt leicht zu gewinnen: nicht, daß der Mensch als solcher in einem „größeren“ Maße in sich selbst eingesenkt ist, daß er „tiefer“ in

208

Metaphysische Gespräche

seinem eigenen Sein wurzelt, macht eigentlich den Unterschied aus, sondern daß er überhaupt in sich selbst hineingesenkt, überhaupt in sein eigenes Sein gleichsam eingelassen ist. Nicht das Maß der „Selbstverwurzelung“, sondern ihre pure Tatsache ist das Eigentümliche. P s i l . : Sie würden also sagen, daß geistgeborene Wesen überhaupt nicht in diesem Sinne in sich selbst hinein gewurzelt sind? M o n t . : Ich glaube, daß der phänomenale Gegensatz von Schwere hier und Leichtbeschwingtheit dort eben damit zusammenfällt, daß der Mensch – der von ihm unabtrennbaren Seinsanlage nach – in sich selbst „eingelassen“ ist und daß genau dieses Moment in die Idee eines Geistwesens nicht eingeht, nicht eingehen kann. {59} P s i l . : Aber wenn Sie sagten, das geistgeborene Wesen sei vom Geist her substanziiert, er bilde das seinsmäßige Fundament dieses Wesens, so handelt es sich doch auch da um einen persönlich in dasselbe eingegangenen, in ihm persönlich verselbständigten Geist? Steht dieses Geistwesen denn nicht ebenso „für sich“, als selbständig abgelöste Individualeinheit? M o n t . : Ohne Zweifel. Aber jener Gegensatz widerspricht dem nicht. Das fundamentale Moment, daß der Mensch noch in besonderer Weise in sein eigenes Sein hineingesetzt ist, erschöpft sich eben keineswegs mit dem Faktum der personellen Selbständigkeit, sondern fügt ihr einen höchst eigenartigen Charakter hinzu. Und umgekehrt ist das Geistwesen trotz seiner personellen Selbständigkeit durch die ihm konstitutive Seinsanlage oder mit ihr eigentümlich aus sich selbst „herausgestellt“ oder „herausgehoben“. P s i l . : Mir ist noch nicht durchaus klar, worauf Sie abzielen. M o n t . : Führt nicht geistiges Sein notwendig über das eng Personelle hinaus? P s i l . : Weil man eben an der Welt teilnimmt, die der Geist umfaßt? M o n t . : Ungefähr so. Aber Sie dürfen es in unserem Falle nicht in einem allzu „intellektuellen“ Sinne fassen, sondern in einem fundierenden: Wesen, die aus einem bestimmten Geist heraus substanziiert sind, ihn zur„Basis“ und „Wurzel“ ihres gesamten Daseins und ihrer gesamten inneren Gestaltung haben, müssen damit zugleich in der geistigen Welt oder Sphäre unmittelbar leben, die eben die spezifische dieses „Geistes“ ist, müssen ihr unaufhebbar eingeordnet, in ihr gleichsam „aufgehoben“ sein. {60} P s i l . : Auch vom Menschen kann man sagen, daß er in eine bestimmte geistige Welt unmittelbar eingeordnet ist – je nach dem Geist, der in ihm persönlich waltet und aus dem heraus er lebt. Aber wenn ich Sie richtig verstehe, so sehen Sie hier einen prinzipiellen Unterschied. Der Mensch scheint einer solchen geistigen Welt nicht ebenso primär, nicht so unabänderlich innezuwohnen? Sie ist hier nicht wahrhaftes „Seinsfundament“ wie dort, sondern eine Sphäre, in die er nur eben kraft seines Geistes, also sekundär, hineinreicht?

Die Seele

209

M o n t . : Daß die geistige Welt dort „Seinsfundament“ ist, ist ein vorzüglicher Ausdruck. Nur müssen wir uns jetzt hüten, die mögliche Beziehung auch des Menschen zu einer Sphäre, der er sich geistig völlig anheimgibt, allzu äußerlich zu fassen und dadurch den ontischen Gegensatz überhaupt in seiner Reinheit zu trüben. Denken Sie etwa an einen Heiligen, der es erreichte, von seinem peripherischen und äußerlich orientierten Selbst ganz und gar loszukommen und „in Gott“ zu leben: wäre nicht auch er mit seinem gesamten Sein, Tun und Erleben in dem „geistigen Reich“, das „nicht von dieser Welt ist“, aufgehoben, wäre er nicht wahrhaft in ihm fundiert? {61} P s i l . : Es ist allerdings richtig, daß man auch hier in gewissem Sinne von einem Seinsfundament sprechen könnte, da das Leben und Sein eines solchen Heiligen ganz und gar von „dorther“ bestimmt wäre – M o n t . : Da es auch von dort „Kraft“, „Licht“ und „Orientierung“ unmittelbar empfangen würde. P s i l . : Allerdings – und doch – M o n t . : Nun? P s i l . : Ich weiß durchaus nicht, wie ich es fassen soll – als wäre es doch wiederum nicht ein Seinsfundament in eben der primären oder, wie Sie sagen, fundamentalen Weise; als bliebe es doch immer – auch in diesem eigentlichsten Fall – etwas jenem ursprünglichen Verhältnis, das sich bei den echten Geistwesen finden müßte, Sekundäres. Der Heilige würde doch diesen Zustand nur durch Vertiefung oder Verinnerlichung erreichen können. Bei den Geistern aber ist jene Beziehung, ich möchte fast sagen „so wie so“, vorhanden. M o n t . : Sie ist ihnen konstitutiv wie die Schwere dem Stein? P s i l . : Ja. M o n t . : Aber ich möchte Sie jetzt, Psilander, an die religiöse Idee des „ursprünglichen“ Menschen erinnern, des Menschen „vor dem Sündenfall“; dieser wird als noch nicht aus Gott heraus und in das peripherische und äußere Dasein herabgesunken vorgestellt: er war mit seinem gesamten Sein „in Gott“ durchaus noch bewahrt und aufgehoben. Wäre dieses Aufgehobensein nicht ebenfalls ein konstitutives? {62} P s i l . : Ein konstitutives doch nicht, sonst hätte es ja durch den Sündenfall nicht gestört werden können. M o n t . : Aber immerhin doch ein fundamentales, primäres, ursprüngliches, nicht etwa erst durch die persönlich geistige Bemühung dieses ersten Menschen erreichtes? P s i l . : Aber wollen wir uns hier nach einer bestimmt gearteten religionsphilosophischen Anschauung richten? M o n t . : Gewiß nicht, Psilander. Jedoch sollte es nicht etwas für unser Problem besagen, wenn wir die Idee eines in diesem Sinne, wie Franz von Baader so trefflich

210

Metaphysische Gespräche

sagt, noch „integern“ Menschen bilden können, der mit dieser seiner Integrität doch nicht aufhören würde, wahrhaft „Mensch“ zu sein? Oder scheint Ihnen die reine Idee des Menschen dadurch zerstört? P s i l . : Nein – allerdings nicht. M o n t . : Es wäre ja auch seltsam, wenn das, was nach dieser tiefsinnigen Anschauung der Idee des Menschen am eigentlichsten entsprechen soll, faktisch seinem Wesen widerspräche. Wenn es aber seinem Wesen nicht widerspricht, so könnte also auch der Mensch ein in jenem fundamentalen und primären Sinne in ein geistiges Reich eingeordnetes und in ihm aufgehobenes Wesen darstellen. Wie aber steht es nun mit unserem Unterschied, der uns doch so wesentlich erschien? {63} P s i l . : Sie selbst haben den Unterschied aufgestellt, Montanus.Was soll ich tun, wenn Sie ihn durch eigene Einwände zunichte machen? M o n t . : Ich meine, daß der prinzipielle Unterschied zwischen dem möglichen Aufgehobensein des Menschen in Gott oder einem geistigen Reich und dem reellen Aufgehobensein der substanzialiter geistigen oder der geistgeborenen Wesen auch jetzt noch besteht. Ja – der entscheidende Punkt wird nunmehr viel prägnanter zu fassen sein. P s i l . : Sie scheinen mit dem Gegensatz des „möglichen“ und „reellen“ schon etwas andeuten zu wollen? M o n t . : Nicht mehr, als Sie vorhin mit dem Hinweis, daß die Beziehung beim Menschen nicht konstitutiv sein kann, weil sie – jener Anschauung nach – durch den Sündenfall gestört werden konnte. Aber jetzt, Psilander, bringe ich noch einen schwerwiegenden Einwand: gibt es denn nicht ebenfalls die Idee von abgefallenen Engeln? „Aus Gott“ oder dem „göttlichen Reich“ gleichsam herausgefallener Engel? P s i l . : Ich bin kein Religionsphilosoph, Montanus. Sie jagen mich ja förmlich durch Himmel und Hölle. Mir liegt das alles ziemlich fern. {64} M o n t . : Und wenn wir auch keine Religionsphilosophen sind, so ist doch kaum etwas instruktiver, als auf die wesenhaften Beziehungen hinzusehen, die diesen Anschauungen zugrunde liegen. Nirgends sind die wahrhaften Wesensgrenzen reiner erhalten als hier; deshalb kann man so unendlich viel aus ihnen lernen. Wenn es der ursprünglichen, religiösen Vorstellung nach „gefallene Engel“ gibt, so widerspricht dieses Moment auch sicherlich nicht dem Wesen solcher Geschöpfe. Aber wir wollen das keineswegs von vorne herein annehmen, sondern selber zusehen, ob es sich widerspricht – ob das Moment des möglichen „Abfalls“ mit der reinen Anschauung, die wir von ihnen zu gewinnen vermöchten, widerstreitet. Wenn nämlich nicht, dann kann hierin allein auch kein Unterschied zum Wesen des Menschen begründet werden. P s i l . : Die Folge wäre also, daß auch dem puren Geistwesen das „Aufgehobensein“, wie Sie es nennen, in der Sphäre, der er primär zugehört, nicht konstitutiv wäre? Wenigstens dem puren Geistwesen in Gestalt des Engels?

Die Seele

211

M o n t . : Doch – es ist ihm trotz alledem konstitutiv. P s i l . : Dann verstehe ich Sie noch nicht. M o n t . : Der mögliche Abfall hebt eben die Beziehung, um die es sich bei dem primären und seinsmäßigen Eingeordnetsein des Geistwesens in die geistige Sphäre oder Welt handelt, nicht auf, geht sie gar nichts an. Und in dem Augenblick, wo Sie das sehen, werden Sie auch unmittelbar verstehen, dieses (konstitutive) Aufgehobensein von dem beim Menschen möglichen radikal zu unterscheiden. P s i l . : Ich sehe aber noch keineswegs, was man hier überhaupt unterscheiden kann. {65} M o n t . : Aus einem dem eigenen Sein und Wesen konstitutiven Moment kann man nicht herausfallen? P s i l . : Gewiß nicht. M o n t . : Aber ein bewußtes und freies Wesen könnte sich doch dem ihm konstitutiven Sein innerlich widersetzen? P s i l . : Woran denken Sie dabei? M o n t . : Nehmen Sie ein Beispiel aus einer ganz anderen Sphäre, in der es sich nicht um Wesensbeziehungen handelt: zum Beispiel kann es doch zur empirischindividuellen Konstitution eines blind- oder taubgeborenen Menschen gehören, eben blind oder taub zu sein? P s i l . : Gewiß. M o n t . : Ein solcher Mensch könnte sich seiner Taubheit oder Blindheit nicht entäußern oder entledigen? P s i l . : Nein. M o n t . : Aber er könnte doch in beständiger innerer Opposition gegen dieses sein Gebrechen leben, in unaufhörlicher Auflehnung dagegen? P s i l . : Natürlich. M o n t . : Er kann förmlich von dieser Opposition und Widersetzlichkeit leben – so daß ihm der Inhalt seines Lebens, ja die gesamte Basis für die ihm eigentümliche Individualgestalt genommen würde, zu der er sich durch eben dieses Leben herausgebildet hat, wenn er seines Gebrechens los und ledig werden könnte? {66} P s i l . : Etwas Derartiges gibt es. M o n t . : Wenn nun einem Wesen das substanzielle Eingeordnetsein in ein göttliches Reich konstitutiv wäre, dann könnte es sich dieses ihm konstitutiven Seinsmomentes in einem noch ganz anderen, in einem prinzipiellen Sinne nämlich, nicht entledigen? P s i l . : Allerdings. M o n t . : Aber auch ein solches Wesen könnte in Opposition gegen diese seine fundamentale Seinsstellung treten, könnte diese Opposition zur „Quelle“ und „Nahrung“ gleichsam seines gesamten Daseins machen? Es würde sich – als speziell geistgeborenes Wesen – mit der und durch die fortwährende positive Verneinung

212

Metaphysische Gespräche

seiner primären und im Grunde unaufhebbaren Position zu einer ganz besonderen „Gestalt“ oder „Figur“ substanziieren? P s i l . : Hiermit haben Sie den abgefallenen Engel im Auge? {67} M o n t . : Ja – die Idee des bösen Geistes in Person. Ein solcher Geist wäre seiner eigentlichen Stellung und Bestimmung fundamental untreu geworden und insofern „abgefallen“. Aber das Eigentümliche ist, daß er hiermit gegen sein eigenes, ihm primär substanzielles Wesen, gegen die Sphäre, auf der das ihm verliehene Sein wesenhaft basiert, wütet. Dieses Seins kann er sich nicht entäußern und ihm daher nie gelingen, wohin er strebt. Weshalb wiederum Franz von Baader, der diese Verhältnisse mit Meisterhand aufgedeckt und gefaßt hat, von einem „ewig tantalischen“ Bestreben spricht. Aber Sie werden nunmehr deutlich unterscheiden können: der abgefallene Engel wäre in das Reich, dem er ursprünglich zugehört, einerseits natürlich nicht mehr wahrhaft „eingeordnet“ – da der „Geist“ dieses Reiches nicht mehr aktuell und lebendig in ihm waltet, da er selbst diesen Geist nicht mehr positiv bejaht und immer neu in sich „setzt“, andrerseits aber ist er auch jetzt noch von dorther seinsmäßig substanziiert, da er eben ein Geist ist, der nur und allein aus diesem Reich – primär – Gestalt und Figur gewinnt. Mag er sich auch – sekundär – in eine zweite, in eine unabhängige Gestalt hineinzuzwingen versuchen, deren wahrhafte Vollendung doch letztlich nie zustande kommen kann. Man hat also das seinsmäßige oder substanzielle und damit unaufhebbare Aufgehobensein von demjenigen zu unterscheiden, das nur durch eine freie Hingabe, durch eine positive Bejahung des betreffenden Geistes zustande kommt und bewahrt werden kann. Das substanzielle Aufgehobensein fixiert oder konstituiert allererst die primäre „Gestalt“ und die primäre Seinsstellung; das auf positiver Hingabe beruhende aber setzt die fixierte Gestalt und Seinsstellung schon voraus. Wenn wir nun von einem möglichen Aufgehobensein des Menschen in einer solchen Sphäre oder einem solchen Reiche sprechen, so kann das immer nur die zweite Bedeutung haben; mag auch eine solche Hingabe das gesamte Sein des Menschen wahrhaft umgestalten, ihn gleichsam über sich selbst hinauserheben: es bleibt doch immer eine – der konstitutiven Seinsanlage gegenüber – sekundäre Umgestaltung. {68} P s i l . : Ich verstehe jetzt: jenem konstitutiven Eingeordnet- oder Aufgehobensein in ein geistiges Reich, das den Geistwesen zukommt, steht eben das konstitutive In-sich-selbst-hineingesetzt- oder Sich-selbst-überlassensein, wie man vielleicht sagen kann, beim Menschen gegenüber. M o n t . : Sehr richtig. „Das konstitutive Sich-selbst-überlassensein“ sagen Sie – nur lassen Sie uns diesen wichtigen Punkt noch einmal präzisieren: nicht etwa, als ob der Mensch damit zugleich verlassen, als ob er damit notwendig abgeschnitten von jeder höheren Sphäre zu sein brauchte. Wir wissen ja, daß es der Idee des noch „integern“ Menschen entspricht, mit seinem gesamten Sein und Wesen in die Sphäre, aus der er als „Kreatur“ sein Dasein empfing, noch „emporgehoben“ zu sein.

Die Seele

213

Beachten Sie es, Psilander, daß diese beiden Momente sich nicht nur nicht widersprechen, sondern im Gegenteil sich voraussetzen: nur weil der Mensch als solcher in sich selbst oder ins eigene Zentrum hineingesetzt oder -gestellt ist, kann er zugleich wie in sie emporgehoben oder über sich hinausgehoben erscheinen; das Geistwesen ist weniger in sie emporgehoben, als daß es sich vielmehr primär von ihr aus zum Sein entfaltet. Aber was noch wichtiger ist: nur weil der Mensch ins eigene Zentrum gesetzt ist, kann er in dasselbe oder in sich eigentlichst „zurückfallen“; wenn er auch nicht notwendig „abgeschnitten“ oder „verlassen“ zu sein braucht, so macht es doch das ihm konstitutive „In-sich-selbst-gestelltsein“ möglich, daß er im radikalen Sinne in sich versinkt, sich selbst absolut anheimfällt. Ein Geistwesen kann nicht in dieser fundamentalen Weise aus jeglicher es tragenden und basierenden Sphäre heraus und sich selbst anheimfallen. Der Teufel glaubt notwendig an Gott – denn er ist und bleibt mit ihm unablöslich verbunden. {69} P s i l . : Sie haben eben ein Moment berührt, das mir in der rein psychologischen Betrachtung des Menschen – abgesehen von allen möglichen religiösen Beziehungen – schon immer als besonders erwähnenswert aufgefallen ist: diese, wenn ich so sagen kann, immanente Verlassenheit, die den Menschen auf Grund seines eigentlichsten Wesens auszuzeichnen scheint. M o n t . : Sie haben vollständig recht. Nur würde ich es dahin präzisieren, daß dieses Moment der immanenten Verlassenheit zwar vom Wesen des empirischen Menschen unabtrennbar, für die reine Idee des Menschen aber nur insofern äußerst charakteristisch ist, als das seinsmäßige in sich selbst oder in das eigene Zentrum Gestelltsein jene Möglichkeit in sich schließt – nicht aber mit ihr notwendig verbunden, oder gar identisch mit ihr ist. P s i l . : Sollte man nicht – jener Idee des „integern“ Menschen nachgehend – sagen können, daß der Mensch ursprünglichermaßen zwei „Reichen“ oder „Dimensionen“ angehört, von beiden aus ins Dasein geführt und in ihm fixiert worden ist: einerseits von der gleichsam „unteren“ oder naturhaften Sphäre; die ihn zugleich in seinem selbstigen Sein eigentümlich verfestigt, und andrerseits von einer „oberen“ oder geistigen her, die ihn als solche über sich hinaus hebt? {70} M o n t . : Hierin liegt sicher etwas Zutreffendes und anthropologisch außerordentlich Wesentliches. Aber mit unseren rein ontischen Unterschieden, die gewissermaßen noch eine Stufe tiefer liegen, hat es wenig oder gar nichts zu tun; sie werden durch die Bezugnahme auf diese Anschauung eher getrübt als geklärt. Denn im fundamentalen, im ontischen Sinne kann ein jedes Wesen nur von einer Seite her oder von einem „Punkt“ aus in sein selbstiges Dasein wirklich hineingestellt sein. Nur eine einzige Basis kann es geben, die die letzte seines zur Selbstigkeit gelangten Daseins ist. In diesem Sinne „ist“ das Geistwesen „von oben“ oder aus einer geistigen Sphäre her, „ist“ der Mensch „von unten“ oder aus dem eigenen

214

Metaphysische Gespräche

immanenten Zentrum her. Sie werden von selbst diese Fixierung nicht etwa genetisch verstehen. P s i l . : Nein – sondern im Hinblick auf die Art der Stellung solcher Wesen in sich selbst. {71} M o n t . : Sehr richtig. Und das ist zugleich der wichtigste Punkt, Psilander, den Sie durchaus festhalten müssen: daß es sich bei allem diesem eben um letzte Aufbaumomente, daß es sich darum handelt, wie ein Wesen – primär – in das Sein hineingestellt ist, von wo es als von dem ihm konstitutiven Seinsfundament her an demselben teilzunehmen hat. Welche Bestimmung ganz und gar davon unabhängig ist, wo die eigentliche geistige und seelische „Heimat“ des Menschen liegen mag, welchen Geist er nun positiv in sich walten lassen soll und so weiter. Die ontische Grundlage kann er weder „erstreben“ noch „abstreifen“; sie ist. P s i l . : Und Sie meinen nun, daß jenes dem Menschen als solchem konstitutive Seinsmoment, daß er „in das eigene Zentrum hineingestellt oder -gesetzt“ ist, mit dem Besitz der Seele unmittelbar zusammenhängt? M o n t . : Allerdings. Und erst die Einsicht in diesen Zusammenhang wird uns nunmehr die Bedeutung und die Eigentümlichkeit dieses konstitutiven Momentes wahrhaft klar machen. Lassen Sie uns von einem peripherischen Faktor ausgehen, der leicht zu sehen ist. Kann man nicht sagen, daß der Mensch in seiner Seele und mit ihr alles unmittelbarst empfängt, was ihm begegnet und was er erlebt? P s i l . : Dieser Faktor wäre mir wohl zuerst bei einer Betrachtung über das Wesen der Seele aufgefallen. M o n t . : Aber als geistiges Wesen empfängt er doch ebensowohl alles durch und mit seinem Geist? P s i l . : Ja – aber er nimmt es anders mit der Seele und anders mit dem Geist entgegen. {72} M o n t . : Aber wie nun mit der Seele? P s i l . : Das läßt sich allerdings schwer fixieren. M o n t . : Mit dem Geist nimmt oder faßt er nur auf, mit der Seele aber „erlebt“ er es? P s i l . : Ja. M o n t . : Aber was heißt das: er „erlebt“ es? P s i l . : Das müssen Sie schon selbst beantworten, Montanus. M o n t . : Wenn er etwas, was ihm begegnet, nur „geistig“ entgegennimmt, wird er in dasselbe nicht eigentlich persönlich „hineingezogen“, nicht wahr? Er bleibt gleichsam außerhalb desselben stehen? P s i l . : So etwa, ja. M o n t . : Sofern aber seine Seele daran teilnimmt oder er es wahrhaft erlebt, „schlägt“ es gewissermaßen in ihn persönlich „ein“? P s i l . : Ich verstehe.

Die Seele

215

M o n t . : Die Seele scheint also immer dort beteiligt, wo der Mensch mit seinem zentralen Selbst in das Erlebte miteinbezogen oder von ihm betroffen wird. Und weit bedeutungsvoller noch ist die umgekehrte Einsicht: weil und insofern der Mensch in sein eigenes Zentrum hineingesetzt ist, durch das er – in immanent beschlossener Selbstheit – Welt und Leben in sich und durch sich empfangen kann, hat er eine „Seele“. P s i l . : Hiermit wäre ja plötzlich der Ring geschlossen, Montanus – {73} M o n t . : Ungefähr ja. Aber es bleibt für eine gründliche Einsicht noch manches zu tun. P s i l . : Ein Wesen ohne Seele könnte also das Sein nicht in immanent beschlossener Selbstheit, wie Sie sagen, entgegennehmen? M o n t . : Sehr gut. Und so auch nicht aus einem eigensten Bezirk des Selbst heraus der Welt antworten. P s i l . : In Freude und Trauer, in Liebe und Haß? M o n t . : Ja – und in Begeisterung und Abscheu, in Verehrung und Verachtung, Hingabe und Abkehr, Seligkeit und „abgründigem“ Schmerz. P s i l . : Aber nun drängt es mich doch zu fragen: nehmen Sie denn nicht Liebe und Verehrung und Hingabe in die Idee Ihrer englischen Wesen auf? M o n t . : Das ist allerdings eine wesentliche Frage. Selbstverständlich läßt sich von der Idee des Engels Liebe, Demut und Verehrung ebensowenig abtrennen wie von der Idee des Satans Hochmut und Haß. Aber ist es nicht ebenso sichtbar, daß die Liebe der substanziell geistigen Wesen nicht dieselbe sein kann, wie die Liebe der in ein eigenes Zentrum gesetzten, der aus ihrer Seele hervorlebenden Wesen? Diese Liebe der puren Geistwesen, die nicht etwa mit einer „nur intellektuellen“ und damit „kalten“ und „leeren“ Liebe, also dem bloßen Schattenbild der wahren, verwechselt werden darf, in ihrer Eigentümlichkeit zu charakterisieren, müssen wir uns wohl jetzt versagen. Jedenfalls gibt die ontische Grundstellung und -artung einer jeden Kreatur allen ihren Äußerungen, Manifestationen und Erlebnissen ein – in einem fundamentalen Sinne – durchgehend eigentümliches Gepräge. Die naturhafte Liebe und der naturhafte Haß von Elementargeistern wäre selbstverständlich wiederum ein Typus für sich. Aber eines können wir schon jetzt sehen und fixieren, Psilander: der Mensch ist durch seine Seele und mit ihr „höher“, oder Sie können auch ebensowohl sagen „tiefer“, das heißt wurzelhafter, eigenherrlicher gestellt als alle möglichen Geistwesen, aber er ist auch eben hierdurch schwerer belastet. {74} P s i l . : Weil er die Welt und das Sein persönlichst empfangen kann, aber auch muß? M o n t . : Genau so. Oder ontisch gewendet: weil er zentral in sich selbst beschlossen ist und damit „gottähnlich“ wird, weil er nun aber auch in diesem ihm zentral zu eigen gegebenen Selbst oder durch es hindurch persönlichst tragen und ertragen muß, was ihm begegnen mag.

216

Metaphysische Gespräche

P s i l . : Auch jener – „aufgehobene“ Mensch? M o n t . : Auch er. Nur daß hier selbstverständlich ein wesentlicher Unterschied obwaltet. Die Welt fällt in die Seele des empirischen Menschen hinein wie in einen „Grund“ oder „Abgrund“ und bleibt hier gleichsam liegen; je abgeschnittener, je verlassener, je sich selbst überlassener er ist, um so lastender und schwerer. Im „aufgehobenen“ Menschen aber ist, wie die Seele selber, so mit und in ihr alles, was auf sie fällt, aufgehoben, das heißt getragen und wie beschwingt, von eigenem Gewicht entlastet. {75} P s i l . : Auch der Mensch also, oder er in und mit seiner Seele kann „leichtbeschwingt“ sein? M o n t . : Ja – aber nun halten Sie den ontischen, tiefgreifenden Gegensatz wohl fest. Die faktische Leichtbeschwingtheit der substanzialiter geistigen Wesen beruht darauf, daß sie selbst – in dem ihnen konstitutiven Sein und Wesen – „von oben“, das heißt von einem geistigen Reich her sind und bestehen. Auch die Elementargeister basieren in diesem Sinne in einer „geistigen“ Sphäre, die in dem betreffenden Naturbezirk oder Element ihren äußerlichen und sinnlichen „Niederschlag“ hat. Die mögliche Leichtbeschwingtheit aber des menschlichen, mit einer Seele begabten Wesens besteht darin, daß es in und mit dem Zentrum, aus dem es lebt, in die „Höhe“ oder über sich hinausgehoben und so von sich selbst eigentümlich entlastet werden kann. Es ist etwas fundamental anderes, ob etwas konstitutiv leicht und so außer und jenseits aller Schwere ist, oder ob das konstitutiv Schwere durch eine „Gegenkraft“ gleichsam oder einen „Gegenzug“ davor bewahrt bleibt, sich selber und seiner immanenten Belastung und Fixierung anheimzufallen. Wie das Gewicht auf der Wage oder an der es haltenden und hebenden Schnur. {76} P s i l . : Aber das Gewicht bleibt schwer und wird nicht in sich leicht – es erhält nur ein Gegengewicht von außen, so daß es nicht wirklich fällt. Während doch die Seele offenbar selbst und in sich „leicht“ zu werden vermag. M o n t . : Haben Sie noch nicht bemerkt, daß uns hier immerwährend eine Doppeldeutigkeit des Begriffs der Schwere und somit des der Leichtigkeit verfolgt, die die Lösung der ganzen Sache in sich schließt? Wenn der Mensch ein durch und mit seiner Seele konstitutiv „schweres“ Wesen ist, so heißt das nicht, daß er damit auch ein konstitutiv durch diese seine Schwere in sich belastetes Wesen sei. Der Stein ist zugleich immanent belastet und daher kann diese Belastung an ihm nie wahrhaft aufgehoben, sondern nur durch ein Gegengewicht außer Wirksamkeit gesetzt werden. Daß aber der Mensch als solcher in sein eigenes Zentrum gesetzt ist, macht ihn zunächst nur zu einem wahrhaft in sich selbst begründeten und wurzelnden und in diesem Sinne „schweren“, schwergewichtigen, in der eigenen Selbstheit ruhenden und mit ihr beschlossenen. Zur Schwere aber im Sinne der „Last“ wird diese Zentralität und Selbstbegründetheit erst dadurch, daß ein Mensch – abgeschnitten von allem, was ihn aus sich herausheben könnte – in sich selbst

Die Seele

217

hinein und hinabfällt.Von dieser Belastung aber kann er „erlöst“ werden oder kann er sich selbst erlösen; und die Seele „erhält Flügel“, wird leicht in sich, wie Sie sagten, weil sie eben nicht mehr ihrer eigenen Abgründigkeit überlassen ist. {77} P s i l . : Zum Beispiel auch durch die Liebe? M o n t . : Ja, durch alles, was „frei“ macht, wie man sich ausdrückt. Dabei bleibt aber natürlich jene andere „Schwere“, die auf der schlichten und ihm konstitutiven Seinszentralität des Menschen beruht, ganz und gar unangetastet. P s i l . : Ich hätte nicht gedacht, Montanus, daß man aus dem im Anfang von mir ziemlich naiv beigebrachten Gegensatz der Schwere und Leichtigkeit soviel herausziehen kann. M o n t . : Er war auch ganz besonders glücklich und treffend. Aber lassen Sie uns noch die Gegenseite betrachten.Wir sahen vorhin, daß der Mensch die Welt und das Sein mit seiner Seele entgegennimmt und gleichsam „trägt“, nicht wahr? P s i l . : Ja. M o n t . : Auch dieses „Tragen“ wird, denke ich, ebenso doppeldeutig sein wie jene „Schwere“. P s i l . : Das Tragen wird um so mehr eine wahrhafte „Anstrengung“ und „Aufgabe“ sein, um so mehr der Mensch sich faktisch selbst anheimfällt. M o n t . : Andernfalls könnte er sie leicht und beschwingt tragen, sie aufnehmend und emporhebend als ein selbst aufgehobener und emporgehobener – nicht so? P s i l . : Allerdings. {78} M o n t . : Und so wie dort unbeschadet aller möglichen „Leichtbeschwingtheit“ doch die konstitutive „Schwere“ im Sinne der zentralen Selbstbeschlossenheit nicht aufgehoben wurde, so auch jetzt trotz aller möglichen Leichtigkeit oder gar Lust des Tragens nicht das konstitutive Moment des Tragens selbst, sofern eben der Mensch als solcher – seinsmäßig und primär – die Welt durch sich und in sich entgegenzunehmen hat. P s i l . : Der Mensch bleibt der Welt und dem Sein gegenüber stets im Zentrum seiner selbst, kann man etwa so sagen? M o n t . : Vortrefflich. Er bleibt im Zentrum seiner selbst, wie er auch immer sonst gestellt sein mag. Aber er bleibt nicht nur im Zentrum seiner selbst, sondern der Mensch, ein jeder Mensch, ist ein Zentrum oder ein Mittelpunkt, in dem die Welt und das Dasein gleichsam „zusammenschlägt“. P s i l . : Wie man etwa auch sagt: die menschliche Seele sei der „Spiegel der Welt“? M o n t . : Gewiß – nur darf dieser Spiegel nicht in einem allzu „geistigen“ Sinne gesehen und gefaßt werden. Auch der menschliche Geist selbst kann ja ein Spiegel der Welt genannt werden. Die Seele dagegen ist die Stätte des wahrhaft lebendigen Widerspiels der Welt in einem persönlichen Selbst.

218

Metaphysische Gespräche

P s i l . : Also auch des durchaus individuellen Widerspiels? {79} M o n t . : Gewiß. In der Frauenseele schlägt das Leben und Sein anders zusammen als in der Seele des Mannes, in der Seele des Indiers anders als in der des Chinesen oder der des „weißen Mannes“, in der des Kranken anders als in der des Gesunden, in der des Kindes anders als in der des Erwachsenen, in jedem einzelnen Menschen neu und immer neu. P s i l . : Aber wie, Montanus, kommt es zu dieser immer und ewig individuell neuen Gestaltung der Seele? M o n t . : Das ist eine genetische Frage und da stehen wir allsogleich vor einem dunklen Tor. Vielleicht aber würde uns auch diese Frage nicht mehr völlig unergründlich erscheinen, wenn wir noch tiefer das Wesen der Seele zu erfassen und auszuschöpfen vermöchten, als wir es jetzt können. Aber auch jetzt bin ich doch in einem und, wie mir fast scheint, einem wichtigsten Punkt noch durchaus nicht befriedigt, Psilander. P s i l . : Und so werde ich es sicherlich noch weniger sein – wenn Sie erst sagen, in welchem. M o n t . : Sprachen wir nicht einmal im Anfang davon, daß der Mensch aus seiner Seele wie aus einem „jenseitigen Grunde“ seiner selbst hervorlebt? Weshalb sagten wir „jenseitigen“ Grund? Was ist da jenseitig? P s i l . : Ich erinnere mich allerdings, daß mir dieser Ausdruck aus irgend einem Grunde gefiel. Aber weshalb, weiß ich freilich nicht zu sagen. {80} M o n t . : Wie würden Sie etwa, Psilander, einen gleichsam „seelenlosen“ Menschen charakterisieren? P s i l . : Als einen Menschen, der nur durch die „Vernunft“ hindurchlebt, ohne daß die Gefühls- und Affektsphäre mitspricht? M o n t . : Kann nicht auch ein „seelenloser“ Mensch zornig, erfreut, verstimmt, ungeduldig sein? P s i l . : Allerdings, ja. M o n t . : Gibt es hier nicht denselben Unterschied? Gibt es nicht eine seelenlose Freude und eine seelenvolle? P s i l . : Jetzt möchte ich mit einem Bilde sagen, daß die seelenlose Freude keinen so „vollen Klang“ hat wie die seelenvolle. Sie ist „leer“ in sich selbst. Aber das sagt wohl nicht viel. M o n t . : Es sagt schon etwas. Aber ich möchte die letzte Wendung durch ein anderes Bild vervollständigen. Scheint nicht der seelenlose Mensch in sich selbst gleichsam „leer zu laufen“? P s i l . : Wie eine leerlaufende Maschine? M o n t . : Ja – aber legen Sie nicht den Nachdruck auf die Maschine, sondern auf das Leerlaufen selbst. In einem Menschen „ohne Seele“ ist das zentrale Selbst

Die Seele

219

gleichsam nicht mit „angekurbelt“; sein Sein, Tun und Sich-Äußern geht durch dieses zentrale Selbst nicht hindurch, ist mit ihm nicht beschwert. P s i l . : Deshalb läuft alles so glatt ab, nicht wahr? Und ohne jegliche Reibung? Deshalb auch fehlt bei allem der „volle Klang“, den wir bei einem seelenvollen Menschen finden: denn nur wo es ein zentrales „Mitnehmen“ der „Materie“ gibt, kann es auch ein volles Klingen geben. {81} M o n t . : Ganz recht. Nur beachten Sie wieder, daß es neben dem seelenlosen Vernunftmenschen auch den seelenlosen „Affektmenschen“ gibt. Es gibt Menschen, die sozusagen ein bloßes „Affektgetriebe“ darstellen und mit allen ihren „inneren“ Widerständen, Reibungen, Reaktionen und Auslösungen ebenso „leer“ und im tieferen Sinne „unbeschwert“ sind wie die, bei denen alles glatt, weil ohne Hemmung und nur vernunftgemäß vor sich geht. Nicht also der Mangel an Affekten als solchen macht die Seelenlosigkeit aus – sondern daß ein seelenloser Mensch wie nur in die Peripherie seiner selbst versetzt, nur in dieser Peripherie zu leben scheint. P s i l . : Aber steht denn nicht die Gefühls- und Affektregion im engeren Sinne doch irgendwie der Seele näher als eine jede andere Region des sich auswirkenden menschlichen Seins? M o n t . : Doch – Sie haben vollständig recht. Und wenn ich schnell andeuten darf, wie mir das Verhältnis ungefähr vor Augen steht: die Gefühlssphäre erscheint mir wie der„Leib“ gleichsam der Seele oder wie ihr spezielles peripherisches Selbst; ebenso wie am körperlichen Leib jeder äußere Eindruck unmittelbar „gespürt“ wird, so auch an diesem „Leib“ der Seele jeder„innere“ Eindruck; aber es ist, solange sie nicht zentral mitbetroffen wird, ein nur oberflächenhaftes, ein fixiertes Empfinden – eine bloße „Reizung“ und ein Reagieren auf diesen Reiz. Mit dieser Region des spezifisch sensibeln Erlebens und Reagierens beschließt sich eben das Ganze der Seele keineswegs – ja, wir gewinnen mit ihr nur die „Hülle“ der Seele. Und diese Einsicht ist für alle „Seelenlehre“ fundamental wichtig. {82} P s i l . : Sie haben zwar jetzt noch einmal von einer anderen Seite her gezeigt, Montanus, weshalb der Mensch, der von seiner Seele aus lebt, in einem besonderen Sinne zentral an allem beteiligt ist; aber weshalb das zugleich bedeutet, daß er mit ihr „jenseitig“ in sich selber steht, sehe ich noch nicht. M o n t . : Es ist aber von hier aus nicht allzu schwer aufzuweisen. Denn wenn es zwar eine „Spezialität“ des gleichsam seelenlosen Menschen ist, der Peripherie vollständig ausgeliefert zu sein, so scheint es doch andrerseits in der Seinskonstitution des Menschen schlechthin zu liegen, das Zentrum unaufhörlich um des peripherischen Seins und Tuns willen verlassen zu müssen – um überhaupt zu „leben“. Das Sich-Darleben des Menschen, seine Aufnahme der Welt, sein Wirken in ihr, seine Hingabe an diese oder jene Region seines eigenen totalen Seins, an die Region des Erkennens, die unmittelbare Gefühlsregion, die Region der Sinnlichkeit

220

Metaphysische Gespräche

– alles das ist ein Herausgehen und ein Herausgestelltsein aus dem zentralen Selbst. Immer bleibt dabei die Seele notwendig im „Untergrunde“ als die letzte Basis seines selbstigen und in dieser Selbstigkeit sich auswirkenden Seins, von der er nur immer ausgehen, die er aber nie voll in sein sich notwendig peripherisch entfaltendes Dasein mit hinauf- oder hinausnehmen kann. {83} P s i l . : Aber gibt es denn nicht ein vollständiges Aufschließen der Seele und eine vollständige Hingabe derselben in gewissen tiefsten Erlebnissen? Gibt es nicht auch ein unbedingtes und restlos in sie hineingegebenes Ruhen in ihr? Und damit eine letzte „Rettung“ vor allen peripherischen Ansprüchen? M o n t . : Und doch scheint es mir, Psilander, als als wenn auch die im psychologischen Sinne durchaus „restlose“ Hingabe der Seele, ihr absolutes Aufschließen sie aus ihrem letzten und seinsmäßigen, aus ihrem „wurzelhaften“ Verborgensein nicht herausheben könnte. Und als wenn auch ein Ruhen in diesem „abgründigen“ Grunde letztlich nicht möglich sei. Denn in und mit der Seele sind wir mit dem Dasein selbst und als solchem verknüpft, sind mit ihr gleichsam in das Dasein „hineingeschrieben“, und ein solcher letzter Seinsgrund läßt sich – für uns empirische Menschen wenigstens – nicht entsiegeln, nicht ausloten und nicht ausschöpfen. P s i l . : Was deuten Sie mit dem Hinweis an: „für uns empirische Menschen wenigstens“? Ist dieses letzte Entzogensein der Seele doch keine unbedingte Notwendigkeit? {84} M o n t . : Wenn das seinsmäßig ins Peripherische hinausgehende und -gewendete Dasein des Menschen kein von seinem Wesen unabtrennbares Moment wäre, Psilander – ich wage darüber nichts zu sagen –, wenn es möglich wäre, daß der Mensch in ein rein „immanentes“ Dasein eingehen könnte, ohne doch sein persönliches Wesen zu verlieren, so brauchte auch die Seele nicht mehr jenseitiger und verschlossener Grund seiner selbst zu sein, sondern er könnte sie nun wahrhaft und restlos innehaben, könnte in ihr ruhen als der durchleuchteten und aufgeschlossenen Mitte seines in sie zentral hineingestellten und sich in reiner Immanenz bewegenden Daseins. Aber wir wollen uns heute nicht in diese mystischen Möglichkeiten verlieren. Nur beachten Sie die eigentümliche Tatsache, daß jetzt am Ende, da wir doch die Seele ganz anders beim Schopf gepackt zu haben glauben als anfänglich, sie unter unsern Händen zu einem „Mysterium“ geworden ist. Wie seltsam, ja fast erschütternd ist das. Wir scheinen mit ihr so tief im Sein darinzustehen, daß man sich so ohne weiteres gar nicht weiter zu gehen getraut. P s i l . : Das klingt, wie ich Sie kenne, fast so, als seien Sie der Ansicht, man könne ihr von irgendwo anders her noch näherkommen. {85} M o n t . : Gewiß könnte man auf Grund einer wahrhaft umfassenden Ontologie oder Metaphysik ihre Stellung und Bedeutung im allgemeinen Sein und Dasein als solchem noch weit erschöpfender fixieren. Besonders aber, wenn es

Um den Menschen

221

möglich wäre, den fundamentalen Gegensatz des „äußeren“ oder „äußerlichen“ und des „inneren“ oder „immanenten“ Daseins und Seins, der uns immerwährend verfolgte, in seinem eigentümlichen Sinn aufzuklären. Daß er kein psychologischer, sondern ein ontischer, ja metaphysischer ist, brauche ich gewiß nicht mehr zu betonen. Aber wie ihn näher fassen? Doch lassen wir das jetzt. Mit Recht bleibe uns das, was sich innerhalb unserer Seinstotalität als ein „Allerheiligstes“ gleichsam darstellt, in ein letztes Dunkel gehüllt. P s i l . : Sie stellen die Seele sehr hoch, Montanus. Ich habe noch nie solche Ehrfurcht vor meiner eigenen Seele gehabt. M o n t . : Sagen Sie doch lieber, Psilander, ich stellte sie „tief“ – weil mir durch sie der Mensch zu tiefst und zu innerst mit dem Sein als solchem verbunden zu sein scheint.Vergessen Sie nicht: nur der Mensch als Mensch bedarf einer Seele, damit er einerseits ein in sein eigenes Zentrum hineingesetztes und darin beschlossenes Wesen sein kann; ein „kleiner Gott“ gleichsam, ein kreatürlicher Gott: Gott selbst aber ist „Geist“. Doch lassen Sie uns unser Gespräch beendigen, lieber Freund. Ich glaube, es ist bereits nach Mitternacht. P s i l . : Nur eines noch, Montanus. Wie steht es mit der Tierseele? Was wir besprachen, paßt eigentlich nicht auf sie. Und doch haben die höheren Tiere eine Seele. {86} M o n t . : Ich glaube, es ist nicht so schwer, von der Basis aus, die wir jetzt gewonnen haben, das Menschliche von unsrer Seele abzustreifen und das Tierische hineinzusetzen. Aber hören Sie auf, Psilander. Sie bringen mich allen Ernstes dazu, noch einmal anzufangen. P s i l . : Nein, das will ich nicht. Die Seele des Menschen und was Sie mir mit ihr aufgeladen haben, ist mir erst einmal genug. Leben Sie recht wohl.

Um den Menschen. 1. Vom Tier und der Quall. {87} M o n t a n u s : Mensch und Tier, Psilander – was vermöchten wir wohl leichter in seinem entscheidenden Wesen zu erfassen? P s i l a n d e r : Den Menschen kennen wir von innen her, das Tier nur durch einfühlendes Nacherleben; aber das Tier ist weniger kompliziert und geheimnisreich. M o n t . : Es ist seltsam, mein Freund – aber ich versichere Sie: die Tatsache, daß wir uns selbst von innen her kennen, trägt viel weniger dazu bei, die fundamentale Seinsstruktur unseres Wesens aufzudecken, als man gewöhnlich annimmt.

222

Metaphysische Gespräche

P s i l . : Weil es dem sich rückwendenden Blick schwer gelingt, das unmittelbare Leben zu ergreifen? M o n t . : Weil wir mit dieser reflexiven Blickwendung nur die kleine Helle erschauen, zu der wir in uns selbst erlebnismäßig aufgebrochen sind, nicht aber die Totalität des menschlichen Seins, in der wir aufgebaut dastehen. {88} P s i l . : Und wenn wirklich hellseherische Fähigkeiten die in uns schlummern sollen, das Bereich des direkt Erschaubaren ungeahnt erweitern könnten? M o n t . : So wäre wahrlich das materiale Wissen um unser Sein merkwürdig bereichert, aber der entscheidenden Form der spezifisch menschlichen Wesenheit würden wir auf diesem Wege nicht begegnen. P s i l . : Auf welchem Wege? M o n t . : Auf dem der empirischen Kenntnisnahme. Was aber kann das Hellsehen mehr bieten als eine grandios erweiterte Empirie? P s i l . : Die noch eine Fülle theoretischer Interpretationsmöglichkeiten offen ließe? M o n t . : Ja, auch das – auch das. Doch suchen wir ebenfalls d i r e k t Erschaubares, nur eben von ganz anderer Artung und also in ganz anderer Blickrichtung zu Erfassendes. P s i l . : Sie sprachen von Form, von Materie – M o n t . : Der Mensch birgt ein Mehr von faktischen Dimensionen in sich als ein Tier, das ist gewiß. Aber wir fragen hiernach nicht – oder doch nur als nach einem Faktum; dessen Möglichkeit oder auch Notwendigkeit in dem entscheidenden formalen Seinsaufbau des Menschen begründet sein muß. P s i l . : Beginnen Sie, Montanus, beginnen Sie. Ich kenne doch nun Ihre Fragestellung. Immer aufs neue aber wird es mir schwer, diese Wendung selbständig zu vollziehen. {89} M o n t . : Wie ist es denn nun mit dem Menschen und dem Tier? Wird es uns leichter sein, hier oder dort anzufassen? P s i l . : Ich habe jetzt wohl verstanden, daß die Möglichkeit der Reflexion wenig zur Sache tun kann. Man muß ja doch auch den Menschen in seiner Ganzheit herausgehoben vor sich haben, vor dem geistigen Blick. M o n t . : Trefflich. P s i l . : Das Tier hat zudem gewiß einen einfacheren Aufbau als der Mensch. M o n t . : Einfacheren gewiß. Der Mensch steht im Zentrum allen Seins. Könnten wir ihn restlos begreifen, so gäbe es wohl nicht mehr viel Hüllen vor unseren Augen. Und das Tier versinkt. Aber mit dem Tier ist es doch für uns, in unserer Blindheit, ein eigentümliches Ding. Da ist noch reine Natur, fremde unverstehbare Gewalten, denen es noch völlig anheimgegeben ist. Das Sein selbst schlägt uns über dem Kopf zusammen. Wir haben keine Distanz und keinen Maßstab mehr.

Um den Menschen

223

P s i l . : Der Mensch aber bleibt außerhalb dieser dunkelsten Dimensionen? Gewiß nicht. M o n t . : Gewiß nicht. Aber er taucht aus dieser Naturbasis prinzipiell hervor und eben hier können wir ihn – formal wenigstens – packen. P s i l . : Er beherrscht diese ganze Sphäre bloßer Triebhaftigkeit mit Selbstbewußtsein und freiem Willen? {90} M o n t . : Das ist nun allerdings eine großmächtige Weisheit, die wir da fixieren. P s i l . : Ja, es klingt reichlich nach banalster Popularphilosophie. Aber bleibt nicht eben doch hier der entscheidende Punkt? M o n t . : Selbstbewußtsein – freier Wille–Beherrschbarkeit der Triebe; gewiß, gewiß! Aber wenn wir über allervagste Bestimmungen hinauskommen wollen, dürfen wir niemals hiermit beginnen, wenn vielleicht auch aufhören. Denken Sie an den Blick eines Hundes. Zuweilen scheint es uns, als ob das Tier, das uns so ansieht, dicht, ganz dicht vor dem Durchbruch stünde, der es zu unseresgleichen machen würde. Daß aber dieser Durchbruch dennoch fundamental unmöglich erscheint, schiebt Welten zwischen es und uns. Wollen wir uns diesem quälenden Phänomen gegenüber mit dem Gedanken beruhigen: ja, der Hund hat nun einmal wie alle Tiere kein Selbstbewußtsein? Wo liegt der Grund, der konstitutive Grund für diese eigentümliche Grenze? Weshalb ist dieser kleine Schritt, diese kleine Biegung des Blicks auf sich selbst zurück so radikal unmöglich? Wenn der Unterschied in einem nur gerade zufällig vorhandenen Vermögen läge, weshalb sollte es nicht fließende Grenzen, nicht ein klein wenig mehr oder weniger geben? P s i l . : Die Grenze ist absolut? {91} M o n t . : Ja, aber der Differenzpunkt liegt in der Tiefe, nicht an der Oberfläche. Ich pflege mir vorzustellen, daß die fabelhaften Elberfelder Pferde eines Tages „ihren Hut vom Nagel nehmen“ und ihrem Besitzer durch Klopfen bedeuten, daß es nun genug sei mit dem Unterricht und sie ihr Leben jetzt auf eigene Faust führen werden. Sie lachen? Aber Sie fühlen gewiß auch das Entscheidende in dieser grotesken Vorstellung. Dann, ja dann wäre der Bann gebrochen. Vorher kann kein wie immer geartetes Rechenkunststück die absolute Distanz zwischen ihnen und uns auch nur um die kleinste Strecke verringern. Gewiß, es gibt auch menschliche Sklaven, für die ein solcher Akt von Freiheit faktisch außer dem Bereich ihrer inneren Lebensmöglichkeit läge – prinzipiell ist er immer möglich. Sie brauchten sich nur selbst zu finden. Die Pferde aber können sich nicht selbst finden. Woran aber hängt dieses Können und Nichtkönnen? Woran liegt es, daß das Tier unabänderlich hinter dieser Grenze festgelegt ist? P s i l . : Ich verstehe. Aber wie an dieses „Warum“ heranzukommen ist, ich weiß es nicht.

224

Metaphysische Gespräche

M o n t . : Es handelt sich nicht um Sprünge ins Ungewisse, nicht um die Notwendigkeit kühner Kombinationen oder Schlüsse. Wir brauchen nur den Punkt selber, an dem das Hier und Dort sich anschaulich wesenhaft scheidet, in klarer Intuition zu fassen. – Wir sagten, daß der Mensch aus der Sphäre der Natur hervortaucht, das Tier aber in sie eingesenkt bleibt? {92} P s i l . : Ja. M o n t . : Aber was am Menschen begreifen wir mit diesem ungefähren Wort „Sphäre der Natur“? Und sollen wir sagen, daß dem Menschen dieselbe allgemeine Lebensbasis gegeben ist wie dem Tier, nur daß der Mensch ihr gegenüber eigentümlich frei ist? P s i l . : So daß also im Menschen zwar nicht ein vollkommenes Tier, aber doch eine rein animalische Basis stecken würde, so meinen Sie? M o n t . : Und der Mensch als Mensch erst dort einsetzte, wo er innerlich gleichsam sein Haupt erhebt – eine wahre Sphinx, ein wunderlich zwiespältiges Wesen! Sind wir vom Grund unseres Seins her schon zu Menschen aufgerichtet, oder ist nur das Haupt unseres innerlichen Seins ein menschliches? P s i l . : Ich vermute, was Sie darüber denken, der Sie stets noch gesagt haben, der Mensch sei wie aus einem Guß. Und oft an die scholastische Lehre von der einen einzigen Form, die das ganze Wesen durchbestimme, erinnerten. Aber hier gibt es doch etwas Eigentümliches. Ich weiß nicht, ob die scholastische Anschauung dem ganz gerecht werden kann. Man spricht von dem Kampf zwischen Tier und Mensch im Menschen, und gewiß, man kann das nicht wörtlich auffassen. Aber sollte sich das Ganze mit dem rationalen Hinweis erledigen lassen, daß die sinnliche Sphäre der vernünftigen nicht entsprechend unter- und eingeordnet sei – {93} M o n t . : O Psilander, wenn Sie beginnen, Gefühl für Irrationalitäten zu bekommen, so machen Sie mir wahrhaft Freude. P s i l . : Ich wagte mich vielleicht etwas zu weit vor. Aber zuweilen habe ich wirklich das Gefühl einer konstitutiven Doppelschlächtigkeit unseres Wesens. M o n t . : Und als ob schon das bloße Vorhandensein dieser spezifisch animalischen Sphäre an uns ein, sagen wir einmal, metaphysischer Makel ist? P s i l . : Vielleicht. Obzwar – M o n t . : Hier ist ein Urgegensatz, an dem sich mystische Weisheit von scholastischer, platonische von aristotelischer trennt. P s i l . : Und wir? Was sollen wir sagen? M o n t . : Wie sollten wir hierzu etwas sagen wollen, die wir an einem kleinen Punkt anfangen, uns etwas Klarheit zu verschaffen. Immerhin – ich glaube, daß die Scholastik der generellen Art nach, wie sie die Dinge sieht, nicht an die tiefste Stelle reicht. P s i l . : Und das durchgehend einheitliche Sein des Menschen?

Um den Menschen

225

M o n t . : Wenn man tief genug stünde, würde man den synthetischen Punkt finden. Doch lassen Sie uns jetzt wieder an die Sache selbst anknüpfen. Eines ist jedenfalls wohl sichtbar: daß der Mensch, wenn wir ihn in seiner formalen Totalität, sagen wir, um diesen wesentlichen Begriff nunmehr heranzuziehen, in seiner P e r s o n h a f t i g k e i t betrachten, daß er dann etwas dem Tier gegenüber vom Grunde seines Seins her aufgerichtetes hat. {94} P s i l . : Das Wort Person führt allerdings eine solche Anschauung unmittelbar herauf. M o n t . : Wie aber sollen wir diese innere Aufrichtung näher fassen? Und wie hängt sie mit jener anderen zusammen, daß der Mensch sich innerlich über seine eigene Naturbasis erhebt? P s i l . : Oder besser vielleicht, daß ihm diese seine Natur eben zur Basis wird, während sie für das Tier – M o n t . : Finden wir jetzt den richtigen Ausdruck. P s i l . : Es bleibt in ihr stecken. Es bleibt in sie eingehüllt oder wie soll ich sagen. M o n t . : Der Mensch aber streift diese Hülle in sich selber ab und ist also wesentlich in sich selbst – nackt. Nehmen Sie jene Aufrichtung hinzu und wir haben vorläufig zwei wesentliche Phänomene. P s i l . : Jetzt fällt mir ein, verzeihen Sie, wie die Tiere der Wildnis bei Kipling den Menschen definieren: er ist nackt und geht auf den Hinterbeinen. M o n t . : O bitte, das ist trefflich. Ist nicht äußerer Habitus bedeutsamstes Symbol innerer Konstitution? Daß der Mensch nicht aussieht wie ein Bär oder wie ein Papagei, daß er nicht auf vier Beinen läuft und weder ein Fell noch einen bunten Federflaum trägt, wollen Sie es als Zufall ansehen? P s i l . : Aber daß es eine innere Nacktheit gibt, ist mir freilich noch nie eingefallen. {95} M o n t . : Ich wüßte kein besseres Bild. Das Tier dagegen bleibt in seine Natur eingekleidet – was begreifen Sie nun eigentlich unter dieser Natur, von der wir hier reden? P s i l . : Alles, was sich im Tier unmittelbar auswirkt, und worin und woraus es lebt – so ungefähr? M o n t . : Nicht aber, als ob das Tier etwa nur passives Werkzeug gewisser Naturkräfte wäre, die sich seiner bedienen oder die an ihm gesetzt sind? In d i e s e m Sinne ist es der Natur nicht einfach ausgeliefert? P s i l . : In unseren Gesprächen über Pflanze und Tier faßten wir den Unterschied dahin, daß das Tier schon Besitzer seines Leibes ist und also wahrhafter Träger von Aktionen sein kann. M o n t . : Mögen diese auch wie immer unfreiwillig, mögen sie mit reaktiver Notwendigkeit hervorgerufen werden? P s i l . : Wir sahen es.

226

Metaphysische Gespräche

M o n t . : Wir nannten einmal die Pflanze das Gestaltswesen katexochen; sollten wir nicht vom Tier als dem Aktionswesen katexochen sprechen? P s i l . : Im Unterschied nicht nur zur Pflanze, sondern auch zum Menschen? M o n t . : Eben das meine ich. Wird nicht im Tier alles das, was naturhaft in ihm treibt und lebt, unmittelbar in Tat umgesetzt? In Tat umgesetzt, also höchsteigen realisiert – aber eben unmittelbar realisiert, mit triebhafter Notwendigkeit in die entsprechende äußere Aktion verwandelt? {96} P s i l . : Das erste soll das Tier von der Pflanze, das zweite vom Menschen abgrenzen? M o n t . : Ja – aber nun kommt es uns auf eine Vertiefung dieses zweiten Momentes, dieser zweiten Grenze an. Im Tiere wie im Menschen lebt eine Art urhafter Spontaneität – oder scheint es Ihnen, daß man etwas gegen diese Ausdrucksweise einwenden müßte? P s i l . : Spontaneität? Bei der Unfreiwilligkeit des Agierens im Tiere? Gerade das spontane Handeln würde ich dem Menschen zuweisen. M o n t . : Freiwillig ist nicht spontan. Wenn der Mensch bewußt handelt, so handelt er nicht mehr spontan, weil er eine Grenze setzt zwischen sich und das Handeln.Weil er dem, was aus ihm – spontan! – herausbrechen möchte, erst einmal Halt gebietet, ehe er es – eventuell auch nicht – in Tat umsetzt. Spontan ist das, was aus letzter naturhafter Quelle, also von innen her, stammt – P s i l . : Ich fühle, was Sie meinen mögen. Dieses „von innen“ ist ein anderes als das gewöhnlich verstandene, als das „psychologische“? M o n t . : Aus dem sich die gesamte Totalität des betreffenden Wesens in ihrem Sich-Darleben letztlich schöpft – sollen wir so sagen? P s i l . : Obzwar hiermit wohl noch einige Unklarheiten – {97} M o n t . : O Psilander, nicht nur einige Unklarheiten. Hier ist der dunkelste Punkt, an dem doch die ganze Natur hängt, wenn wir sie überhaupt als Natur begreifen wollen. Wir werden immer von neuem daran rühren müssen. Jetzt aber sollen Sie nur sehen, daß dem unmittelbaren Agieren aus diesem treibenden ,,Grunde“ heraus, der unverstehbaren Spontaneität – und gerade in der Unverstehbarkeit ist ihr entscheidendes Charakteristikum in sich selbst gegeben – die Unfreiheit des Agierens keineswegs widerspricht. P s i l . : Daß im Gegenteil beides einander fordert und voraussetzt – M o n t . : Sehr wahr. Und nur wegen dieser Unfreiheit das Urhafte des SichDarlebens diese brutale und unter Umständen dämonische Form annehmen kann. Ja, sollte man nicht das Dämonische überhaupt an diesem Punkte orientieren und fassen müssen? P s i l . : Aber es gibt auch dämonische Menschen – gibt Triebmenschen – Wilde – M o n t . : Und Sie fragen dann nach der absoluten Grenze? P s i l . : Ja – hier scheint sie jedenfalls nicht zu liegen.

Um den Menschen

227

{98} M o n t . : Und doch gerade hier. Denn nicht darauf kommt es an – wir sahen es schon vorhin –, daß der Mensch ebenfalls nur spontan, ebenfalls nur von blinder Aktion zu blinder Aktion leben könnte wie das Tier, sondern darauf, daß er es auch nicht kann! Während des Tieres lebendiges Wesen sich in dieser Form konstitutiv erschöpft. Auch den wildesten Menschen fühlen wir anders als ein Tier, weil in ihm die prinzipielle Möglichkeit jener Distanz zwischen sich und seinem Handeln besteht – und das, w e i l er ein in sich aufgerichtetes Wesen ist. Diesem Zusammenhang eben wollen wir weiter nachspüren. Übrigens, da Sie einmal an das Dschungelbuch erinnerten: nichts ist natürlich lächerlicher als – wie zuweilen geschieht – im Leben des kleinen Mogli die Entwicklung der Menschheit aus dem Tiere heraus, in ein einziges Leben zusammengedrängt, dargestellt zu sehen. Denn das Geniale ist eben, daß dieser kleine Wilde trotz seines äußerlich und innerlich den Tieren aufs Vollkommenste angepaßten Lebens Mensch ist und bleibt, von der ersten Sekunde seines erwachenden Daseins an. Durch eben jenes eigentümliche Etwas, dem wir nachgehen. Die wesenhafte Faktizität seines Menschentums steht formal hinter jedem Wort und jedem Tun, mag er sich wann immer erst zum Bewußtsein und zur lebendigen Auswirkung seines Menschentums durchringen. P s i l . : Aber eines noch. Kommt über der ungehemmten und unmittelbaren Spontaneität, die Sie so sehr betonen, nicht die gewiß wesentliche Tatsache zu kurz, daß das Leben gerade des wilden Tieres in so eigentümlich festgelegten Bahnen verläuft. Es erscheint ja wie förmlich eingesponnen in vorbestimmte Daseinsabläufe. {99} M o n t . : „Ein Storch unter dem Himmel weiß seine Zeit, eine Turteltaube, Kranich und Schwalbe merken ihre Zeit; aber mein Volk will das Recht des Herrn nicht wissen.“ Nur der Mensch kann in seiner Freiheit der furchtbar Disziplinlose sein – und je weiter er vom Wilden abrückt, um so mehr. Das ist selbstverständlich. Aber wo liegt hier ein Widerspruch? Wenn die Abfolge der Aktionen, die ungehemmt aus dem Tier herausbrechen, nicht von vornherein sinnvolle Bestimmtheit, Maß und Ziel in sich trügen, wie sollte das Tier bestehen, wie aus einem chaotisch sich selbst verzehrenden Taumel zu lebensfähigem Dasein gelangen? Ist nicht gerade die jeweilige Art des Tieres gekennzeichnet durch eine sich in ihm auswirkende Lebenstriebkraft ganz bestimmter Gestalt, die in seinem Leibe symbolisiert ist und seinen Aktionen Richtung, Qualität, Maß und Tempo verleiht? Aus ihr heraus sind dem Tiere die Gesetze ins Blut geschrieben. Sie liegen und wirken hinter ihm, nicht vor ihm – wie beim Menschen. P s i l . : Hier Vorstellungen – Motive? M o n t . : Ja. Wie sollten sie dort also das spontan sich auswirkende Leben der Tiere hemmen, da sie zu diesem Leben selbst gehören, ihm gestaltsmäßig aufgeprägt sind?

228

Metaphysische Gespräche

P s i l . : Sie sprechen fast, als wenn sich das Leben des Tieres rein aus sich selber schöpfte und durch sich selber bestimmte. Ist es denn nicht ein vornehmlich reaktives? {100} M o n t . : Weil dieser oder jener bestimmte Trieb, diese oder jene konkrete Begierde notwendig durch gewisse äußere Bedingungen, Anreize, sinnliche Eindrücke ausgelöst wird? P s i l . : Ja. M o n t . : Jetzt drehen wir uns im Kreise, Freund. Wollen Sie dem Tiere noch einmal die Spontaneität, die U r w ü c h s i g k e i t seines Agierens um der Unfreiheit willen abschneiden? Was nennen Sie Reaktion? P s i l . : Daß ein bestimmter Trieb, eine bestimmte Begierde notwendig durch gewisse äußere Bedingungen, Anreize, sinnliche Eindrücke ausgelöst wird –. M o n t . : Daß also das Tier auf diesen Reiz mit einer ganz bestimmten Aktion antwortet? P s i l . : Antworten muß. M o n t . : Oder naturhaft antwortet? Darin liegt wohl das „Muß“ eingeschlossen? P s i l . : Ja, so kann man sagen. M o n t . : Was antwortet denn nun im Tier? Oder wie kann etwas antworten, wenn nicht eine primär im Tiere wirksame Lebenstendenz bestimmter Art durch diesen Reiz eben aufgereizt wird und sich a n der konkreten Situation konkret und faktisch auswirkt? Was läßt jene Urwüchsigkeit besser heraustreten, als diese notwendig naturhaften, notwendig reaktiven Antworten? {101} P s i l . : Sie haben recht. Ich sah vorhin schon, wie sehr beides einander bedingt. Aber jetzt beschäftigt mich doch, was Sie immer wieder „primäre Lebenstriebkraft“ und ähnlich nennen. Gibt es so etwas auch bei der Pflanze? Liegt es nicht beim niederen Tier etwas anders als bei höheren? Vorhin hatte ich einen Moment so stark das Gefühl dessen, worauf Sie wohl den Finger legen wollen. Wolf und Adler, Schlange und Krokodil – mir war, als würde ich mit jedem neuen Tier in immer neuer ursprünglicher Weise ins Leben oder Dasein hineingeschleudert. M o n t . : O das ist gut. Ein letztlich immer anders qualifizierter Daseinsmodus scheint mit jeder Tierspezies leibhaft geworden, a u s dem sich die allerletzte und nicht mehr in Worten präzisierbare, die intime Differenz der Tierarten schöpft. P s i l . : Sollte man nicht bei den Pflanzen Ähnliches sagen? Pflanzen sind die Gestaltswesen katexochen, sagten Sie, und Tiere die Aktionswesen katexochen. Was sich dort in immer neuem Sinne rein gestaltsmäßig auswirkt, ist hier in Wesen verleiblicht, die es durch entsprechende Aktionen selbst lebendig darleben. Ich denke, so könnte man jetzt sagen. M o n t . : Trefflich. Jakob Böhme spricht von der „Quall“, die sich in jedem Ding spezifisch anders auswirkt, oder in der dieses Ding, Tier, Mensch oder Pflanze „urständet“. Das ist ein vorzüglicher Ausdruck. Denn es ist in ihm das Quellende

Um den Menschen

229

und primär Treibende mit dem Qualifizierenden eigentümlich verbunden. Sie haben nun selbst auf Ihre Frage nach den Pflanzen geantwortet. Aber Sie schienen gewisse Bedenken bei den niederen Tieren zu haben? {102} P s i l . : Ja, es streifte mich vorhin, daß es wohl leicht sei, „Schlange und Bär, Walfisch und Krokodil“ so von Grund auf verschieden zu erleben – aber bei den niederen Tierarten möchte es nicht ebenso gelingen? M o n t . : Sie denken an Schnecke und Seestern, Polyp und Qualle? P s i l . : Ja etwa. M o n t . : Und bei der Pflanze schien es Ihnen wiederum verständlich? Verständlich nämlich, bei den verschiedenen Spezies von einer jeweilig einzigartig charakterisierten Quall zu sprechen? P s i l . : Ja. Aber ich sehe jetzt auch, daß es nicht die Frage war, ob auch die niederen Tiere aus einer bestimmten Quall heraus qualifiziert und gestaltet sind, die mich beschäftigte – weshalb sollte hier an sich eine größere Schwierigkeit bestehen als bei der Pflanze –, sondern ob die niederen Tiere auch ebenso als Aktionswesen in Ihrem Sinne aufzufassen sind wie die höheren? M o n t . : Wenn Sie das im Auge haben, was wir „Dämonie“ der höheren Tiere nennen können, jenes Hervorbrechen der Aktionen aus einer eigenen seelischen Mitte, in der das Tier unmittelbar lebt: dann haben Sie recht –. P s i l . : Jetzt haben Sie zum erstenmal wieder die Seele berührt – worauf ich doch mit Begierde warte. {103} M o n t . : Aber nicht, um jetzt schon bei ihr zu bleiben. Wir werden noch einen weiten Weg zurücklegen müssen. Gerade diesen Unterschied zwischen höheren und niederen Tieren werden wir erst dann ganz verstehen. Aber der allererste primitivste Differenzpunkt zwischen Pflanze und Tier liegt ja doch, wie wir wissen, dort, wo das lebendig organisierte Wesen beginnt, von sich selber her Aktionen zu vollziehen – seien es auch nur völlig vage Körperreaktionen. Allerdings – das Tier ist auf diesen Stufen noch eingefangen in seine Leibesmasse, noch wie verteilt an sie, obzwar ein Aktionszentrum ja bestehen muß. P s i l . : Aber dieses Zentrum ist noch nicht zu jener selbständigen seelischen Mitte geworden, von der Sie eben sprachen. Habe ich recht verstanden? M o n t . : Noch nicht zu dieser seelischen Mitte hinein- und zurückvertieft – ja, so können wir sagen. Ohne aber mit dieser Wendung genetische oder Entwicklungsgesichtspunkte verbinden zu wollen. P s i l . : Ich verstehe. Noch wie eingefangen in die Leibesmasse, sagen Sie – daher bleiben alle Aktionen so eigentümlich peripher? M o n t . : Gewiß. P s i l . : Aber die Insekten?

230

Metaphysische Gespräche

M o n t . : Sie fragen mit Recht. Das ist ein höchst sonderbares Kapitel. Hier liegt es ja förmlich umgekehrt. Hier scheint die ganze Leibesdimension geradezu „aufgezehrt“ zu sein. {104} P s i l . : In einem, gewissen Sinne paßt der Ausdruck „Aktionswesen katexochen“ besonders gut auf die Insekten. Wenn zwar wiederum ganz anders als bei den höheren Tieren. Hier kann man von einer seelischen Mitte wohl ebenfalls kaum reden? Wenigstens ist mir ihr ununterbrochenes Tun und Treiben, so kunstvoll es ist, immer absolut „seelenlos“ erschienen. M o n t . : Man möchte sagen, ihr fanatisches Tun und Treiben, um damit die vollkommene Blindheit, in der es geschieht und zugleich den unabwerfbaren Bann, unter dem sie stehen und der sie treibt, anzudeuten. Wenn nicht auch dieser Ausdruck schon zuviel „Seele“ voraussetzte. Sie erscheinen ja nur mehr noch als Durchgangsstationen für faktische und mögliche Aktionen. Es kommt zu keiner wahrhaften substanziellen Gestaltung mehr bei ihnen – weder nach außen noch nach innen. Dieser skelettartige Leib, der von einer das Tier umhüllenden und ihm als Wohnstatt dienenden Leibesdimension schon fast nichts mehr an sich hat; und ebenso keine eigentliche innere Sphäre, in der das Tier an sich selbst heimisch wäre. Sondern ein bloßes Umsetzen des gesetzmäßig in ihm treibenden Lebens in die entsprechende äußere Aktion – ein leeres Umsetzen, das weder Leibhaftigkeit noch Lebhaftigkeit am Tier und im Tier gewinnt. Daher das merkwürdig Fratzenhafte und Groteske in ihrem Leben. Wegen dieser Fundament- und Blutlosigkeit ihres inneren und äußeren Seins. Dem Maskenartigen ihres bloßen Skelettleibes entspricht die Hohlheit ihres dem Phänomen nach meist so wüsten Treibens. {105} P s i l . : Die Insekten kommen schlecht fort bei Ihnen. M o n t . : Schlecht? O sie sind im höchsten Grade interessant, diese fanatischen kleinen Völker. Diese naturfanatischen, wenn ich so sagen darf. Nie habe ich es verstehen können, wie man hier nach so etwas wie freier Bewußtheit des Tuns überhaupt hat suchen können. Man muß die klassischen Darstellungen von Jules Fabre lesen. P s i l . : Und jetzt, Montanus? Wie kommen wir weiter? Wie gelangen wir zum Menschen? M o n t . : Ah, Sie haben das Ziel im Auge. Nur Geduld, mein Freund. Ich vermute, wir müssen noch einige Wege gehen, um auch nur allererste Tore sich öffnen zu sehen. Kehren wir zur„Quall“ zurück – es ist das alles noch dunkel genug. Doch eine Schwierigkeit gibt es, die gleich hervorgehoben werden muß. Was ist es mit ihrer Einzigartigkeit bei jeder typischen Tier- und Pflanzenart? Wenn wir Löwe und Kängeruh, wenn wir Adler und Eule und Gans nebeneinanderstellen, so meinen wir es ja, wie Sie richtig sagten, förmlich zu spüren. Aber nicht immer geht es so ohne weiteres – und auch hier: was macht die Differenz aus, an ihrer letzten Wurzel,

Um den Menschen

231

wenn wir von aller Ausgestaltung, von aller faktischen Substanziierung, die ja nur Symbol und Konsequenz ist, absehen? {106} P s i l . : Vorhin glaubte ich Sie so zu verstehen, daß es sich hier eben um letzte Qualitätsdifferenzen handelt, die man prinzipiell nicht mehr rational fassen kann. M o n t . : Es mag sein – und dennoch: es gibt Punkte, nach denen man fragen muß und an die man sich vielleicht ein wenig herantasten kann. Wie weit soll man von einer letzten Einzigartigkeit der substanziierenden Quall sprechen? Bei welcher Verwandtschaftsnähe tritt an ihre Stelle eine bloß immanente Differenzierung einer und derselben einzigartigen? Etwa bei Wolf und Hyäne, Biene und Ameise? P s i l . : Die alte Frage also nach der sachlichen Begründungsmöglichkeit der Ordnungen, Gattungen, Arten und so weiter. M o n t . : Die alte Frage. Aber uns soll es jetzt nicht auf feste Bestimmungen und systematische Fixierungen ankommen, sondern nur auf die Erfühlung gewisser Momente. Es gibt da etwas Merkwürdiges, was als Phänomen in der Tat durch die moderne naturwissenschaftliche Forschung erst voll herausgetreten ist. Man hat in ihr ziemlich alle absoluten Grenzen, alle sogenannten „scholastischen“ Grenzen aufgelöst oder auflösen wollen. Sie wissen, daß dieser Versuch dort, wo es sich um konstitutiv formale Seinsgrenzen handelt, philosophisch absurd genug ist. Mag es immer Wesen geben, die noch vor der Differenzierung in Tier und Pflanze stehen, mag sich beides faktisch eigentümlich mischen können – dadurch kann der radikale Gegensatz, der, wie gesagt, im ontisch Formalen liegt, nicht tangiert werden. Darüber sind wir einig. Aber hier nun – im Tierreich selbst, im Pflanzenreich selbst: der formale Rahmen ist konstituiert und soll gleichsam qualitativ ausgefüllt werden: gibt es da immer neue und neue „uranfängliche“ Qualitäten? Sozusagen Vollqualitäten, die das gesamte Sein des Tiertypus in ihrer substanziellen Ausgestaltung bestimmen? {107} P s i l . : Der Biologe glaubt, daß die gesamte Gestaltung der Tierspezies durch das Milieu, in dem sie lebt, oder bei der vorauszusetzenden Gestaltsfixierung gelebt hat, in genauester Weise bestimmt wird. M o n t . : In der Tat, Psilander, man gerät hier auf groteske Dinge. Eine jede Tierart ist nur darauf aus, sich zu erhalten, sich im Dasein lebensmäßig durchzusetzen – diese Erkenntnis ist heute nachgerade so banal geworden, daß man nach anderem sucht. Aber wenn man nun wirklich sieht, daß die Ausgestaltung der Art bis in ihre scheinbar kleinsten Zufälligkeiten hinein diesem Gesetz zu folgen scheint, d. h. verstehbar ist aus der Notwendigkeit, sich gerade diesen konkreten Verhältnissen anpassen zu müssen, um überhaupt existieren zu können? Man fragt sich dann: ja, w a s eigentlich will sich denn durchaus erhalten? Und man fragt vergeblich. Denn die Art gerade in ihrer spezifischen Gestaltung wird durch diese Anpassungsnotwendigkeit b e s t i m m t . Da ist dann alles auf den Kopf gestellt. Die

232

Metaphysische Gespräche

Fortpflanzungs- und Ernährungsorgane, die Sinneswerkzeuge, der ganze leibliche Habitus in seinen Möglichkeiten, in bestimmter Weise zu agieren, alles das ist nicht etwa in seiner eigentümlichen Artung wegen einer bestimmten und immer noch vorauszusetzenden Spezies da, die eben als solche erhalten werden muß – nein, die Spezies ist wegen dieses Komplexes von Erhaltungsmöglichkeiten da. Oder genauer: sie ist das Gestaltungsresultat eben dieser und keiner anderen eigentümlichen Weise, sich im Dasein zu erhalten – bei den Pflanzen in der Form bloßer Gestaltswesen, bei den Tieren in der typischer Aktionswesen. {108} P s i l . : Jetzt scheinen Sie der Meinung folgen zu wollen, die alles von außen her rational aufbaut, und bisher sprachen Sie doch von jenen gleichsam schöpferischen und immanenten Quellen der Substanziierung – ich verstehe nichts mehr. Wo bleibt die „Quall“? M o n t . : Huldigen wir nicht dem allzu schnellen Entweder-Oder, mein Psilander? Synthesen sind immer da, nur vielleicht nicht dort, wo wir sie suchen. Und schließlich hier: irgend etwas muß ja vorhanden sein, was sich anpassend gestaltet oder sich gestaltend anpaßt. Irgend etwas muß den Trieb zur Substanziierung und Selbsterhaltung im Dasein in sich haben – P s i l . : Der Wissenschaft zufolge wäre das die jeweilig immer weniger entwickelte Tierspezies – M o n t . : Und zu Anfang jene primitiven einzelligen Wesen, von denen dann niemand weiß, woher sie kommen. Gewiß. Mag dem sein wie immer. Merkwürdig bleibt nur, woher die Entwicklung hier auf einer niedersten Stufe stehen blieb, dort bis zur höchsten Kompliziertheit gelangte, weshalb alle diese vielen eigentümlichen Sackgassen mit allen ihren unendlichen Verzweigungen, in die sich das Reich der Lebewesen in immer neuer Gestaltung einzwängt und in denen es an allen Enden blind ausläuft – nur in der nicht, die zum Menschen führt. {109} P s i l . : Sackgassen? M o n t . : Ja, denn so kann man ja schließlich vom höchsten Standpunkte aus alle diese merkwürdigen Versuche, sich im Dasein zu substanziieren und substanziierend zu erhalten, nennen. Mag es nun in „Schwammform“ oder „Krebsform“ oder „Ameisenform“ oder„Schlangenform“ sein. Ich glaube, Bergson sieht es ähnlich. Ja – was hat hier und dort den Elan gegeben, sich soweit zu komplizieren und nach gerade dieser Richtung? Was hat bei gleicher allgemeiner Artung des Milieus die Veranlassung gegeben, daß sich gerade in diesem engeren Milieu diese Art ausbildete, in jenem jene? Hier wieder überall nur Zufall, äußere Bedingungen sehen zu wollen, sind Sie bereit dazu? Es könnte sich wirklich das Verhältnis einmal umkehren, daß, wie Üxküll sagt, wenn auch in etwas anderem Sinne, nicht das Milieu das Tier schafft, sondern das Tier sein Milieu. Oder besser und um in unserer Ausdrucksweise zu reden: daß das sich substanziierende Wesen, getrieben und geleitet von der in ihm wirkenden und eben zur leibhaften Gestaltung drängenden

Um den Menschen

233

Quall, sich dasjenige engere oder auch weitere Milieu „aussucht“, sich in demjenigen Milieu gerade, sich ihm anpassend, festsetzt, in dem der vitale Elan, die vitale Reichweite, die Lebensintensität, der „Wärmegrad“, die Beweglichkeit seiner Lebens- und Gestaltungsquelle oder was immer man da nennen könnte und müßte, spezifische Gestaltungsbefriedigung findet. Auch dann müßten das Milieu und die endgültige Gestalt sich einander aufs Genaueste angepaßt zeigen. Auch dann könnte die Spezies in ihrer eigentümlichen faktischen Artung restlos aus dem Trieb erklärt werden, sich im materiellen Dasein (nicht nur konsequenterweise zu erhalten, sondern) erst einmal l e i b h a f t und damit wesenhaft zu substanziieren, festzusetzen, s i c h i n e s e i n z u g e s t a l t e n . {110} P s i l . : Jetzt fange ich an, ein wenig zu verstehen, worauf Sie hinauswollen. Sie wollen der lebendigen materiellen Gestaltung schlechthin und allen ihren unzähligen Erscheinungen und Modifikationen einen puren und sozusagen allgemeinen „Trieb“, eben im materiellen Dasein G e s t a l t z u g e w i n n e n , sei es wie immer, fundierend zugrunde legen? M o n t . : O ja, Sie haben es begriffen. Nur ist das nicht eine These oder Behauptung oder Anschauung, sondern irgend ein kleiner tastender Versuch – nahegelegt durch eine Fülle sich aufdrängender Phänomene. Hier handelt es sich jetzt nicht um strenge Analyse, sondern um ein vagabundierendes Gespräch. Sie sagten eben „sei es wie immer“ – und diese Wendung drückte gerade das aus, was wichtig ist: dieses bloße urhafte Streben, sich ins wesenhafte Dasein hineinzuverleiblichen als solches –, das in jeder Quall sich gleicherweise auswirkt und worin eben ihr eigentliches, ihr allüberall gemeinschaftliches Wesen besteht. Jede materielle Entität wird so zu irgend einer spezifischen und ganz direkten Manifestation dieses Gestaltungsverlangens. {111} P s i l . : Dieses Gestaltungsverlangens oder Verleiblichungs- oder Substanziierungsstrebens schlechthin? M o n t . : So könnte man sagen. Und die Differenzen? Die Fülle der unendlich mannigfaltigen Erscheinungen? P s i l . : Sie sprachen von der Verschiedenheit der Energie, des Tempos, des Elans –? M o n t . : Der Leidenschaft, des Maßes und Umfangs an Ausdrucksstreben – hier eben kommen jene letzten und schließlich unausdrückbaren Differenzen in Betracht. In welcher metaphysischen Tiefe sie liegen mögen – wie weit die Gestaltungsdifferenzen dann doch vorwärtig und peripher von den äußeren Gestaltungsbedingungen, von Gestaltungshemmungen und dergleichen abhängen mögen – hier enden unsere vagen Tastungen völlig. Aber wissen Sie, Psilander, weshalb wir das jetzt einmal so auf Probe entworfen haben? P s i l . : Um die Quall und ihr Wesen war es uns zu tun –

234

Metaphysische Gespräche

{112} M o n t . : Und um die Möglichkeit ihrer Differenzierung, um die Möglichkeit letzter Qualitätsunterschiede, die dann in der Totalität des Gestalteten leib- und lebhaft geworden ist. Es schien uns ein wesentliches Etwas in der Natur – die unendlichen Übergänge, das gestaltungsmäßig Zufällige aller dieser aneinander vorbei- und hinaufdrängenden Erscheinungen mit ihren unendlichen Modifikationen – gegen die Ansetzbarkeit immer neuer und neuer mit sich selbst beschlossener Urqualitäten zu sprechen, die die betreffenden Gestaltungen gewissermaßen a priori und vorgezeichnet in sich tragen. Und wiederum t r ä g t ja jede Gestaltung ihren einzigartigen und bis in die Wurzel gehenden Qualitätsstempel. Diesen beiden Phänomenen, die erst Natur zu Natur machen, muß spürend nachgegangen werden. Das aber zwingt, an einer wesentlichen Stelle mit scholastischen Vorstellungen zu brechen. Hier setzt plötzlich eine bis auf den Grund differente Fühlung der Natur ein. P s i l . : Vorstellungen, mit denen ja faktisch längst überall gebrochen wurde – M o n t . : Aber nun wieder in einem Ausmaß und Sinn, der keineswegs berechtigt ist, und unter anderem auch jenes zweite Phänomen gänzlich ausgelöscht hat. Das Phänomen von der qualitativen Selbstherrlichkeit einer jeden Gestalt – wie man es nennen könnte. In diesem letzteren liegt zugleich die Anschauung von der Substanzialität der Natur: daß jedes Naturhafte die Quelle seines Seins in sich selber birgt und auf eigenen Gestaltungswurzeln steht. Diese das ganze scholastische Weltbild tragende Vorstellung ist in der Tat für jede reelle und wesenhafte Naturanschauung von allerhöchster Bedeutung. Sie erst gibt der Natur ihre lebendigschöpferischen Potenzen zurück. {113} P s i l . : Ihre schöpferischen? Aber gerade für die Scholastik ist Gott der Schöpfer eines jeden Dinges? M o n t . : Verwechseln Sie nicht transzendente und immanente Schöpfung. Gott setzt ein jedes Ding in seine substanzielle und es also nunmehr nährende, bauende und es i n s i c h s e l b s t bewahrende Quelle. Er schafft es und erhält es in seiner Substanzialität; aber erschaffen und erhalten steht es nunmehr in sich selbst auf eigenem Boden. Diese beiden Momente in ihrer Wesentlichkeit und Widerspruchslosigkeit erkannt zu haben, ist gerade eigentümlichstes Verdienst scholastischen Geistes. P s i l . : Und die Grenze? Mir ist wieder entglitten – M o n t . : Wenn die Naturentitäten als qualitativ wesenhaft isoliert, wenn sie als apriorische Gestaltswesenheiten gesehen und gefaßt werden – ja, apriorische Gestaltswesenheiten, dieser Ausdruck scheint mir bezeichnend. Dann hat alles Evolutionäre, dann hat der Übergang, der Zufall, der Versuch, der Wurf, das halb und gar nicht „Geglückte“ keine echte Stelle mehr – mag es wie immer eingeführt werden. Es kommt auf den Geist der Sache an. Dann verlieren die Naturentitäten in ihrer Erscheinungsfülle das Moment einer gewissen „Gleichgültigkeit“ an letzter

Um den Menschen

235

Stelle, den Aspekt, m e h r o d e r m i n d e r (und hierin drückt sich ihre Verbundenheit aus!) geglücktes Gestaltungsresultat eines einzigen gestaltungsbegierigen ungeheuren Lebens zu sein. Dann wird die Natur trotz aller wesenhaften Substanzialität doch schließlich zu einem – Museum. {114} P s i l . : Und die Schöpfung? M o n t . : Ich glaube nicht, daß das Fiat, das „es werde“, das Öffnen der Quellen, oder wie immer es notwendig sein möchte sich da auszudrücken, seine basierende Stelle verliert. Doch hier beginnt Metaphysik. Und mir scheint, mein Freund, wir haben heute schon reichlich viel theoretisiert.Wir sollten jetzt zu schlichter Analyse zurückkehren, wie es Phänomenologen ziemt. Wenn zwar – ich fürchte, ich fürchte – gerade diese uns der Metaphysik schließlich ganz in die Arme treiben wird. Wenn es Ihnen recht ist, fahren wir morgen fort und versuchen uns weiter zum Menschen heranzupirschen.

2. Dämonen und Engel, Geist und Geister. {115} M o n t . : Wie nun, Freund, werden wir beginnen? Wo sollen wir anknüpfen? P s i l . : Mir ist bei späterer Überlegung aufgefallen, daß wir gestern immer nur von den l e b e n d i g e n Naturentitäten sprachen. Wie aber ist es mit den toten, die doch auch einen konstitutiven Teil dieser Natur ausmachen? M o n t . : Mit Gold und Kohle, Wasser, Schwefel und Salz? P s i l . : Ja – derartiges. M o n t . : Und inwiefern wäre es nötig gewesen, auch von ihnen zu sprechen, da wir uns doch mit dem Tiere und dem Menschen beschäftigen wollen? P s i l . : Sollte es nicht, wenn ich Sie recht verstand, für eine Naturentität wesenhaft sein, daß sie sich aus eigener Quelle innerlich schöpft – oder wie Sie sich da ausdrückten? M o n t . : Daß sie in eigener sie eben zu dem, was sie ist, substanziierender Quall urständet? P s i l . : Ja. Aber trifft das nicht allein auf die lebendigen Wesenheiten zu? M o n t . : Bis hinab zu den Pflanzen? – P s i l . : So würde ich denken. M o n t . : Sollten wir denn nicht auch von der Quall des Goldes, der Quall des Wassers reden können und müssen? {116} P s i l . : Aber wo bleibt da die Grenze zwischen dem vegetativ Lebendigen und dem stofflich Toten? Gerade Sie, denke ich, müßten auch hier die Wesensgrenzen unbedingt respektieren wollen.

236

Metaphysische Gespräche

M o n t . : Das müssen wir allerdings. Aber konnten wir denn nicht auch die Wesensgrenze zwischen Tier und Pflanze durchaus festhalten – ja, ließ sie sich nicht erst völlig deutlich machen a n dem verschiedenen formalen Verhältnis zu der jeweilig substanziierenden Quall? P s i l . : Insofern sie sich in der Pflanze nur lebendig gestaltend auswirkt, im Tiere aber – M o n t . : – aktiv dargelebt wird. P s i l . : Hier wie dort handelt es sich um ein lebendiges Hineinwirken dieser Quall in die betreffende Entität.Wie aber soll bei den toten Stoffen hiervon die Rede sein. Sie müßten sie denn wirklich auch in der Art des vegetativ Lebendigen auffassen wollen. M o n t . : Sie würden also sagen, daß die Quall in die Pflanze lebendig hineinwirkt? Oder vielleicht besser, daß eben darin das Eigentümliche vegetativer Lebendigkeit besteht, daß eine Quall sich gestaltsmäßig an und in der Materie auswirkt, daß sie sich einen leibmäßigen Ausdruck in einer bestimmt gearteten Gestalt schafft? P s i l . : So ungefähr vielleicht. M o n t . : Und eben dieses unmittelbar gestaltende Hinein- und Fortwirken eines lebendig substanziierenden Grundes würden Sie den „toten“ Stoffen absprechen? {117} P s i l . : Sie sind was sie sind – ein für allemal –, auf Grund einer bestimmt gearteten Konstellation toter Kräfte. Da ist kein Wachstum, keine Bildung von innen her, keine individuelle und artmäßige Selbsterhaltung in Regeneration und Fortpflanzung. M o n t . : Lauter Anzeichen, daß in der betreffenden vegetativ lebendigen Entität die Quall eine selbsteigene S t ä t t e gefunden hat, daß sie sich nicht nur ein für allemal in ihr leibhaft manifestiert hat, sondern – in ihr gleichsam wohnend – in fortwährender Aktualität aus ihr heraus oder in sie hinein (wie man es nehmen mag) wirkt? P s i l . : O – jetzt haben Sie unversehens einen Unterschied gebracht, der wesentlich sein mag. In den toten Stoffen besitzt die Quall keine selbsteigene Stätte, aus der heraus sie immer aktuell wirkt – M o n t . : Und sollten sie also nicht trotzdem die verleiblichten Manifestationsresultate dieser oder jener fundierenden, dieser oder jener gestaltungsgierigen Quall sein können? Auch sie? Nur eben in der Form ein für allemal, wie Sie sagten, abgesetzter und substanziell fixierter Gestaltungsresultate? P s i l . : Der Wesensunterschied zwischen Totem und Lebendigem wäre hiermit allerdings wohl untangiert. M o n t . : Aber?

Um den Menschen

237

{118} P s i l . : Ich sehe nicht recht, wie diese Anschauung mit den chemischanalytischen Ergebnissen der Wissenschaft zusammengehen kann. Und auch: die Verwandlung eines Stoffes in den andern – M o n t . : Die Chemie stellt höchst interessante Ordnungs- und Aufbaugesetze fest und substituiert ihnen entsprechende Kräfte und Potenzen. Aber könnte nicht das ganz bestimmte Aufbaugesetz irgend eines Körpers, das in einer bestimmten Kräftekonstellation fixiert und als solches gesichert sein mag, andere Gründe noch haben als zufälliges Zusammengeratensein eben dieser Potenzen? Ist nicht im Wasser, im Blei, im Schwefel jeweilig etwas wesenhaft gestaltsmäßig ausgesprochen? Zur leibhaften Manifestation gelangt? P s i l . : Ein vages Bewußtsein hiervon habe allerdings auch ich. M o n t . : Aber auch hier gewiß keine a priori immer neu für sich setzbaren Gestaltswesenheiten. Hier im Reich der Stoffe zu allerletzt. Über all die aufsteigenden und absteigenden, die sich kreuzenden Linien, die immer neuen „Versuche“ und „Würfe“ nach gleichen oder verschiedenen Richtungen. Letzte Spezifikationen in der Art und Weise, sich ins Dasein einzustofflichen, sich in ihm einzufixieren; aber dieses pure „Gestaltungsstreben“ selbst als allgemein manifestierte Grundlage. O – darüber ließe sich viel Konkretes, viel Einzelnes und Erhellendes sagen. Aber wir dürfen uns nicht verirren. Fast sieht es aus, als ob Sie uns mit Ihrer Frage nicht in unser Thema hinein sondern ganz aus ihm herausgebracht haben. Aber doch gibt es jetzt gerade ein Moment, das wesentlich genug ist. Haben wir nicht in unserem Fortgang vom Tiere zum puren Stoff ein immer neues Verhältnis zur Quall entdeckt, das sich formal fassen ließe? Im Tiere wurde sie selbsteigen, wurde sie aktiv dargelebt, in der Pflanze wirkt sie sich lebendig und aktuell aus, wenn auch die Pflanze nur mehr noch ihre Gestaltungsmanifestation darstellt. Im puren Stoffe aber scheint sie selbst gar nicht mehr persönlich gegenwärtig, gar nicht mehr beheimatet zu sein, ob sie zwar auch hier als letztes Gestaltungsfundament durchaus gelten mag. {119} P s i l . : Als wenn das Verhältnis nach oben hin immer„innerlicher“ würde. M o n t . : Die Quall immer eigentlicher in das Sein und Sich-Darleben der betreffenden Entität einbegriffen würde? P s i l . : So etwa. M o n t . : Oder auch die betreffende Entität immer eigentlicher selbsteigner Besitzer der sie substanziierenden Quall würde? Kann man auch so sagen? P s i l . : Dem Stoff ist sie noch ganz transzendent oder daher unerreichbar, der Pflanze schon immanent, dem Tiere aber – M o n t . : Der Pflanze ist sie immanent, aber sie, die Pflanze, bleibt der Quall äußerlich; sie bleibt ihr und ihrem Gestaltungsstreben passiv überliefert. Beim Tiere aber ist nicht nur die Quall immanent, sondern der Quall ist im Tiere auch das Tier immanent.

238

Metaphysische Gespräche

{120} P s i l . : Noch nicht ganz habe ich verstanden – M o n t . : Nicht nur„wohnt“ die Quall selbsteigen im Tiere, wie sie in der Pflanze wohnt, sondern das Tier wohnt als solches auch in der Quall. Ist hier nicht ein eigentümlichster Durchbruch geschehen? Ist nicht der substanziierende Grund an die Oberfläche des Daseins geraten? Hat er, der bis dahin nur von der Tiefe her gestaltend und ausgestaltend wirkte, nicht jetzt – m i t dem Tiere – aktiv Sitz und Stimme gewonnen? P s i l . : Das Tier schöpft in seinen Reaktionen und seinem spontanen Agieren unmittelbar aus der in ihm wirksamen Quall – kann man auch so sagen? M o n t . : Sicherlich. Aber ebenso wichtig ist es nun zu betonen, daß es durch die Quall zu den bestimmten Aktionen und Reaktionen unmittelbar gedrängt und gezwungen wird. Das Tier ist ja wie ertrunken in diesem sich durch es hindurch aktiv auswirkenden Leben. P s i l . : Jetzt sind wir bei früheren Bestimmungen angelangt. Früher sagten wir, das Tier bleibe eingesenkt in seine eigene Natur und umhüllt mit ihr, jetzt, es sei „wie ertrunken“ in seiner sich in ihm auswirkenden Quall – {121} M o n t . : Aber ich denke, wir haben jetzt einen etwas vertiefteren Aspekt gewonnen. Das Tier ist noch ertrunken in seiner eigenen Quall, der Mensch aber aus ihr errettet, das Tier noch begraben in der Tiefe und Untiefe eigener Innerlichkeit, der Mensch aber auferstanden. Das Tier fällt noch ganz der Dimension des Dämonischen anheim, der Mensch aber nimmt an der Dimension des „Englischen“ teil – P s i l . : Das sind jetzt allerdings neue Begriffe. M o n t . : Die ich zaghaft genug ausspreche. Nicht etwa will ich das Tier zu einem Dämon oder den Menschen zu einem Engel machen. Beides wäre falsch genug und das Letztere zugleich grotesk. P s i l . : Höchstens könnte man den Menschen doch ein Gemisch aus Dämon und Engel nennen? M o n t . : Aus Dämonischem und Englischem besser. Doch auch das dürfte noch recht bedenklich sein. Aber gut wäre es, Psilander, und von höchstem Interesse, wenn wir uns diesen Gegensatz einmal etwas näher betrachten. Haben wir nicht eine ontische Gegensätzlichkeit vor uns, wie sie schärfer nicht gedacht werden kann? P s i l . : Noch sehe ich nicht ganz, was Sie im Auge haben. Und hätten wir nicht schon einmal über Engel gesprochen – M o n t . : So würden Sie wiederum glauben, ich triebe Spott mit Ihnen. P s i l . : Vielleicht. {122} M o n t . : Aber das sahen Sie mit mir, daß im Tiere, besonders im höheren, sich das spezifisch Dämonische eigentümlich manifestieren kann? P s i l . : Wenigstens kann ich mir ungefähr vorstellen, was Sie meinen.

Um den Menschen

239

M o n t . : Sollten wir es nicht etwas näher fassen können? Haben wir nicht mit dem Dämonischen etwas im Sinn, was jedenfalls in die „Tiefe“, ins Unterirdische, Untergründige gehört? P s i l . : Was jenseits der gegebenen, der empirischen Natur liegt? M o n t . : Soweit es nicht in sie hineinwirkt. Aber Sie haben recht: seiner eigenen Behausung, seinen Wurzeln nach liegt es jenseits. Doch jenseits liegt auch, was überirdisch, was in der Höhe ist. P s i l . : Womit ein sachlicher, kein örtlicher Unterschied gemeint ist? M o n t . : Das Örtliche, vielleicht nicht im brutalen räumlichen, sondern in einem metaphysischen Sinne, ist Konsequenz, nicht Grundlage. Dazwischen aber liegt das spezifisch Irdische – die gegebene empirische Natur, wie Sie sagten.Warum nun nennen wir jenes im Verhältnis zu diesem „unterirdisch“? P s i l . : Wenn es das überall lebendig Fundierende ist – und so schien es doch in der Tat bisher – so dürfte es vielleicht nicht so schwer zu verstehen sein. M o n t . : Sie bringen das Dämonische ohne weiteres mit der Quall zusammen? {123} P s i l . : Muß man nicht? Allerdings – ich tat es unversehens. M o n t . : Aber in der Pflanze z. B. oder gar im Wasser finden wir doch kaum eine Spur des Dämonischen, wenngleich wir auch hier von der qualifizierenden Quall sprachen. Überhaupt streift uns fast nur bei den höheren Tieren eine Spur und Ahnung dessen. P s i l . : Also dort nur, wo das Tier eine eigene Lebens- und Erlebensmitte besitzt, aus der heraus es agiert – M o n t . : Wo recht eigentlich erst die Quall zu offener und freier Wirksamkeit durchgebrochen ist. Eben das, was uns aus den Augen eines Tieres zornig und flehend, gierig und unterworfen und immer in dieser eigentümlich bebenden Stummheit ansprechen kann. Und gelegentlich in unverständlichen Aktionen der Macht und Kraft sich äußert. Immer aber auch hier noch das schließlich Gebundene, Geregelte und Fixierte, das die freie Manifestation des Dämonischen wesenhaft hindert. P s i l . : Hier also scheint ein Gegensatz zu liegen. Wo Gebundenheit ist, ist nicht Dämonie. M o n t . : Aber doch auch: wo Freiheit ist, ist nicht Dämonie. Ist nicht das Dämonische das spezifisch Unfreie? P s i l . : Eine Doppeldeutigkeit des Ausdrucks „Freiheit“! M o n t . : Sehr recht. Die Unfreiheit der empirischen Naturentitäten ist nicht die Unfreiheit des Dämonischen. {124} M o n t . : Die Unfreiheit des Dämonischen steht mit Ungebundenheit nicht im Widerspruch, wohl aber die des Empirischen. M o n t . : Ist es nicht eben ausschlaggebendes Charakteristikum der materiellen Natur, in bestimmten Gestalten und mit denselben gesetzten Daseinsabläufen fi-

240

Metaphysische Gespräche

xiert zu sein? Nicht was die Natur zur Natur, wohl aber was sie zur materiellen, zur empirischen, zur sinnlich manifesten Natur macht, liegt hier. P s i l . : Was sie aber zur Natur macht, liegt gerade in der Teilnahme an der Dimension der Tiefe, an der Dimension des Dämonischen? M o n t . : O, Sie haben verstanden. Nur daß das Dämonische eben dort und alsobald aufhört, ein solches zu sein, wenn es in bestimmte Naturgestalten hineingestaltet, hineinsubstanziiert und fixiert ist. Oder vielmehr kann man vom Dämonischen von vornherein gar nicht sprechen, wo es schon in der Bestimmung des treibenden und qualifizierenden Lebens liegt, in fixierten Bildungen Wesen und Bestand zu erhalten. P s i l . : Also nur dort, wo es sich frei auswirken kann? M o n t . : Was heißt nun also dieses „frei“ – P s i l . : Nicht fixiert, nicht gestaltet zu sein – M o n t . : Nicht substanziiert zu sein. Aber wie sich davon einen näheren Begriff machen? Das Substanziierte ist dasjenige, was in sich wahrhaft ausgewirkt ist als das, was es ist und so Leibhaftigkeit und Bestand gewann. Das nicht Substanziierte, noch Gestaltlose also – {125} P s i l . : Ist das „Hohle“ – M o n t . : Sie haben zuweilen treffliche Bilder, die in ihrer Bedeutung nur gefühlt werden könnten. Muß man nicht diese Dimension geradezu an dem Hunger und der Gier nach Substanzialisierung und Leibhaftwerdung bestimmen? P s i l . : Schon einmal, als wir die Gestalt des Luzifer streiften, sprachen Sie von dieser und zwar hier vergeblichen Gier. M o n t . : Ja, nur daß es sich dort um den gefallenen Engel, also um ein in der Substanzialität des Geistes in der Dimension der Höhe wurzelndes Wesen handelt, das diesen seinen Standort und damit seinen Bestand verlor und nun Bestand und Wesen gewaltsam aus Eigenem gewinnen will. Luzifer gehört nicht, in die Dimension des Dämonischen, wenn er auch zum selbstverständlichen Herrn aller Dämonen wird. In der Dimension der Tiefe aber handelt es sich um das eo ipso oder „naturgemäß“, weil eben noch vor aller Gestaltung und Wesenhaftigkeit liegende gestaltungsgierige Leben an sich selbst. Das schwanger mit der chaotischen Fülle aller nur denkbaren Qualifikationen diese zur Manifestation und Auswirkung herauszusetzen drängt. Hier, im Chaos, werden die Dämonen geboren. P s i l . : Die aber doch wiederum Gestalten sind? – {126} M o n t . : Sie haben recht und es scheint mir kein Widerspruch. Gestalten und damit wirkliche Dämonen sind und werden sie, sofern sie einzeln für sich gesetzt, in sich persönlichen Sitz und persönliche Stimme erhalten. Aber in ihnen ist eben das Gestaltlose „gestaltet“; sie sind die U n w e s e n katexochen. Und sollte nicht, Psilander, ihre eigentümliche Macht, die Unwiderstehlichkeit ihrer Herrschaft, wo sie sich kundgibt, gerade auf diesem konstitutiven Trieb nach Auswir-

Um den Menschen

241

kung, nach Substanzialisierung und Gestaltwerdung wo und wie immer beruhen? Ihre Brutalität bei Hemmung und Widerstand, ihre Unbeirrbarkeit ist die Brutalität, ist die Unbeirrbarkeit des gestaltungssüchtigen Lebens schlechthin. P s i l . : Hierauf auch beruht zugleich ihre Unfreiheit, wie mir jetzt scheint. Denn natürlich: was aus dem Urleben herausgestaltet ist, kann nicht anders, als diesem Urleben folgen. M o n t . : Sehr richtig. Sie sind besessen von sich selbst, so wie hinwiederum ein Mensch oder ein Tier von ihnen besessen sein kann. Was aber ein anderes ist, Psilander, als wenn das Tier selbst, wie wir vorhin sagten oder der Mensch dämonische Q u a l i t ä t e n hat. Sie verstehen? P s i l . : Ja, aber wie ist ein solches wirkliches Besessensein möglich? Ich habe davon keine Vorstellung. {127} M o n t . : Wir Menschen von heutzutage haben wenig Vorstellung mehr von solchen Dingen. Aber muß sich nicht das Dämonische mit Gier auf jede „leere Stelle“ werfen, die nur irgendwo innerhalb der substanziellen Welt und ihrer Gestaltungen auftritt? Wo sie eindringen können in diese und sich ihre Leibhaftigkeit und Ausdrucksfähigkeit zu Nutze machen können, wo sie d u r c h den Menschen oder das Tier hindurch an die Oberfläche des Daseins zu dringen vermögen. So etwa würde ich mir Dergleichen vorstellen. P s i l . : Was heißt „leere Stellen“? M o n t . : Wo konstitutiv oder entwicklungsmäßig oder durch bewußte Selbstentleerung keine volle Leibhaftigkeit des eigenen, des natürlichen Lebens besteht oder mehr besteht. Die Selbstentleerung, die Entsubstanzialisierung als bekanntlich der erste Schritt zur Vollkommenheit im mystischen Sinn ist auch die nun gefahrvolle Basis für das Einbrechen „unterirdischer“ Gewalten.Wehe dem Menschen, der sodann nicht gewappnet ist. Die Materialität der Welt, ihre Beschwerung und Fixiertheit hierin ist nicht nur Hindernis für die verlorene Erhöhung ins Geistige, sondern der nun einmal entwurzelten zugleich Schutz gegen das Versinken in die dämonischen Gewalten des Abgrundes. So etwa sagt Franz von Baader. Aber jetzt, Psilander, wie finden wir aus der Tiefe in die Höhe? P s i l . : Vom Dämonischen zum Englischen? Sie sprachen von einem radikalen Gegensatz. M o n t . : Von einem polaren Gegensatz, ja. Ist es nicht, als wenn wir von der Unfreiheit in die Freiheit, aus dem Dunkel ins Licht, aus dem chaotisch Gestaltlosen zur Herrlichkeit und Strenge der Gestalt aufstiegen? {128} P s i l . : Das sind Aspekte – Bilder – M o n t . : An die Wurzel des Gegensatzes müssen wir uns erst heran arbeiten. Steigen wir nicht auf ins Reich des Geistes? P s i l . : Engel sind Geister – M o n t . : Ja – jedenfalls von geistiger Wesenheit.

242

Metaphysische Gespräche

P s i l . : Aber – sind denn Dämonen nicht auch Geister? Ich hätte wenigstens immer geglaubt, daß sie in diese Kategorie eingeordnet werden müßten. M o n t . : Und daher eigentlich kein eines modernen Menschen würdiger Beschäftigungsgegenstand sind? P s i l . : Ach, Montanus, Sie wissen ja, wie sehr Sie mich schon eingesteckt haben. Mag man nun an das alles glauben oder nicht – ich weiß, Sie glauben daran – jedenfalls erwachsen ungeahnte Einsichten. M o n t . : Unsere Dämonen sind also auch Geister – Geister „aus der Tiefe“ sozusagen. P s i l . : Sie haben doch jedenfalls, so wie man von ihnen spricht, sprachliche Audrucksfähigkeit, Selbstbewußtsein, Intelligenz? M o n t . : Weil sie sich in Einflüsterungen, guten und schlechten Befehlen kundgeben – oder z. B. die ihr Unwesen in Menschen treibenden Dämonen den noch ganz unerkannten Jesus von Nazareth als den Messias und Sohn Gottes ansprechen? P s i l . : Zum Beispiel. M o n t . : Sind Menschen Geister, weil sie Intelligenz haben? {129} P s i l . : Nein. Aber jedenfalls haben sie damit einen Geist. M o n t . : Vielleicht dürfte das auch nicht ganz so einfach sein. Doch jetzt suchen wir nach dem Moment, das uns veranlaßt, Dämonen – im Unterschied zum Menschen – Geister zu nennen. P s i l . : Es scheint mir fast, als wenn es mit ihrer Leiblosigkeit zusammenhinge? M o n t . : Mit dem Mangel eines materiellen Leibes? P s i l . : Ja. M o n t . : Weil sie, wie Sie vorhin sagten, „hohl“ sind, wesenlos, ohne alle wahrhaftige Substanzialität? P s i l . : Fast scheint es mir so. M o n t . : Gerade damit also hinge es zusammen, was ihre eigenste Natur ausmacht – denn deshalb ja eben ihr unstillbarer Hunger nach Gestaltung und Auswirkung. P s i l . : Auch im Volksglauben liegt es, daß Geister Schemen sind, die keine ganz eigentliche Realität haben. M o n t . : Die Geister, die gelegentlich erscheinen, meinen Sie? Z. B. auch die Geister der Toten, die sich an den Stätten ihres früheren Lebens oder auf den Kirchhöfen herumtreiben? Wenn sie nämlich von diesem Dasein, gequält durch die Erinnerung an irgendein Verbrechen, oder sei es sonst wie immer, nicht los kommen können. P s i l . : An solche abergläubische Vorstellungen etwa dachte ich. {130} M o n t . : Auch hier wäre es ja in der Tat ihre durch den Tod geschehene Entsubstanzialisierung, der für ihre ungetilgten Begierden furchtbare Mangel an einem ausgewirkten Leibe, der sie zu „Geistern“ macht!

Um den Menschen

243

P s i l . : So schwebte es mir vor. M o n t . : Aber, mein Psilander, heißt es nicht auch von Gott, daß er Geist sei? Sie sehen mich ein wenig verwirrt an und das ist gut. Denn Gott dürfte wohl das einzige Wesen sein, dem an Substanzialität und Leibhaftigkeit schlechthin nichts mangelt. P s i l . : Allerdings bin ich etwas verwirrt. M o n t . : Und sollte es nicht gerade deshalb sein, w e i l er absoluter Geist ist? Oder doch ohne diese Voraussetzung jedenfalls nicht möglich sein? P s i l . : Die restlose Substanzialität? M o n t . : Ja. Ist nicht allem Materiellen diese restlose und freie Ausgestaltung und Verwirklichung des eigenen Wesens unmöglich, weil die Materie eben – Grenzen setzt? P s i l . : Jetzt sieht es mir allerdings auch so aus. Und doch scheint es das gerade Gegenteil von dem zu sein, was mir eben noch einleuchtend war. M o n t . : Das gerade Gegenteil. Vorhin schien ein Geist zum Geiste zu werden durch das konstitutive oder sonstwie bedingte Unvermögen, sich zu verleiblichen und reelle Gestalt zu gewinnen, jetzt aber gerade in und mit der Möglichkeit absoluter Versubstanzialisierung. Was tun wir jetzt? {131} P s i l . : Ich weiß es nicht. M o n t . : So müssen wir uns wohl aufraffen und uns das, was „Geist“ ist, etwas näher betrachten. – Vielleicht sollte man bei ganz Abliegendem und gewissermaßen Anologiehaftem beginnen. Sprechen wir nicht, Psilander, auch von dem Geist einer Blumenart, der aus ihr aufsteigt, von dem Geist einer Gegend, der uns in bestimmter Weise anmutet? Kann man nicht sagen: hoffentlich bedrückt, beengt dich nicht der Geist, der in dieser Landschaft lebt. Oder: der Geist dieser Symphonie, dieser Kathedrale ist ein erhebender und letztlich befreiender? P s i l . : Hier überall handelt es sich wirklich nur um Analogien. M o n t . : Vielleicht – vielleicht auch nicht. Jedenfalls ist da etwas, das uns erlaubt oder sachlich auffordert, diesen Ausdruck anzuwenden. Was ist das? P s i l . : Man sagt ebensowohl: die Stimmung dieser Gegend oder die Stimmung, die über dieser Landschaft liegt – M o n t . : Aber in genau demselben Sinne? Ist nicht Stimmung etwas weniger, ist sie nicht etwas Oberflächlicheres als Geist? Wenn sich auch Stimmung und Geist qualitativ im allgemeinen entsprechen werden. P s i l . : Wenn der Geist einer Landschaft bedrückend ist, so ist auch ihre Stimmung bedrückend? M o n t . : Ja. Aber doch nicht immer. Kann man nicht gelegentlich sagen: der Geist dieser Landschaft ist ein wesentlich erhebender; aber heute liegt eine trübe Stimmung über ihr? Oder: Dieses Tier hat einen wilden Geist; aber heute ist es nicht bei Stimmung?

244

Metaphysische Gespräche

{132} P s i l . : Stimmung ist etwas mehr Zufälliges, der Geist aber hängt mit dem Wesen zusammen? M o n t . : Vielleicht ja. P s i l . : Aber Montanus, setzen Sie den Geist eines Tieres und den Geist einer Landschaft oder eines Gebäudes gleich? M o n t . : Wir wollen nicht setzen, wir wollen suchen. Aber in der Tat: ist es nicht auch beim Tier ein unpersönlicher Geist, der in ihm waltet, aus ihm spricht? Genau wie bei der Kathedrale, der Blume, der Gegend? P s i l . : Bei der Blume kann man wohl kaum sagen, daß ein Geist in ihr „w a l t e t “? M o n t . : Aber beim Tiere und bei der Symphonie? P s i l . : Ja – wohl weil hier etwas vor sich geht. Weil das Tier aus diesem Geiste heraus agiert, die Symphonie sich in ihm gestaltet und aufbaut. M o n t . : Auch in der Landschaft, auch in einer Kathedrale „waltet“ ein bestimmter Geist – P s i l . : Hier allerdings fehlt dieses Moment, daß durch ihn etwas in Bewegung gesetzt ist. Weshalb aber geht es hier und nicht bei der Blume? In dieser ist gleichsam nicht „Raum“ genug – M o n t . : Das ist gut – nicht Raum genug. Sie ist zu einebenig. Aus ihr kann ein bestimmter Geist nur„sprechen“, oder er kann „über ihr liegen“? Ist es nicht immer, Psilander, etwas Schwebendes, wovon wir hier reden? {133} P s i l . : Etwas Aufsteigendes, hin und her Webendes, Waltendes in diesem Sinne, ja. Aber das sind materielle Bilder, die uns irreführen können? M o n t . : Wenn das Bild sachlich anwendbar ist, so bedeutet es etwas. Übrigens haben alle solche Wendungen einen materiellen und – geistigen Sinn! Und der zweite ist vielleicht der primäre. Man muß sie nur in ihrer Wesentlichkeit haben. Was ist nun aber mit diesem Schweben, Weben und Walten? Wir haben ein charakteristisches Moment, nicht aber die Sache. P s i l . : Ich denke soeben darüber nach, weshalb zwar aus einem Hause, auch einem unbewohnten, ein bestimmter Geist sprechen, weshalb über ihm ein bestimmter Geist liegen kann, nicht aber aus einem – Stuhl. Zuerst nämlich schien es mir, als wenn es bei einem Hause möglich sei, weil dieses ebenso wie die Symphonie und Kathedrale aus dem bestimmt gearteten und orientierten Geist des Künstlers oder Erbauers geschaffen ist. Aber auch ein Stuhl kann unter der Regie einer künstlerischen Idee geschaffen sein. M o n t . : Nicht also auf das, was hinter der Sache liegt, sondern auf das, was in sie eingeht, kommt es an? Oder vielleicht besser, was aus ihr herausgeht? P s i l . : Der Stuhl ist zu „tot“, als daß ein Geist aus ihm sprechen könnte. Aber das Haus – ist es lebendiger? Es ist merkwürdig, aber es sieht in der Tat so aus. Als wenn das Haus atmen könnte, der Stuhl aber nicht.

Um den Menschen

245

{134} M o n t . : Jetzt haben Sie unversehens eine wundervolle Bestimmung gebracht und ich vermute, ich vermute eine Bestimmung von sehr großer Tragweite. Nur was atmet, kann Geist entfalten, und alles, was atmet, entfaltet Geist. P s i l . : Diese kühne Folgerung lag mir allerdings mehr als fern. Atmen – kann denn atmen etwas anderes bedeuten als das wirkliche Atmen des tierischen und menschlichen Wesens? M o n t . : Sie selber haben ja eben von dem „Atmen“ des Hauses gesprochen! P s i l . : Ja, aber doch nur ganz gleichnishaft – vage – M o n t . : Natürlich atmet das Haus nicht in dem materiellen Sinne eines Tieres, ja auch nicht in dem substanziell lebendigen einer Pflanze; denn es ist in diesem Sinne gewiß kein lebendiges Wesen. Und doch muß da ja irgend etwas sein, was Sie veranlaßte, so zu sprechen. Sie hatten entschieden ein reines Phänomen im Auge. Aber lassen wir Haus Haus sein. Nehmen Sie das, was Sie spürten, oder vielleicht auch nur zu spüren glaubten, heraus – dieses eigentümlich lebendige „wesen“ in sich selbst, diese innere Lebensbewegung, das, was allem eignen muß, was wir unter dem Aspekt eines aus ihm sprechenden Geistes auffassen wollen. {135} P s i l . : Der Ausdruck „wesen“ gefällt mir an dieser Stelle gut. So ist es – ein inneres, ein lebendiges Auf und Ab in der eigenen, mit sich selbst umschlossenen Leiblichkeit. Das auch meinte ich ja mit dem Bilde des Atmens. M o n t . : Und ich wüßte nicht, was man eigentlicher und ursprünglicher mit diesem Ausdruck des Atmens belegen sollte, als eben dies. Kann nicht im eigentlich reellen Sinn nur etwas atmen, was in „eigener Quall urständet“? P s i l . : Was sich in seinem ausgewirkten Sein aus eigener Quall schöpft? So sagten wir früher. M o n t . : In sich selbst aus eigener Wurzel, durch eigene innere Lebensbewegung immer neu „geleibt“ wird. Hier dann eben dieses „atmende Auf und Ab“, von dem Sie sprachen. P s i l . : Von dem man materialiter nichts zu finden und zu spüren braucht – ebensowenig wie vom Leben selbst? M o n t . : Sehr richtig. Es ist ja eben die „Bewegung“ dieses Lebens selber. P s i l . : Aber wie man jetzt vom Atmen zum Geist finden soll, ist mir allerdings nicht recht klar. M o n t . : Sollte die reine Wortbedeutung nichts besagen? Liegt in ihr nicht das Wesen der Sache symbolisiert? Heißt spiritus nicht „Hauch“? P s i l . : Im Hauche habe ich nichts von Geist. {136} M o n t . : Weil Sie Hauch von vorne herein materiell auffassen. Wie ist es denn, Psilander – wenn Sie durch einen Wald gehen und den „Geist“ dieses Waldes förmlich zu spüren meinen: ist es nicht, als wenn der Wald sein eigentümliches, sein substanzielles Wesen ausatmete und Sie eben diese „Luft“ als seinen Geist geistig einatmeten und erlebten?

246

Metaphysische Gespräche

P s i l . : Mit Ihrer Wendung, „als wenn er sein substanzielles Wesen ausatmete“, ist mir, glaube ich, plötzlich deutlicher geworden, was Sie meinen. Ich hatte doch auch dieses „Atmen“ noch zu materiell und damit wieder nicht tief, nicht wesentlich genug gesehen. Es ist ja richtig: man hat in solchen Fällen das Gefühl, als wenn sich das Wesen der Sache noch einmal frei um sie herum ausbreitete – M o n t . : Das Wesen der Sache, das andererseits in dem fixen Gebilde gestaltet und verleiblicht ist? P s i l . : Ja. M o n t . : Sollte man nicht „leiben“ und „geisten“ nebeneinander setzen können als zwei verschiedene Weisen oder Formen substanzieller Auswirkung? P s i l . : Das „Leiben“ als die Form fixierter Ausgewirktheit, das „Geisten“ als die unfixierter? M o n t . : Wenigstens vorläufig können wir so sagen. P s i l . : Sie meinen, daß alles, was aus eigener Wurzel substanziiert ist, also zum mindesten alle Naturentitäten, Leib und Geist in diesem Sinne besitzen müssen? {137} M o n t . : Lassen Sie mich noch nicht gleich darauf antworten. Wie ist es mit den Dämonen, Psilander? Sagten wir nicht, daß es zu ihrem Wesen gehört, von sich aus nicht ins Substanzielle gelangen zu können? P s i l . : Ja. M o n t . : Und was hieß uns das? P s i l . : Daß sie sich in ihrem Wesen nicht auswirken, nicht gestalten, nicht l e i b e n können, um jetzt diesen neuen Ausdruck zu gebrauchen. M o n t . : Und auch nicht „geisten“? P s i l . : Ich weiß nicht – M o n t . : O hier liegt ein schwieriger doppeldeutiger Punkt. Können wir nicht von einer bestimmten Art „Geist“ reden, der aus diesem oder jenem Dämon spricht? Von bösem und gutem Geist vielleicht sogar von süßem und grimmigem, von sanftem und zornigem? Und ist ihnen nicht allen eben das eigen, was man den „Hungergeist“ nennen kann? P s i l . : In dem Getriebensein nach Substanzialisierung? M o n t . : Ja. P s i l . : Also doch – M o n t . : Ja. Aber eben ein Hungergeist! Ist es der gleiche wie jener „ausgeatmete“, über und um die in ihrer Fülle lebende Entität gebreitete? P s i l . : Fast möchte man wie von den ganzen Dämonen auch von diesem Geiste selber sagen, er sei „hohl“. {138} M o n t . : Und mit Recht. Hat nicht ihr Geist, was seine Solidität gleichsam betrifft, gleiche Wesenlosigkeit wie das ganze Wesen?

Um den Menschen

247

P s i l . : Aber, Montanus, es scheint mir, daß es uns nur darauf ankommen sollte, ob es hier auch so etwas wie „Geist“ gibt und woran das hängt, nicht aber darauf, ob er nun etwas anders beschaffen sei wie der anderer Gebilde. M o n t . : Das ist richtig. Nur ist seine Uneigentlichkeit hier gerade so überaus bezeichnend für das, was er e i g e n t l i c h ist. Und danach suchen wir ja. Er kann sich ja hier gleichsam als solcher nicht entfalten. Sofern der Dämon, wenn auch als Unwesen, wenn auch deshalb ungestaltet und unausgewirkt, so doch als „Wesen“ bestimmter Art „gestaltet“ ist – Sie erinnern sich, daß dieser „Widerspruch“ gerade zum ausschlaggebenden Charakteristikum wurde – und also aus sich heraus lebt und „west“, erhebt er sich auch notwendig in sich zu einem Geist bestimmter Art. Aber sofern er sich eben nicht eigentlich zu sich erhebt, da er ja gar nicht zu sich gelangen kann, sondern von dem ihn qualifizierenden Leben nur gejagt wird und wie besessen ist, nicht aber es besitzt und es besitzend in ihm ruht, kann auch der von ihm „ausgeatmete“ Geist nicht zu der reellen Breitung und frei das Wesen darbringenden Substanzialität gelangen, die ihm als solchem eigen wäre. So wie das ganze Wesen nach sich selbst, nach wahrer Wesenhaftigkeit hungert, so hungert auch sein „Geist“ nach sich selbst, nach wahrer Geistigkeit. {139} P s i l . : Soeben haben Sie ein paar Wendungen gebraucht, die mir das Wesen von Substanzialität und Leibhaftigkeit um vieles deutlicher machten. Daß nämlich der Dämon von seinem ihn qualifizierenden Leben nur „gejagt wird“ und wie besessen ist, nicht aber es besitzend „in ihm ruht“. Plötzlich sah ich gleichsam die Entstehung des Leibes oder des leibhaft ausgewirkten Wesens vor mir. Daß dies qualifizierende Leben jetzt nicht mehr „hinter“ der betreffenden Entität liegt, die es – getrieben von ihm – nicht zu sich heran- und heraufholen kann, sondern nunmehr zu ihr erhoben und aus ihr herausgesetzt in seiner Fülle um sie herum gestaltet ist. So besitzt sie es nun und ruht in ihm – in dem Leibe ihres Seins. M o n t . : Psilander, das – bitte, halten Sie es fest, was Sie jetzt haben. Es ist wohl einer der entscheidendsten Punkte in der Konstitution des Seins, die es geben mag. Denn jetzt werden wir das Leiben und Geisten zu gleicher Zeit und mit gleicher Notwendigkeit entstehen sehen können. Bedarf es nicht, um zur Substanzialität im eignen Sein zu gelangen, einer ersten Bewegung, die eben in jenem Umschwung oder wie man es nennen soll, besteht, den Sie schon glücklich charakterisierten: diese Selbstbefreiung von dem Stachel des jagenden und hungernden Lebens und die Erhebung über dasselbe, die es nun zugleich möglich macht, jenes qualifizierende Leben zu freier Entfaltung heran- und heraufzuholen oder herauf- und herauszusetzen. {140} P s i l . : Ich bin etwas unsicher, von was eigentlich Sie jetzt sprechen. Ist das alles nur ein Gleichnis, ein Bild? Ist hier genetisch gewendet, was wesenhaft verstanden werden soll? Oder soll man sich jedes Ding so „entstanden“ denken? Aber

248

Metaphysische Gespräche

das käme ja einer Selbstschöpfung in jedem einzelnen Falle gleich – so aktive und selbstherrliche Wendungen gebrauchen Sie. M o n t . : Lassen Sie uns, Psilander, nicht zu unzart an letzte Punkte rühren. Gewiß sprechen wir nur in Bildern, gewiß sind zuerst und vor allem wesenhafte Verhältnisse gemeint, die aber eine metaphysische Genesis charakteristisch genug andeuten mögen. Und was die „Selbstherrlichkeit“ betrifft, so ist sie gewiß nur auf den Urzeuger und „Vater“ aller Dinge selbst anzuwenden, während alles andere durch ihn oder von ihm her durch das „Wort“ erhoben und in Wesen und Bestand geführt ist – P s i l . : Gott selbst entstanden – {141} M o n t . : Von Ewigkeit zu Ewigkeit aus sich selbst erstehend. Über die Weisheit Jakob Böhmes, Psilander, werden wir wohl hier kaum hinauskommen. Franz von Baader fixiert immer wieder, daß wir allerdings von einem naturfreien, d. h. über die Natur in absolut freier Selbstgestaltung erhabenen, aber nicht von einem naturlosen, d. h. von den Wurzeln und Tiefen qualifizierenden Urlebens abgeschnittenen Gott sprechen dürfen, wenn wir nicht den Ursubstanziellen an letzter Stelle doch in ein – Gespenst verwandeln wollen. Aber das Wichtigste und nun erst alles Mißverständnis ausschließende: daß nur Gott selbst aus seiner uranfänglichen lauteren und unfaßlichen Stille das qualifizierende Ur- und Naturleben in sich selbst erzeugt, gesetzt und erweckt hat. So a u c h in seinem allerersten „Anfang“ und Grunde frei von ihm und Herr über dasselbe. Aber kehren wir von dieser flüchtigen und schüchternen Annäherung an das ewig brennende Zentrum aller Fragen in unsere kühleren Peripherien zurück. Wollen wir das Leiben und Geisten in ihren wesenhaften Bedingtheiten entstehen sehen, so war es nur wichtig, diesen ersten Punkt der Freiheit zu erfassen, das punctum saliens aller Substanzialisierungsmöglichkeit, in dem die Entität das qualifizierende Leben nicht mehr, von ihm „gehabt“, hinter sich, sondern es, seiner h a b h a f t , vor sich hat. Das eigene Wesen und Sein wird zur persönlichen „Habe“ – ohne das kein Leib, kein Geist.Was alles übrigens so unpersönlich und so sehr nur als passives Schicksal geschehend wie nur möglich gedacht werden kann. Doch ist diese „Habe“ ja vorerst noch eine bloß potenzielle, eine solche der Macht und der Herrschaft – wie gelangen wir von ihr zur reellen Leibhaftigkeit, zum leibhaften Ruhen in Fülle und Wesen? {142} P s i l . : Wenn ich an Früheres denke – dadurch, daß die Entität sich gestaltet und fixiert in der ihr habhaften Fülle. M o n t . : Mit dem Ausdruck fixiert müssen wir jetzt vorsichtig sein, um nicht nur das m a t e r i e l l e Leiben, sondern alles mögliche in unsere Bestimmung einzufangen. P s i l . : Immer schon hatte ich das Gefühl, daß Sie etwas Universelles, über die materielle Natur Hinausliegendes damit meinen. M o n t . : Ist nicht auch Gott ein leibhaftes Wesen? Er zuerst und vor allem?

Um den Menschen

249

P s i l . : Gott ist Geist – M o n t . : Also gibt es wohl ein spirituelles Leiben, Und ich vermute, daß wir von diesem aus erst das materielle, nicht umgekehrt, verstehen werden. P s i l . : Ein spirituelles Leiben, das dennoch im Gegensatz zum Geisten bleibt? M o n t . : Das diesen Gegensatz erst in seiner ganz reinen Bedeutung fassen läßt. Gerade darauf kommt es jetzt an. Nannten wir nicht vorhin das Geisten ein freies „Ausatmen“ des substanziellen Wesens? P s i l . : So wird wohl, wird mir jetzt klar, das Leiben mit einem Einatmen verglichen werden sollen. Was ich allerdings noch nicht eigentlich verstehe. M o n t . : Weshalb nannten wir das Geisten ein Ausatmen? Nicht deshalb, weil es ein freies sich Hinausgeben, ein sich Darbringen, Verschenken, Ausströmen ist? {143} P s i l . : Ja. M o n t . : Sollte also das Leiben nicht ein sich an sich Ziehen, sich selbst mit sich Umgeben oder „Beschenken“ sein? Ein sich des eigenen Wesens in seiner herausgesetzten Fülle nun wahrhaftig Bemächtigen? Man könnte auch sagen: ein sich mit sich selbst Beladen oder Belasten, wenn es nicht diese Ausdrücke schwerer machen würden, den allgemeinen spirituellen Sinn festzuhalten. P s i l . : Und hiermit zugleich erwächst die Gestalt? M o n t . : Muß sie nicht erwachsen? Ist nicht dieses an sich Ziehen, an sich Halten ein g l e i c h s a m sich Fixieren, in dem das qualifizierende Leben in seiner besonderen Artung sich unmittelbar ausprägen und manifestieren muß? Was verschieden aus sich lebt und west, nach der Bestimmtheit letzter Quall, leibt sich auch verschieden. P s i l . : Noch aber, Montanus, ist mir die Möglichkeit und Artung dieses „gleichsam“ sich Fixierens, das doch kein wirkliches sein soll, nicht recht deutlich. M o n t . : Vielleicht gibt es auch nichts, was für materielle Wesen wie uns schwerer eigentlich zu fassen ist. Und doch wiederum nichts, was für die Erkenntnis der Grundwesenheit alles substanziell geistigen, alles primären Seins, wichtiger zu erfassen ist. Ist es Ihnen nicht deutlich, daß es ein Fixieren geben kann, das doch gleichsam in der Schwebe bleibt? Ein sich in ewiger Aktualität immer neu Schöpfen, Setzen und Gestalten – {144} P s i l . : Als wir in unserem Gespräche über die Seele von der Wesenheit der Geister und Engel sprachen, haben wir gerade dies schon einmal berührt und zu fassen versucht. M o n t . : Nur daß uns damals noch der generelle Zusammenhang, daß uns alle Einsicht in das Wesen von Geist überhaupt fehlte. Wenn Geist im bedeutsamen Wortsinne „Wind“, „Hauch“ heißt, d. h. das von aller beschwerten und fixierten Faßlichkeit Freie, das frei Waltende und Wesende katexochen und wenn uns der objektive Geist dann eben als die frei ausgehauchte und dargebrachte Wesenheit entgegentrat, so mag jetzt heraustreten, daß der spirituelle Leib oder wenn Sie

250

Metaphysische Gespräche

lieber so wollen, die spirituelle Leibhaftigkeit die in freier und immer aktueller Wallung und Wesung besessene und geinnerte und in diesem Besitz und dieser Innerung gestaltete Fülle des eigenen Seins darstellt. P s i l . : Die geinnerte Fülle – M o n t . : Ja, im Gegensatz zur geäußerten des Geistes! Die geinnerte Fülle, in der sich das betreffende Wesen selbst in sich selbst „empfindlich“ wird, um wiederum einen Ausdruck Böhmes zu gebrauchen. P s i l . : Langsam begreife ich, daß trotz der spirituellen Artung dieses Leibens der Gegensatz zum Geisten und damit zu der erst eigentlich freien Setzung des Geistes an sich selbst voll bestehen bleibt. {145} M o n t . : Ohne daß etwa durch diese Spiritualität die Leibung zu einer weniger reellen oder substanziellen würde? P s i l . : Da ja in ihr gerade die größtmögliche schöpferische Lebendigkeit der Selbstgestaltung und Selbstauswirkung gesetzt ist. Ich habe vollkommen verstanden. M o n t . : Und daß nur dort, wo das Leiben fehlt oder unmöglich gemacht ist, die Entsubstanzialisierung und damit das leere „Vergeisten“ unmittelbare Konsequenz ist. P s i l . : Jetzt gehen mir viele Zusammenhänge auf und die Beantwortung mancher Fragen, die mich zu Anfang so sehr in Verwirrung setzten! M o n t . : Alle diese Konsequenzen werden wir jetzt ziehen. Aber zuerst: könnte es nicht auch im Gegensatz zu dem entsubstanzialisierten oder substanzlosen Vergeisten ein, wenn ich so sagen darf, übersubstanzialisiertes Verleiben geben? P s i l . : Wenn das Einatmen nicht durch das Ausatmen ergänzt wird? M o n t . : Sehr gut. Jetzt schießen uns die beiden Lebensbewegungen – die übrigens Goethe mit Intensität erfaßt und an immer anderen Naturphänomenen aufzuweisen versucht hat – in ihrer fundamentalen Ergänzungsnotwendigkeit für alle Ursubstanzialisierung zusammen. Muß nicht das bloße Sich-selbst-einfangen und Sich-innern ohne ein immer erneutes Sich-entselbsten, -hinausgeben und -ausatmen zur wirklichen Fixierung in sich selbst, zur Finsternis, Starre und zum Tod führen? {146} P s i l . : In dem sich die Entität sozusagen in sich selbst hineinfrißt? Und jetzt nicht wieder aus sich selbst herauskann – M o n t . : Ja. An Geist verliert, was sie an Materie gewinnt. P s i l . : Sie wollen, Montanus, die konkrete Materie auf diese Weise „entstehen“ lassen? M o n t . : Das weiß ich nicht. Und an dieses Problem wage ich mich jetzt nicht. Sprechen wir einstweilen ruhig von zwei Formen möglicher Substanzialisierung und Leibung: der einen, die wir soeben zu fassen suchten als der spirituellen durch und durch und der anderen, bei der die Leibung in fixierter Form geschehen ist, in

Um den Menschen

251

der die betreffende Entität sich nunmehr substanziell breitet und ruht, mit der sie aber auch beschwert, eingeengt und belastet ist und in ihrer Urlebendigkeit eine unübersteigliche Grenze findet. P s i l . : Doch auch diese konkret materiellen, stoffbelasteten Bildungen strömen ihren geistigen Atem aus? M o n t . : Müssen ihn ausströmen, solange sie noch primäre Lebensbewegung in sich haben, solange sie überhaupt noch „Natur“ sind. Denn noch einmal: was lebt, atmet. Was west und leibt, geistet. {147} P s i l . : Aber wir spüren und wissen nicht viel von diesem Geiste. So wenig, daß mancher uns seine Existenz ganz abstreiten wird. M o n t . : Aber der Einfluß selbst ist um so größer. Wir werden im Wortsinne getränkt und gespeist mit dem Geist der Dinge, die uns umgeben. Wenn auch – unsere Organe sind ja erstorben und der Geist der Dinge ist schwach geworden und wie erstickt! Aber, Psilander, unsere Fragen waren andere. Suchten wir nicht nach der Wesenheit der Geister? Den Geist haben wir uns jetzt ein wenig klar gemacht. Was aber sind Geister. Waren wir nicht auf einen Widerspruch gestoßen, der uns sehr beunruhigte. Vielleicht gelingt es uns jetzt eher, ihn zu lösen? P s i l . : Es schien uns, daß Gott das substanziellste aller substanziellen Wesen nur sein könne wegen seiner absoluten Geisthaftigkeit, daß dagegen Dämonen und Tote „Geister“ sind oder werden gerade wegen ihrer Substanzlosigkeit oder Entsubstanzialisierung. Doch vorhin schien mir die Lösung dieses Widerspruchs unmittelbar gegeben. Sie haben mir ja auf die Spur zur einer doppelten Form geistiger Wesen verholfen: der einen, die geistig leibt und daher eine höhere, freiere und lebendigere Substanzialität besitzt als die Wesen, die materiell leiben; und die zweite, die nur geisten kann, weil sie zum Leiben nicht zu gelangen vermag und die daher, mit den materiellen Wesenheiten verglichen, sich in Mangel und Elend befindet. {148} M o n t . : Ja, Psilander, in Mangel und Elend. Das sind gute Worte. Was könnte den trostlosen Zustand umhergeisternder und gespensternder Toten, armer Seelen, die aus dem Dasein leibhafter Fülle in die Untiefe ihres hungernden und verhungernden Lebens zurückgebannt sind, besser kennzeichnen als diese Worte? Auf die Dämonen passen solche Ausdrücke weniger. Weil der unbezwingliche Hungergeist wesenhaft zu ihrer Natur als Gestaltungen des qualifizierenden Urlebens gehört. Sie sind ja nichts anderes als eben das personifizierte Rasen nach Auswirkung und Gestaltung. Man kann nicht Dämonen an sich selbst „erlösen“ wollen! P s i l . : Nicht dasselbe also führt hier zum Mangel, dort zur Fülle. Sondern zur Fülle führt die spirituelle Leibung, zum Mangel das Fehlen jeglicher Leibung. M o n t . : So müssen wir, denke ich, Geister aus Mangel und Geister aus Fülle oder substanzielle Geister und Hungergeister unterscheiden?

252

Metaphysische Gespräche

P s i l . : Ja. M o n t . : Wie aber liegt es denn bei unseren Elementargeistern, mit denen wir doch schon einmal auf so vertrautem Fuß gestanden haben? P s i l . : Mit den, wie Sie mir zeigen wollten, seelenlosen Geschöpfen. M o n t . : Sollten wir nicht jetzt die Seele über dem Geist ein wenig aus dem Auge verloren haben? P s i l . : Ach, Montanus, Sie haben es erraten. {149} M o n t . : Und doch waren wir nie näher daran, beides mit einem Griff zu fassen. Fanden wir denn nicht, daß Geister und Engel deshalb keine Seele haben, weil sie nicht wie der Mensch aus einem eigenen Grunde urtümlich erwachsen? P s i l . : Vielleicht habe ich den Zusammenschluß jetzt dennoch. Wir könnten sagen: weil sie nicht in eigener Quall urständen? M o n t . : Wie dagegen jedes niedere Tier, wie Pflanze und Stein? P s i l . : Ich weiß wohl – ich weiß wohl – Sie führen mich hier nicht mehr irre. Damit diese Quall eine Seele wird, muß das betreffende Wesen auch wirklich aus ihr heraus als einer für sich gesetzten Mitte leben – wie es nur beim höheren Tier und dem Menschen der Fall ist! M o n t . : Sie durchaus Gescheiter. Aber beim Menschen werden wir dennoch darauf zurückkommen müssen. Doch, Psilander, da diese Elementargeister und diese Engel und was sonst immer doch auch leibhafte und wesenhafte Gestalten sein sollen, so müssen sie ja wohl auch aus irgendeiner Quall herausleben – müssen sie doch auch lebendig zu dem qualifiziert werden, was sie sind. P s i l . : Hierauf weiß ich nicht zu antworten. M o n t . : Sagten wir nicht, daß sie im Unterschied zum Menschen vom „Geist“ her substanziiert sind? {150} P s i l . : So sagten wir. Und damals war uns noch recht unklar, was dieser „Geist“ eigentlich sein könne und bedeute. Jetzt ist das ja, scheint mir, deutlich geworden. Wenigstens bei den Elementargeistern. Es ist doch wohl jener objektive, jener wesenhaft ausgeatmete Geist der Natur oder der Naturdinge, der in ihnen nun wiederum personifiziert und gestaltet erscheint? O, die Konsequenzen ziehen sich nunmehr wirklich von selbst. M o n t . : Wir nannten sie früher schon einmal „geistgeborene“ Geschöpfe. Dieser Ausdruck ist uns jetzt mit besonderem Sinn und Leben erfüllt. Denn wie Sie richtig sagen, jener objektive „Geist“ ist es in irgend einer spezifischen Gestaltung, der sie zu dem qualifiziert, was sie sind und was sie darstellen, was sie wesen und leiben. P s i l . : So wie es das qualifizierende Urleben selbst ist, das Tiere und Menschen und Pflanzen qualifiziert.

Um den Menschen

253

M o n t . : Und die Dämonen? Sie auch leben ja aus diesem Urleben heraus, sind nichts anderes als das personifizierte Urleben in seinen vielen möglichen Gestaltungen. P s i l . : Ja, auch die Dämonen. M o n t . : Mir scheint also, daß wir zwischen geistgeborenen Geistern und naturgeborenen Geistern unterscheiden müssen. P s i l . : Den Elementargeistern als den geistgeborenen, weil sie im „Geist“ urständen und den Dämonen als den naturgeborenen, weil sie in der Urnatur – kann man so sagen – urständen? {151} M o n t . : Ja, die letzteren also in einem primären Leben, die ersteren in einem sekundären? P s i l . : Weil kein objektiver Geist existieren kann, er sei denn an erster Stelle aus dem qualifizierenden Urleben heraufgeführt – ich verstehe. M o n t . : Waren nicht die Elementargeister eben deshalb seelenlose, weil sie im Geist urständen, nicht aber im Urleben, weil sie nicht von unten herauf, sondern von oben herunter erwachsen? P s i l . : Ja. M o n t . : Weil sie Geist leben, weben und sind, aus ihm sich gestalten, leiben und nähren, stehen sie wesenhaft, weil konstitutiv jenseits der Dimension des Dämonischen, des Urlebens, der Tiefe – P s i l . : Ja. M o n t . : Die Dämonen aber? Sie leben, weben und sind in eben diesem Urleben, in eben dieser Tiefe, die chaotisch und gestaltlos, wie sie ist, sie selbst zu einem echten leiben und wesen nicht kommen läßt. Und auch, Psilander, zu einem echten Geisten! P s i l . : Ja. M o n t . : Wenn also den geistgeborenen Geschöpfen die Seele fehlt, weil sie in sich selbst in die Tiefe nicht hinabreichen, so werden ja wohl umgekehrt die in der Tiefe ausschließlich wesenden Geschöpfe ganz eigentliche „Seelenwesen“ sein? {152} P s i l . : So ganz eigentlich – M o n t . : So ganz eigentlich möchten sie den Ausdruck „Seele“ hier nicht gebrauchen, sondern erst dort, wo sie zum Mittelpunkt eines wahrhaft gestalteten Wesens gemacht ist, das nun seinerseits aus ihr heraus ins offenbare Dasein hinein lebt und geistet? P s i l . : Ja – vielleicht ist es alles dies. M o n t . : Weil also der Dämon ganz und gar in die Tiefe und Untiefe herabgezogen bleibt? P s i l . : Das erinnert an jenes Ertrunkensein der Tiere in sich selbst, von dem wir sprachen. Und doch – hier ist ja ein wichtiger Unterschied, der vielleicht doch wieder beim Dämon eigentlicher von einer „Seele“ sprechen läßt als beim Tiere –

254

Metaphysische Gespräche

M o n t . : Weil das Tier wahrhaft leibt, der Dämon nicht? P s i l . : Nein, das ist umgekehrt der Grund, weshalb gerade beim Tier vom Besitz einer Seele besser zu sprechen ist. Nein – weil das Tier doch kein persönliches Wesen ist, der Dämon aber wohl. Und von einer eigentlichen Seele doch wohl erst bei einem persönlichen Wesen gesprochen werden kann. M o n t . : Und ein persönliches Wesen? Was ist das? P s i l . : Der Dämon, so wie wir ihn bisher sahen, ist es jedenfalls, das Tier nicht. {153} M o n t . : Also wollen wir uns vorläufig hierbei beruhigen, um jetzt nicht alle mühsam gesponnenen Fäden aus der Hand zu verlieren. Sie sagten eben, beim Tier könne man eher als beim Dämon vom Besitz einer Seele sprechen – und damit haben sie recht. Denn das Tier ist ja nun das Hinausgestaltete und -Geleibte, das die „Seele“ inner oder unter sich läßt, sie eben besitzt. Der Dämon aber ist ja nichts anderes als dieses nackte Leben – als solches zur Gestalt geworden. Deshalb nannte ich ihn ein „Seelenwesen“! Das pure „ Seelenhafte“ zur persönlichen Gestalt geworden. P s i l . : Jetzt fallen mir die, wie Sie sagen, entsubstanzialisierten Toten ein, die man „arme Seelen“ nennt. M o n t . : Sehr richtig, sehr richtig. Da haben Sie ebenfalls das Phänomen. Ja noch reiner. Weil es hier wirklich die „übrig gebliebene“ Seele ist, d. h. die zur persönlichen Wesenheit erhobene und dieser ihrer Formung nicht mehr entkleidbare, nun aber entsubstanzialisierte – entleibte und entgeistete – qualifizierende Lebensmitte an sich selbst. P s i l . : Und auch hier das Monadische, wie Sie es nannten. M o n t . : Ja, das Zurückgebanntsein in die eigene Tiefe und Untiefe. Das nicht mehr Heraus- und Heraufgelangenkönnen zu Wesenheit und Bestand, um so Erlösung zu erlangen von dem ununterbrochen jagenden und peinigenden Eigenleben. Nur daß den reinen Dämonen gegenüber hier das Gewaltige und Unbezwingliche des Urhaften fehlt. {154} P s i l . : Diese armen Seelen sind ja sozusagen schon ein wenig verbraucht. M o n t . : Das sollte man denken, mein Guter! Und dann dieses wichtige Moment, daß sie ja eigentlich nicht in die Tiefe g e h ö r e n wie die Dämonen, sondern in die Höhe, ans Licht. Doch, denke ich, können wir jetzt selber diesen Aufstieg wagen. Ist nicht, Psilander, alles Substanziierte, alles was in seinem eigenen Sein Bestand und Wesen gewann, damit eo ipso ein Manifestes? P s i l . : Ich verstehe noch nicht ganz. M o n t . : Denken Sie zuerst an die spirituelle Leibung als der eigentlich wesenhaften. Die Umwandlung des vorher nach Substanziierung hungernden und jagenden Lebens in die ausgewirkte und ausgebreitete Fülle stellt sich als ein unmittelbares Übergehen aus der Finsternis an das Licht des Tages dar.

Um den Menschen

255

P s i l . : Ich sehe es fast, aber doch nicht völlig. Am besten kann ich mir diese Untiefe, in der das chaotische Leben nach Wesen und Bestand hungert und es doch noch nicht hat, nach alten Höllenvorstellungen wie einen offenen Rachen vorstellen, der ja allerdings das Moment der Finsternis unmittelbar in sich schließt. {155} M o n t . : Aber das ist doch das einzig mögliche Bild! Daß dieses Urleben noch nicht ausgewirkt ist zu dem, was es ist – daß es in sich noch nicht Wesen und Bestand gewann, was heißt denn das anderes, als daß es eben noch nicht ist, was es ist, daß also „dort“ n i c h t s ist, wo es ist. Aber nicht das Nichts der absoluten Leere – diese wäre weder licht noch finster –, sondern das Nichts zurückgestauter Fülle, einer Fülle, die nur nicht herauskann, die sich im Stadium unentfalteter Potentialität befindet – das aber ist der „offene Rachen“, ist die mit ihrer Fülle schwangere Finsternis – P s i l . : Die ihre Fülle nicht ausspeien, nicht ans Licht bringen kann! Jetzt fasse ich es schon eher. Besonders die Nebeneinanderstellung der beiden möglichen Dimensionen des „Nichts“ half mir. Es war mir nicht klar gewesen, daß „Finsternis“ als solche notwendig ein positives Moment in sich enthält, daß die Abwesenheit allen und jeglichen Seins und Lebens niemals zu ihr führen kann, daß sie recht eigentlich, wie Sie sagten, das Reich der Potentialität ist. M o n t . : Und damit erst in einen wirklichen polaren Gegensatz zum Licht tritt. Oder besser zum Klaren, zum Manifesten, zum „Tag“. P s i l . : Nicht Finsternis und Licht, sondern Finsternis und Tageshelle setzen Sie einander gegenüber? M o n t . : Licht und Finsternis sind die äußersten Gegensätze. Licht ist schon ein Äußerstes an Positivität, ein Herausbrechen aus dem leibhaft Umschlossenen, eine Ekstase, ein Sich-ausströmen aus in sich gesetzter und mit sich erfüllter und als Basis bewahrter Leiblichkeit – P s i l . : Das erinnert an den objektiven Geist – {156} M o n t . : Wie sollte es denn nicht? Ist nicht Licht das unmittelbare Symbol für Geist? Wenn Gottes in ewiger Aktualität in sich selbst entfaltetes Sein im Geist sich ausgießt, dann ist die unfaßliche Lichtglorie seines Wesens gesetzt. Hier, an letzten Stellen, fällt Bild und Abgebildetes zusammen, wird die Sache zum Symbol und das Symbol zur Sache. P s i l . : Wird der Geist zum Licht und das Licht zum Geist. M o n t . : Ja. Denn Geist ist die freie, die von jeglicher Fixierung enthobene Manifestation des Wesens. Und auch Licht werden Sie letztlich nicht anders fassen können. P s i l . : Solange aber das Wesen sich allererst zu eigner Leiblichkeit in sich selbst entfaltet und auswirkt, ist noch nicht Licht, sondern die schlichte Klarheit gegeben? M o n t . : Ach, Psilander, ich begreife ja selbst erst im Sprechen. So ist es, so ist es, Sie Verständnisvoller. Leib ist das aus sich herausgetretene Wesen – auch hier also

256

Metaphysische Gespräche

primär im Sich-entfalten, Heraussetzen, Aus-sich-herausbrechen die Licht-Bewegung, die Überwindung verschließender Finsternis! Aber diese Bewegung ist eine „inne“-gehaltene, eine in sich selbst zur fixierenden Schwebung gebrachte – wie sollte sonst die „empfundene“ Leiblichkeit, die sich im Leibe findende und gestaltende Fülle zustandekommen. Und eben diese angehaltene Bewegung, diese angehaltene und zurückgebundene Lichtbewegung, ist gewiß die pure Klarheit, das einfachhin Manifeste. Solange sie nämlich, Psilander, wirklich eine lebendige, eine immer aktuelle Bewegung aus sich heraus, solange sie auch ein wahrhaftiges, wenn auch eingehaltenes „Atemholen“ bleibt! Der gleichsam „hingehauchte“ Leib ist die in durchsichtiger Klarheit aufgegangene Fülle. {157} P s i l . : Solange es sich also um spirituelle Leibung handelt? Ich dachte schon daran, daß wir vorhin die fixierende Vermaterialisierung der Leiblichkeit eine Verfinsterung nannten. Der Zusammenhang ist jetzt ganz klar. M o n t . : Ja. Aber – die aus der Übermaterialisierung erwachsende „Finsternis“ ist eine andere als die Finsternis der mit ihrer Fülle schwangeren Untiefe. Sie ist nicht die Finsternis, die Leben in sich birgt und es nur „verschließt“, sondern die Finsternis der Starre, des Todes. Und eigentlich: die mit sich selbst durch und durch beschwerte und belastete Materie, wird sie nicht in diesem einen Punkte eher dem absolut Leeren verwandt? P s i l . : Weder licht noch finster zu sein? Es ist ja richtig, man kommt dann in keine Tiefe mehr, in der Finsternis eigentlich „Platz“ hätte. M o n t . : Wie ist es nun aber, Freund, mit dem „Geist“ der Natur oder der Naturdinge – sollen wir ihn auch wie den Geist Gottes als Lichtglorie bezeichnen, der sich aus der Natur ergießt und sie in ihrem substanziellen Wesen offenbart, kündet und verherrlicht? {158} P s i l . : Für den, der Augen hätte ihn zu erleben und zu schauen? M o n t . : Ja, für den, der geistige Augen hätte. Prinzipiell wäre es doch dasselbe wie bei der Schauung Gottes in der ihn verherrlichenden Lichtglorie, die nichts anderes ist als der von ihm ausgeatmete Geist. Nur daß allerdings der in der Gottheit selbst substanziierende Geist notwendig die höchstmögliche Seinsform besitzen muß – die p e r s ö n l i c h e nämlich.Während hiervon natürlich bei der selbst schon unpersönlichen Natur gar keine Rede sein kann. P s i l . : Aber auch sonst würde doch gewiß ein qualitativer Unterschied bestehen. M o n t . : Wer das eine mit der geöffneten Kraft seiner Augen gerade noch zu sehen vermöchte, würde von dem anderen völlig geblendet werden? P s i l . : Ja. M o n t . : Der Geist der Natur müßte also wohl fast ein dämmeriger genannt werden gegenüber dem Geist Gottes.

Um den Menschen

257

P s i l . : Vorhin schon sprachen wir davon, daß der Geist der vermaterialisierten Natur wie lau und lahm geworden sei. M o n t . : Das ist aber schon ein zweites. Selbst dann, wenn die Natur in die ihr mögliche Lebendigkeit zurückgeführt würde, wenn sie in ihrer wahren Substanzialität wiederum erschlossen und so v e r k l ä r t würde, müßte doch dieser unendliche Qualitätsunterschied bestehen bleiben! {159} P s i l . : Weil die Natur immer das Gebundenere, Fixiertere ist und bleibt? M o n t . : Es ist ja doch ihr Wesen, die Fülle des Urlebens in einer Unendlichkeit einzelner, für sich gesetzter, zerstreuter Gestalten zu verleiblichen, es in diese substanziell hineinzubinden. Muß nicht das Einzelne, das Zerstreute, das Auseinandergebundene, wenn ich so sagen darf, anders sich im Geist manifestieren als das Wesen, das alles in Eins und in absoluter Aktualität in sich enthält? P s i l . : Montanus – die Farben! Die Natur in ihren Gestaltungen muß sich farbig offenbaren. Ich weiß nicht, woher ich die Gewißheit habe. Es ist wie eine Intuition. M o n t . : Eine Intuition. Aber jetzt halten wir ein. Denn nun würden wir uns in eine Philosophie des Lichts und der Farben verlieren. Es kam mir eigentlich nur auf die Einsicht an, daß die Geister, die aus dem Geist der Natur geboren werden, ein anderes Wesen und Aussehen haben müssen als die Geister, die in dem Geist Gottes urständen. Denn wie der qualifizierende Geist, so das Qualifizierte. P s i l . : Geister, die im Geist Gottes urständen? Engel? {160} M o n t . : Ja. Denn jetzt sind wir endlich zu ihnen gekommen, die solange hoch über uns schwebten. Und der polare Gegensatz zwischen Dämonischem und Englischem wird uns nun in seiner ganzen Radikalität aufleuchten. Wir unterschieden bisher H u n g e r g e i s t e r oder Geister aus Mangel und s u b s t a n z i e l l e G e i s t e r, unterschieden andererseits geistgeborene Geister und naturgeborene Geister. In diesem zweiten Gegensatzpaar gehören Dämonen auf die eine Seite, Elementargeister und Engel auf die andere. Aber wenn wir nun den Ausdruck „von oben her qualifiziert“ im prägnanten Sinne nehmen, so würden doch die Engel wieder ihre besondere Stelle erhalten. P s i l . : Die Elementargeister gehören sozusagen einem Reiche der Mitte an – zwischen Untiefe und Höhe. Aber, Montanus, weshalb sprechen Sie immer nur von diesen und von den Engeln? Sind es die einzigen substanziellen Geister, die man wesenhaft absondern kann? M o n t . : Soviel Substanzielles, soviel Atmendes; soviel Atmendes, soviel Geist; soviel Geist, soviel mögliche Geister. Hier gibt es keine Begrenzung. Daß wir aber jene herausheben, liegt an der Möglichkeit, an ihnen besonders viel Typisches und Wesenhaftes einzusehen. Einem Reiche der Mitte, sagen Sie, gehören die Elementargeister an, sofern eben die Natur selbst ein Reich der Mitte darstellt? P s i l . : Ja, so dachte ich.

258

Metaphysische Gespräche

{161} M o n t . : Und hier aus dem aufsteigenden Geist der von unten her substanziierten Natur lösen sich auch diese Geister heraus und kommen aus dem Bann dieser farbigen und dämmerhaften Atmosphäre nicht heraus? P s i l . : Diese Fassung führt unmittelbar Wald und See, Berg und Wiese herauf. M o n t . : Es sind substanzielle Geister, insofern die Dimension, in deren Geist sie urständen, die Natur, eine selbstausgewirkte und leibhafte ist. Aber, nicht wahr, die Natur hat ja die ganze Unruhe des sich Gestaltens und Leibens noch in sich – sie ist nie fertig, ruht nie im ein für allemal entfalteten Bestände ihres Wesens? P s i l . : Sagten wir nicht, daß es zum Wesen alles Lebendigen gehöre, sich immer neu aus sich selbst zu schöpfen und zu gestalten? M o n t . : Sodaß also auch Gott diese ewige Unruhe in sich selber hätte? P s i l . : Die Unruhe des Lebens selber – M o n t . : Aber ist denn nicht Gott gerade der von Ewigkeit zu Ewigkeit restlos in sich Substanziierte? Wo kann da die Unruhe eines erst „Werdens“ ihre Stelle finden? P s i l . : Verwechsele ich zwei Sachen? Es scheint fast so. Die ewige Aktualität des sich Gestaltens, vereint sie sich mit der Ruhe des vollkommen Gestalteten? {162} M o n t . : Besser lassen sich jetzt die beiden entscheidenden Punkte nicht ausdrücken. Das ewige Atmen des in absoluter Lebendigkeit in sich Ruhenden – und diese immanente Bewegung zeigt doch eben nur, soweit sie reicht, das Leben, die Unfixiertheit, die Geistigkeit des Seins an – ist etwas radikal anderes als die Notwendigkeit einer immer neuen Erhebung aus unentfaltetem Grund zum entfalteten Dasein! P s i l . : Aber auch der Urzeuger, schienen Sie anzudeuten, steigt auf aus dem Grunde des Urlebens – M o n t . : Ist der von Ewigkeit zu Ewigkeit Aufgestiegene – P s i l . : Die beiden Gegensatzpaare sind also: Starre oder Fixiertheit der Gestaltung und Lebendigkeit einerseits, Übergang aus Potentialität in Aktualität und pure Aktualität andererseits. M o n t . : Sehr richtig. Die Natur aber i s t ja die Dimension des Übergangs aus der Potenz in die Aktualität.Wir würden ihr Eigentümlichstes nehmen, wenn wir sie nicht in ihren unerschöpflichen Gestaltungen immer neu aus dem dunklen Grunde bloßer Potentialität zur entfalteten Aktualität des Seins aufsteigen ließen. P s i l . : Auch die „erlöste“ oder „verklärte“ Natur? M o n t . : Die aus der Starre, der Vermaterialisierung, der Entgeistung befreite! Ich denke, ja. Hier gerade sehen wir, wie wenig diese beiden Dinge miteinander zu tun haben. Dieser dunkle, verbergende Grund, aus dem die Naturgestalten erwachsen und der sie wieder in sich zurücknimmt und zurückbirgt – e r ist das spezifisch I r d i s c h e , das unaufhebbar Reizvolle aller Natur. {163} P s i l . : Es ist merkwürdig – als Sie vorhin von der verklärten Natur sprachen, überkam mich das Gefühl möglicher Sehnsucht nach der dunklen,

Um den Menschen

259

schweren, irdischen Natur, Sehnsucht nach dem bergenden Schoße fruchtbarer Erde, aus dem alles hervorkommt. Jetzt sehe ich, befreit, daß wir dergleichen nicht zu fürchten brauchen. Sie lächeln. M o n t . : Daß der„Himmel“ nicht nimmt, sondern gibt. Der in falsch orientierter Spiritualisierung anscheinend entleerende, verflüchtigende und lebentötende hat schon manchem Angst gemacht. – So werden also wohl auch die Geister, die aus dem Geist dieser irdischen Natur qualifiziert sind, an ihrer Unruhe und der Vergänglichkeit aller ihrer Gestaltungen teilnehmen? P s i l . : Und auch, Montanus, wie es mir scheint, an dem dunklen Lebensgrunde, aus dem sie, sich selbst nicht verstehbar, hervorwachsen. M o n t . : Aber sie sind und bleiben geistgeborene Geister. Es würde ihr Bild wesentlich verfälschen, wenn wir die abgründig aus sich treibende und quellende Potentialität dieses Urgrundes in sie selbst hineinverlegen wollten – P s i l . : Dann würden sie zu „seelenhaften“ Geschöpfen? M o n t . : Ja, mein Psilander. So aber sind und weben sie nur in und aus dem Geist der schon aktualisierten und ausgewirkten Natur. Aber dennoch hatten Sie recht, und haben das Entscheidende herausgefühlt. Es liegt etwas Dunkles über ihnen und um sie. Sie sind sich selbst nicht verstehbar, weder in ihrem Kommen, noch in ihrem Gehen. Die Natur, in deren Geist sie qualifizieren, schließt sich mit der Verhülltheit und Undurchdringlichkeit ihres nur immer und überall hervorgehenden, nie in erfüllter Aktualität restlos „aufgegangenen“ Seins um sie zusammen. Die Engel aber, Psilander, stehen vor uns in der strahlenden Gewißheit ihrer selbst! {164} P s i l . : O, – das war ein Sprung und ein plötzliches Aufgehen von längst Erwartetem. M o n t . : Jetzt ist die Polarität zum Reiche der Tiefe deutlich geworden. Sie verstehen es jetzt, wenn man hier den Ausdruck „Reich des Geistes“ braucht. Obwohl doch die Dämonen „auch Geister“ sind – P s i l . : Weil jetzt erst die vollkommene, die ewig aktuelle, die restlos lebendige Substanzialität erreicht ist – M o n t . : Die eo ipso eine geistige ist. Jetzt sehen wir die Dämonen vor uns als die „gestalteten“ und personifizierten „Abgründe“ in sich selbst, in denen das Leben unheimlich, weil noch unter der Decke allen Daseins treibt und quillt – monadisch in diese ihre eigene leere und doch von jagender Unruhe erfüllte Untiefe versenkt – hungernd aus ihr nach Dasein, Entfaltung, Fülle und Licht – machtvoll nur durch die Unbezwinglichkeit dieses sie besitzenden Urlebens, das sich einer jeden Daseinsstelle, die ihr„Raum“ gibt, bemächtigen muß – machtvoll und wirksam also nur durch ein persönlichstes und, mag es auch in einschmeichelnder und flehender Form geschehen, eo ipso brutales B e s i t z e r g r e i f e n – die geschwängerten, die ganz und gar potentiellen, sich selbst fremden und in sich selbst unfreien – hei-

260

Metaphysische Gespräche

schende, begehrende, gestaltungssüchtige Mächte, unentbehrlich in der herrischen Kraft ihres Urlebens, furchtbar in der vernunftlosen Unfreiheit ihres besessenen Willens. Und die englischen Geister? {165} P s i l . : „In der strahlenden Gewißheit ihrer selbst“ – M o n t . : Gestaltet und genährt von einem Geist und erfüllt von ihm, in dem alles Urleben in glorreicher Fülle, Selbstheit und Wesenhaftigkeit aufgegangen ist, nichts Dunkles, nichts Unerlöstes, nichts Unausgewirktes hinter ihnen, aus sich selbst herausgestellt und erwachsen zu vollkommener Gestalt, bar alles Unruhe heischenden Lebens, freie Besitzer und Verwalter ihres ganz und gar manifesten und gestaltsmäßig befriedeten Seins, in eigener Fülle stehend, aus sich herausgewendet, ewig bereit zu Dienst und Hingabe mit süßer Sachlichkeit und beschwingtem Ernst – P s i l . : Dies letzte jetzt, Montanus, sagt so viel, ist aber plötzlich unphilosophisch gefaßt – M o n t . : Unphilosophisch, weil dem dunklen Gefühl überlassend, weil unexpliziert? Sachlichkeit ist Hingabe. Aber süße Sachlichkeit? Ist hier nicht ein letztes lächelndes sich Bewahren? Kein subjektives sich Bewahren, das restloser Hingabe entgegensteht. Sondern ein stilles Stehenbleiben in eigener Umfriedung – Und der beschwingte Ernst? Auch Ähnliches. Nicht von den Dingen herabgezogen zu sein, sondern sie zu t r a g e n – wissend um letzte, allerletzte Unbedeutendheit und Unwesentlichkeit gegenüber dem Einen – Sprechen wir nicht mehr von Engeln.Wer will ihre Süße und Majestät mit Worten verdunkeln und beschweren? {166} P s i l . : Aber wie ist aus dieser Sphäre und diesem Sein so etwas wie ein „Fall“ und „Abfall“ auch nur der Idee nach möglich? Jetzt verstehe ich es wiederum gar nicht mehr. M o n t . : Ich auch nicht. Aber wir wollen nicht aufhören, hierüber nachzudenken. Auch den Menschen können wir uns ja nicht erobern, ohne ein wenig hierüber zu wissen. Aber vielleicht sind wir weit genug, um doch gewisses Wesentliches an ihm aufzudecken und aufzubauen. Übrigens, was Luzifer betrifft, so vergessen Sie nicht, daß er niemals mit einem Dämon verwechselt werden darf. Er kommt von oben und nicht von unten. Aus dem Reiche des Geistes und nicht aus dem der Urnatur. Vielleicht war es gerade sein Begehren, sich wie Gott in diesen letzten Urgründen selbtherrlich zu substanziieren. Das einzige, was ihm versagt war und in alle Ewigkeit versagt bleiben mußte.

Um den Menschen

261

3. Evolution – Der Mensch. {167} M o n t . : Haben wir uns jetzt genug mit Tieren und Pflanzen und Steinen, mit Dämonen, Engeln und sonstigen Geistern herumgetrieben, um uns nun auch an den Menschen heranzuwagen? P s i l . : In all den Kreisen, die wir um ihn herumzogen, war ja der Blick doch letztlich auf ihn gerichtet. Ich habe es stets gefühlt. M o n t . : Dem Tiere gegenüber war uns der Mensch der Aufgerichtete, der Nackte? P s i l . : Aber diese Bestimmungen harrten eigentlich noch der näheren Erläuterung. M o n t . : Wir hatten aber ein zweites Bild, das vielleicht schon etwas mehr besagte. Das Tier ist das in sich ertrunkene, der Mensch das aus sich auferstandene Wesen. Auf der Suche nach dem „Element“, das dem Tiere noch über dem Kopfe zusammenschlägt, aus dem der Mensch aber errettet erscheint, gerieten wir ja ursprünglich so weit seitwärts. P s i l . : Als wir die Quall fanden, aus der heraus ein jedes Naturwesen leibt, west und geistet. M o n t . : I h r also ist das Tier noch ganz und gar ausgeliefert, der Mensch aber entstiegen? P s i l . : So scheint es, ja. M o n t . : Was aber heißt nun dieses Entstiegensein? Wie können wir es näher charakterisieren? {168} P s i l . : Charakterisierten wir es nicht schon, als wir vom Dämon sprachen? M o n t . : Der, besessen von dem ihn jagenden Leben, sich nicht in ihm zu gestalten und es leibhaft zu besitzen vermag? P s i l . : Ja, auch er kann nicht herauf und heraus aus seiner eigenen Untiefe. M o n t . : Wohl aber der Stein, die Pflanze, das Tier? P s i l . : Sie sind leibhaft, was sie sind – es ist richtig – M o n t . : Heraus- und heraufgehoben aus bloßer Potenz zur erfüllten Aktualität ihres Wesens? P s i l . : Ja – M o n t . : So muß also doch die Ersunkenheit der Tiere in sich und die der Dämonen eine verschiedene sein, da ja doch die Tiere ihres Wesens ebenso habhaft sind wie alle leibhaften Naturentitäten. P s i l . : Gewiß –, da steckt irgendeine Äquivokation. Und doch – es ist da etwas Gemeinsames, was bei Stein und Pflanze fehlt. M o n t . : Daß das Tier etwas „Dämonisches“ hat, sahen wir ja längst.

262

Metaphysische Gespräche

P s i l . : Als wenn das Tier seiner doch wiederum nicht so habhaft wäre wie Stein und Pflanze. M o n t . : Obwohl es doch höher steht auf der Stufenleiter der Naturentitäten. P s i l . : Das gerade setzt mich momentan etwas in Verwirrung. {169} M o n t . : Können wir denn nicht sagen, Psilander, daß der pure Stoff, das Gold z. B. oder das Wasser, in ein leibhaftes Wesen gesetzt ist, seiner Fülle also wahrhaftig habhaft ist, o h n e sie doch zu besitzen? P s i l . : Aber dieses galt uns doch eben als „Besitz“ des Wesens im Unterschied zum bloßen Besessensein des Dämon. M o n t . : Gut. Doch ist es nicht – beim Gold und beim Wasser – ein gleichsam unbesessener Besitz? Eine Habe, die doch der pure Stoff nicht eigentlich h a t ? P s i l . : Weil er tot ist? M o n t . : Nein – mag er tot oder lebendig sein, darüber sprechen wir jetzt nicht. Aber der Stein bleibt sich in seinem eigenen ausgewirkten oder leibhaften Wesen selber fremd. P s i l . : Ich verstehe – wir sind bei dem, was wir längst sahen, was uns schon für den Wesensunterschied von Pflanze und Tier ausschlaggebend erschien. Das Tier besitzt sich, ist Herr über sich und kann infolgedessen selbsteigene Aktionen ausführen, die Pflanze nicht. Und der pure Stoff erst recht nicht. M o n t . : Erst recht? P s i l . : Er ist seiner noch weniger habhaft als die Pflanze. M o n t . : Es dürfte vielleicht hierin kein Unterschied zwischen Stein und Pflanze bestehen. Beide sind sich selber schlechthin aufgeladen. Beide sind was sie sind, ohne doch zu „haben“ was sie sind. Obzwar sie beide in der Fülle ihres Wesens ruhen. {170} P s i l . : Früher sagten Sie, wenn ich mich recht erinnere, daß in der Pflanze die substanziierende Quall eine persönliche oder selbsteigene, eine aktuelle Stätte gefunden hat, während sie in den puren Stoff nur der Potenz nach hineinwirkt – M o n t . : Und zugleich, daß zwar in der Pflanze die Quall eine persönliche Stätte hat, aber nicht hinwiederum die Pflanze in ihrer Quall – während eben beim Tier jener eigentümliche Durchbruch geschehen ist, der es in die eigene Tiefe seines qualifizierenden Lebens „hinabsinken“ läßt und aus ihr heraus leben, erleben und agieren. P s i l . : Sein eigenes Sein ist wie eine offene Wunde in ihm – M o n t . : Wenn ich das gesagt hätte, so hätte ich gefürchtet, Sie würden mich nicht verstehen. Und nun sagen Sie es so einfach selbst. P s i l . : Ich könnte auch kaum genauer angeben, was ich eigentlich damit gemeint habe und meine.

Um den Menschen

263

M o n t . : Wo die Seele frei wird, ist das Wesen zum Ungrund seiner selbst hin offen, nicht mehr geschlossen, nicht mehr gesichert vor sich selbst – sollte man das nicht eine Wunde fast nennen können. P s i l . : Mir ist jedenfalls jetzt klar geworden, daß an diesem Durchbruch, wie Sie es nennen, dieses beides hängt: daß einerseits das Tier Herr über seinen Leib zu sein vermag und damit das formale Wesen der Pflanze weit überflügelt, daß aber gerade damit auch dieses eigentümliche Faktum des Ersunkenseins in sich zusammenhängt. {171} M o n t . : Mit diesem Hineinsinken in sich oder in die eigene Untiefe wird das Tier frei von seinem Leibe, in den es wie die Pflanze leibhaft hinausgewirkt ist? P s i l . : Ja. M o n t . : Und damit eben Herr über denselben? P s i l . : Und doch besitzt es ihn noch – M o n t . : Diese seinsmäßige Freiheit ist keine Abtrennung! Das eben gilt es zu sehen und zu begreifen, daß das in seiner Habe, d. h. in der ausgewirkten Fülle seines Seins ruhende und sie durchwohnende Wesen noch einmal gleichsam in sich zurückgehen kann, ohne etwa damit sich selbst zu verlieren und nun von diesem geinnerten Punkte seiner selbst aus – hier eben vermag jener Durchbruch zu geschehen! – sich selbst beherrschen kann. Aber Sie verstehen, das ist als wesensmäßige Konstitution gemeint, nicht als Aktion oder Genese. P s i l . : Doch, ich verstehe und habe sie im Grunde längst verstanden: diese Habe, die nun auch gehabt wird und die eben gehabt werden kann, weil das betreffende Wesen nicht schlechthin von ihr gehabt wird. M o n t . : Vorzüglich. Aber beim Tier, nicht wahr, erstreckt sich dieses Haben der Habe nur auf die Leibesdimension? {172} P s i l . : Ja. Und Sie werden wahrscheinlich den Menschen vom Tier durch den Hinweis wesensmäßig abtrennen wollen, daß seine Habe prinzipiell weiter reicht. M o n t . : Und wohin reicht sie denn also? P s i l . : Wir haben die Linie eigentlich schon gezogen und oft angedeutet. So wie das Tier in seinem Leibe geinnert ist und also Herr über denselben, so ist der Mensch in seiner „Seele“ geinnert und frei von ihr und Herr über dieselbe – M o n t . : Sollte es wenigstens sein, könnte es sein – P s i l . : Ja, ja. Und dadurch besitzt er Selbstbewußtsein, Verstand, Sprache, Geist. M o n t . : Halt, halt – jetzt schlagen die Wogen über uns zusammen und aus Erkenntnis wird Wirrsal. Selbstbewußtsein, Sprache, Vernunft, Geist – P s i l . : Ich bin sehr kleinlaut. M o n t . : Hier liegen in der Tat Fußangeln. Wie ist es denn mit dem Dämon? Wenn es Sie nicht sehr verstimmt, daß wir – endlich beim Menschen angelangt, wie es schien – wieder von diesen mystischen Unwesen beginnen: ob nicht auch sie eine

264

Metaphysische Gespräche

Sprache haben, ob sie sich nicht im Drohen, Drängen und Befehlen, im Bitten und Schmeicheln, im leidenschaftlichen Rasen persönlich ausdrücken könnten. P s i l . : Allerdings – M o n t . : Sie selbst haben es schon einmal so fixiert und deuteten dabei darauf hin, daß es sich hier schon um Personen oder dergleichen handele. {173} P s i l . : Und da schon warnten Sie mich – M o n t . : Sollten Dämonen wirklich Personen sein? P s i l . : Wenn ich den Menschen dagegen stelle, so scheint hier allerdings ein erheblicher Unterschied deutlich zu werden. M o n t . : Oder auch, wenn Sie an einen Engel denken? P s i l . : Auch beim Engel das Moment des Aufrechten – das ist es ja eben, daß dieses den Dämonen ebenso zu fehlen scheint wie den Tieren und daß es bei beiden mit dem zusammenhängt, was wir ihre „Ersunkenheit“ in sich selbst nannten. M o n t . : Die also der Möglichkeit einer Art Verstandes oder wie man es nennen soll, nicht entgegensteht? P s i l . : Aber doch bei den Tieren. Das gerade bringt mich in Verwirrung. Immer glaubte ich, wenn überhaupt, so läge hier eine absolute Grenze. M o n t . : Wäre es nicht möglich, daß auch ein Tier, ein Löwe oder ein Wolf, zu sprechen begänne? P s i l . : Ich verstehe nicht – M o n t . : Ich meine nicht das faktische Tier, so wie es ist. – Es ist stumm, ist vielleicht stumm geworden – ich weiß es nicht. Ist es wesenhaft unmöglich, sich ein sprechendes Tier zu denken? Würde das Tier hiermit aufhören, Tier zu sein? P s i l . : Dichter und Märchen sprechen von Sonntagskindern, die „die Stimmen des Waldes“ vernehmen – M o n t . : Des Waldes – also auch der Bäume, der Pflanzen? {174} P s i l . : Es scheint. Und nun, Montanus, werden auch gleich die Steine reden. M o n t . : Und wenn, dann sicher Gescheiteres als wir. Doch was meinen jene mit den Stimmen des Waldes, die dem Helden kund werden? P s i l . : Es ist ein Bild für die tiefere Erkenntnis vom Wesen der Dinge und der Natur, die jener haben mag. M o n t . : Aber ein sehr konkretes Bild. Das die Form, in der diese tiefere Erkenntnis zuwächst, in ganz bestimmtem Sinne festlegt. Daß nämlich die Dinge ihr Wesen im „Wort“ aussprechen und dieses Wort von dem Weisen vernommen wird. So möchte ich es ausdrücken. P s i l . : So gewendet erinnert es an das, was Sie über den objektiven Geist sagten. M o n t . : Und müssen denn nicht Geist und Wort nahe zusammenhängen? Sie sahen es ja schon vorhin – nur daß Sie beider Möglichkeit erst beim Menschen beginnen ließen. Jetzt aber, da uns wieder einfällt, daß ein jedes naturlebendige

Um den Menschen

265

Ding so etwas wie „Geist“ haben mag, kommt es uns vielleicht nicht mehr so absurd vor, auch von der Möglichkeit – der Möglichkeit, Psilander, nicht mehr! – eines faktischen sich Aussprechens zu reden. P s i l . : Aber es ist nicht etwa dasselbe, sich im frei verströmenden und das Wesen frei ausatmenden Geist zu manifestieren oder sich im Wort auszusprechen? M o n t . : Nichts Verschiedeneres könnte es geben. {175} P s i l . : Und doch hängt beides engstens zusammen –? M o n t . : Was lebendig atmet, hat Geist. Nur was lebendig atmet und also Geist hat, kann sich auch im Wort aussprechen. P s i l . : Nichts Verschiedeneres – also um einen Gegensatz in der Manifestationsweise handelt es sich? M o n t . : Um einen Gegensatz, den wir längst kennen. Zwischen Leiben und Geisten. P s i l . : Der Leib? Er ist doch nicht das Wort? M o n t . : Nein. Er ist nicht das Wort im eigentlichen, selbständigen Sinn. Und doch – um nur erst einmal an die Wortbedeutung dessen was „Wort“ ist heranzukommen – kann man nicht zum Beispiel den Leib der Pflanze das „Wort“ nennen, in dem sie ihr Wesen zusammengefaßt, geformt und fixiert niederlegt und ausspricht? P s i l . : Allerdings ein mögliches Bild. Aber wie komme ich von hier zum wirklichen Wort? Ich meine, daß man da doch die Dimension des Leibes verlassen und in die des Geistes aufsteigen muß. M o n t . : Gut. Aber könnte es nicht in der Dimension des Geistes nun wiederum so etwas wie ein Leiben geben? P s i l . : Von einem spirituellen Leiben sprachen wir schon. M o n t . : Aber doch auch nur in dem primären Sinne des sich erst einmal für sich und in sich selbst Gestaltens, Innerns und Setzens. Das ist der wirkliche „Leib“, das „Wort“ auf erster Stufe, wie man es nennen kann. {176} P s i l . : Im Anfang war das Wort und das Wort war bei Gott – die ganze Zeit schon schwebt es mir auf den Lippen. M o n t . : Wieder das brennende Zentrum. Ja, ist denn dieses „Wort“, der Sohn Gottes, nicht das zusammengefaßte, verinnerlichte, verleiblichte Wesen des Urzeugers? P s i l . : Das wiederum eine Person sein soll? M o n t . : O Psilander, an dieser Stelle des Urgeistes sind immer nur die höchsten Gestaltungsformen möglich. Schon beim Geist war daran zu erinnern. Doch lassen wir das jetzt. P s i l . : Also von einem Wort auf zweiter Stufe muß man reden, wenn man an das wirkliche Wort, das Wort im engeren Sinne herankommen will? M o n t . : Wenigstens versuchen kann man es.

266

Metaphysische Gespräche

P s i l . : Von einem Leiben auf zweiter Stufe, wenn ich recht verstehe? Einem Leiben im Geist? M o n t . : Wenn die reell geleibte Entität sich im Geist ausatmet und dieses Ausgeatmete sich selbst und als solches innehält, formt und fixiert – vielleicht ist hier der Geburtsort des Wortes? P s i l . : Sie wenden es so, als spräche jeder nur sein Wesen aus – M o n t . : Und ich glaube auch, daß hierin der letzte Grund und Sinn des Sprechens und des Wortes liegt. Auch beim Menschen. Das werden wir, denke ich, noch sehen. Aber zunächst: daß eine Blume etwa, wenn sie sprechen könnte, nur von sich selbst spräche – das ist sofort einleuchtend? {177} P s i l . : Weil sie keine Erkenntnis von anderem hat? M o n t . : Hat sie überhaupt Erkenntnis? Könnte sie Erkenntnis haben? P s i l . : In einer unserer allerersten Unterredungen bezeichneten Sie es als sentimentale, unsachliche Auffassung, der Pflanze irgend etwas dergleichen einzulegen. Ich habe es nicht vergessen. M o n t . : Also z. B. Empfindung? P s i l . : Ja, gerade Empfindung. M o n t . : Und da erst recht wohl Erkenntnis? P s i l . : Ich denke wenigstens. M o n t . : Denn wenn sie sich selber nicht einmal in der Empfindung hat, wie soll sie sich selber und anderes in der Erkenntnis haben. Sie ist ja ein radikal unpersönliches Wesen. Ihr Wesen ist ausgeschöpft in und mit der lebendigen Gestaltung ihrer selbst. P s i l . : Aber von einem Geist und von einem möglichen sich Aussprechen derselben zu reden, halten Sie nicht für unsachliche Auffassung? M o n t . : Wenn man dieses beides selbst sachlich nimmt, nicht. Und das kann man. Ja man muß es um an die letzte Wesenswurzel dieser Dinge zu gelangen. So wie sich das lebendige Wesen unpersönlich im Geist veratmen, frei darbieten und manifestieren kann, so könnte es sich auch unpersönlich im gefaßten und fixierten Geisteswort aussprechen. {178} P s i l . : Das aus der Pflanze hervorginge oder -tönte, ohne daß sie es selber weiß – M o n t . : Und wichtiger: ohne daß sie es selber formte oder setzte! Daher sagen Sie richtig: es würde a u s ihr hervorgehen oder -tönen. Tönen nämlich, wenn es nicht nur ein Geistwort wäre, sondern in einem materiellen Kleid erschiene. P s i l . : Ich verstehe jetzt, daß die Pflanze nur von ihrem eigenen Wesen sprechen, nur dieses im Wort verlautbaren könnte. Wenigstens solange man sie eben sachlich-wesenhaft auffaßt. M o n t . : Denn was soll sich anderes aus ihr heraus formen als sie selbst! P s i l . : Ja.

Um den Menschen

267

M o n t . : Und verstehen Sie auch, daß letztlich ein einziges Wort genügen müßte, um ihr Wesen also im Geist fixierend zu offenbaren? P s i l . : Ein einziges Wort? M o n t . : Der „Name“, in den sie eingesiegelt ist, der Logos ihres Seins. P s i l . : Die Idee, nach der sie geformt ist? M o n t . : Ja, vielleicht können Sie auch so sagen. {179} P s i l . : Jetzt aber, Montanus, fährt mir alles durcheinander. Jetzt sprechen wir von einer Idee, nach der eine Pflanzenart geformt ist, von einem einzigen Namen, in den ihr Wesen gleichsam hineingesetzt ist – und früher? – Lehnten Sie nicht die „apriorischen Gestaltseinheiten“ als Scholastizismus ab? Sagten Sie nicht, daß da das rein Naturhafte, das dunkle Drängen und Suchen, der Zufall in der Gestaltung, die auf- und absteigenden Reihen des mehr oder weniger Geglückten und Vollendeten zu kurz kämen? So habe ich es wenigstens verstanden. M o n t . : Und Sie haben es gut verstanden. Ach, Psilander, hier stehen wir an einem der allerschwierigsten Punkte, an dem wir uns wohl mit unserem reflektiven Verstande vergeblich die Zähne ausbeißen würden. Mit dem die letzten Gegensätze fast aller großen Philosophien irgendwo zusammenhängen. Natürlich gibt es eine Synthese. Aber nur der Visionäre mag sie einmal in glücklichen Augenblicken erschauen. Wir können nur suchen, tasten, nach allen Seiten die Augen offen halten. Es ist so, wie Sie sagten: der hat Natur noch nicht begriffen, der nicht in aller Gestaltung das blinde Drängen aus urhafter Tiefe, den nackten Hunger nach Gestaltung und Leibung an sich selbst, sei es „wie immer“, die immer erneuten Sackgassen, Verirrungen, halben und grotesken Versuche und Würfe, die bald zu dieser, bald zu jener Art führen und sich nun – glücklich im Besitze doch einer Form wahrhafter Leibung und Wesung – über unüberblickbare Zeiträume hinaus weiter fortpflanzen und als solche bewahren – wer das alles noch nicht mitbegriffen hat, der hat auch Natur noch nicht begriffen. Hier ist der nicht zerstörbare Boden für alle evolutionistische, alle „vitale“ Auffassung der Natur, für alle Auffassung, die in die Tiefe zu blicken versteht, ins Chaotische, die auf einem Gefühl für das „ungeheure Drängen des Lebens“ gründet. Und dennoch: wer hinwiederum nicht gesehen hat, daß über jeder Gestalt der sie – wie sie nun einmal ist – segnende Logos steht, der ihr den Namen gibt, der all ihr Wesen umschließt – nein, es ist nicht nur dies doch auch schon kaum Ausdrückbare! Sehen Sie, mein Freund, eines ist ja gewiß, und alles was wir bisher sahen, führt uns darauf hin – ohne die zeugende, leibende und belebende Kraft der Gottheit wäre kein Ding. {180} P s i l . : Bisher zeigten Sie mir, daß ein Ding nur werden kann, was es ist, wenn es – aus der Untiefe der alles und jegliches in bloßer Potenz verschließenden Finsternis herausgehoben – nunmehr sich in seiner eigenen Fülle sammelt, innert und gestaltet und aus dieser sich verströmend und ausatmend wieder ausgeht.

268

Metaphysische Gespräche

M o n t . : Woher aber die Möglichkeit und Kraft zu dieser Erhebung, Sammlung und zu diesem leibenden Leben in sich selbst? P s i l . : In ihm selbst, in seinem urhaften Drängen – liegt sie nicht hier? M o n t . : So wäre es ja wirklich ein selbstschöpferisches, wie Sie schon einmal sagten. P s i l . : Nein, denn erst müßten die „Quellen geöffnet“ sein. Dies Bild stammt von Ihnen. {181} M o n t . : Aber das war nun allerdings ein höchst vages Bild, das wenig oder gar nichts besagt. Denn da ist ja keine Schleuse, die nur geöffnet zu werden brauchte, sondern eine in der Ohnmacht bloßer Potenz sich in sich selbst verzehrende Finsternis. Es ist schwer, sich hiervon auch nur einen annähernden Begriff zu machen. Aber man darf ja nicht an so etwas wie einen Samen oder einen fruchtbaren Schoß denken; denn da ist die Möglichkeit der Wirksamkeit und Entfaltung schon voll und unmittelbar gesetzt. Hier aber, in dem schwarzen Rachen macht gerade die absolute Impotenz das Wesen der Sache aus – die vollkommene Nichtigkeit und Wesenlosigkeit alles Seins, die gerade den brennenden Hunger und die zehrende Unruhe, die U r unruhe, in sich schließt. Welche Ruhe dagegen schon über der nur n o c h n i c h t entfalteten, der Potenz nach aber schon voll gesetzten Wesenheit, der samenhaften Wesenheit! Sie „hat“ sich ja schon, ohne sich freilich zu haben. D. h. sie ist sich selbst schon durchaus erreichbar. Hier im Abgrund aber macht eben das Moment des „sich selbst in keinem Sinne Erreichen-könnens“ das Wesen der Sache aus. Hier jagt das Sein sich selber nach.Wie sollte es sich je aus sich selbst entfalten können, da es sich gar nicht, auch nicht der Potenz nach, besitzt? P s i l . : Und doch nannten Sie diese Dimension stets die Dimension der schlechthinnigen Potenz – M o n t . : Sie haben recht. Es liegt da eine wesentliche Doppeldeutigkeit des Ausdrucks. Potenz heißt „Können“, nämlich der Kraft nach, und Potenz heißt „Möglichkeit“, nämlich dem Inhalte nach. {182} P s i l . : Der Kraft nach liegen in dieser Untiefe keine Potenzen, wohl aber dem Inhalte nach? M o n t . : So denke ich. P s i l . : Insofern hier nichts ist und nichts aus ihr selbst heraus werden kann, aber doch a u s ihr alles werden kann? M o n t . : Ja. P s i l . : Das ist ja die materia prima der Scholastik. M o n t . : Wohl. Aber vergessen Sie mir nicht dieses eine Moment, ohne das mir die ganze Konzeption wesenlos zu werden scheint: nicht etwa wie der Ton für die irgendeiner Idee nach gestaltende Hand des Künstlers liegt diese materia prima, wenn wir sie so nennen wollen, bereit – bereit als passives und geduldiges Formungsmaterial, das die „Materie“, nicht aber irgendeinen Inhalt beisteuert! Nein –

Um den Menschen

269

gerade die „Materie“ fehlt ganz und gar und die Potenz zu jeglicher Materie. Es ist ja das Hohle, die Untiefe, die Leere, der Abgrund schlechthin. Es ist richtig: er enthält nichts, auch nur der Potenz nach und kann alles und jegliches werden. Aber er enthält alles und jegliches der Sehnsucht nach, wenn ich so sagen darf, dem Hunger, der Gier nach. Es ist kein totes Material, sondern eine lebendige Nichtigkeit – keine qualitätslose Fülle, sondern eine in allen Qualitäten herumgetriebene Leere. {183} P s i l . : Also gerade das Gegenteil von dem, was mir eben noch als materia prima vor Augen schwebte. M o n t . : Es ist mir nicht deutlich, wieweit die Scholastik selbst diesem oder jenem der zwei einander polar entgegengesetzten Begriffe folgt, die doch das Gemeinsame einer für alle Gestaltungen bereiten, in sich selbst durch und durch impotenten Basis haben. P s i l . : Aber das eine ist eine qualifizierende Basis, das andere muß alle Qualität aus der Form erhalten – das dürfte doch der größte Gegensatz sein, der sich denken läßt. M o n t . : Wohl. Doch liegt hier gerade jene tief verwirrende Schwierigkeit. Das durch und durch Impotente also soll zur Potenz seiner selbst, das Leib- und Wesenlose zur Leibhaftigkeit und Wesenhaftigkeit erhoben werden? P s i l . : Ja. M o n t . : Die Potenz zur Erhebung aus der Untiefe seiner Nichtigkeit, zur wahrhaftigen Leibung und Ausgestaltung und zur lebendigen Wesung im gestalteten Sein – die K r a f t zu diesem allem, zur Aktualisierung und Tagwerdung des in der Finsternis sich nichtig Verzehrenden: das ist es, worauf es ankommt? P s i l . : Zur Tagwerdung – M o n t . : Ja. Wie soll man es besser bezeichnen? Und so sind es Lichtkräfte, zeugende, leibende, belebende, die sich des Ohnmächtigen und in Finsternis Verschlossenen erbarmen müssen. {184} P s i l . : „In ihm war das Leben und das Leben war das Licht der Menschen …“ M o n t . : Ja. Hier ist schon vom Menschen die Rede. Und um seinetwillen gehen wir ja diesem allem nach. Aber zuerst gilt es zu sehen, daß in jedem Ding diese Lichtkraft wirken muß, damit es überhaupt sein kann, was es ist. P s i l . : Die dreifaltige Lichtkraft – M o n t . : O ja, Sie haben verstanden. Wer anders als die Gottheit, insofern sie sich von Ewigkeit zu Ewigkeit selber zeugt und aus sich erhebt, soll alle Dinge aus ihrer wesenlosen Nichtigkeit herausheben und herausziehen – er der Urzeuger und Vater alles Seins. Wer anders als die Gottheit, insofern sie sich in der glorreichen Fülle ihrer selbst faßt und setzt, insofern sie in geheimnisvoller Sammlung Leib und Wort wird, soll in allen Dingen wirken als Kraft der Sammlung, Leibung, wahrhaftigen Auswirkung und Gestaltung. Wer anders als die Gottheit, insofern sie aus

270

Metaphysische Gespräche

ihrer erhobenen und gesammelten Fülle in freier Kraft und strahlender Glorie als Geist aus sich selber ausgeht, soll auch dort, wo Vater und Sohn in den Dingen der Kraft nach gegenwärtig und wirksam sind, aus ihnen mit und in der Qualität des Dinges ausgehen und es zu einem atmenden, wesenden und lebenden machen? Was ist der Vater ohne den Sohn und Vater und Sohn ohne den Geist? Was das zeugende Prinzip ohne das leibende und was das zeugende und leibende ohne das geistende? Deshalb heißt es: „im Wort war das Leben“ – denn wo immer sich der Vater im Wort setzt und leibt, ist das ausdringende Leben wesenhaft mitgesetzt. {185} P s i l . : Aber, Montanus, – so stark ich jetzt das fundierende und tragende Wirken der Gottheit in jedem Dinge zu spüren glaube – Sie sagen, dieselbe sei „der Kraft nach“ gegenwärtig – also nicht selbst und als solche? Hier ist ein Punkt, der mir der entscheidenden Betonung wert erscheint. M o n t . : Ach, mein Freund, was fragen Sie mich hiernach? Ich wage nichts Endgiltiges darüber zu sagen. Aber Sie haben ja natürlich die entscheidende Frage gestellt. Manchmal scheint es uns, als ob die Gottheit, so wie sie in sich selbst von Ewigkeit zu Ewigkeit und in der ungesonderten Fülle alles Seins als aus sich gezeugte, geleibte, und geistende wohnt, sich nun auch in jedem kreatürlichen Ding und seiner gesonderten Qualität noch einmal zeugt, leibt und lebt? Das wäre ein Stück Pantheismus – allerdings ruhend auf der Grundlage eines strikten und wie mir scheint, in jedem Falle unaufhebbaren Theismus. P s i l . : Insofern die Gottheit erst als in sich selbst vollendet gedacht werden muß, ehe sie sich in der Kreatur manifestieren kann? {186} M o n t . : Gerade so. Nicht bedürfte sie dieser Glorifizierung in der Natur für ihre selbsteigene Glorifizierung. Aber – sollte es auf dieser Grundlage Möglichkeit sein? Qualifiziert die Gottheit selbst in dieser Hyazinthe, die vor uns steht? Verherrlicht sie sich persönlichst in dem gesonderten und vergänglichen Sein der Blume, sich in ihr auswirkend und gestaltend? Oder gibt sie in ihrer dreifaltigen Wesenheit nur die Kraft, in der und durch die nunmehr das Ding aus sich selber qualifiziert, durch die es sich selbst und damit erst indirekt die Gottheit verherrlicht, aus der es sich schöpft? Denn ein ununterbrochenes Schöpfen, ein ununterbrochenes Getragen- und Genährtsein wäre es ja – ohne diese letztlich fundierende und tragende Kraft wäre es in einem Augenblick von der Finsternis der Nichtigkeit wiederum verschlungen. So aber vermag es nur aus sich selber zu leiben und zu wesen – nach eigenen Gesetzen, Möglichkeiten und „Begierden“ – P s i l . : So wäre dann die Gottheit mit ihrer tragenden Kraft eine Art ununterbrochenen Geburtshelfers? M o n t . : Psilander, Psilander, das ist fast zu scharfsinnig, weil zu ironisch. Aber sehen wir es ruhig einmal so – doch denken Sie daran, daß diese Kraft in ihrer dreifaltigen Wirksamkeit in das Ding wirklich eingehen, von diesem sich zu eigen gemacht, einverleibt sein muß, um nun – soweit sie, die immer neu sich darbie-

Um den Menschen

271

tende, eine hineingenommene und einverleibte ist – förmlich als die Eigenkraft des durch sie in sich selbst substanziierten Dinges zu wirken. Das ist wesensmäßig ein äußerst schwer zu fassendes Verhältnis. Aber gerade in ihm liegt vielleicht die Möglichkeit einer Synthese zwischen Pantheismus und Naturalismus. G o t t , d e r alles in allem selbst ist und wirkt , tritt zurück, damit die Dinge sie selbst sind und sein können. {187} P s i l . : Tritt zurück, ohne zurückzutreten – M o n t . : Ja, gerade darin liegt es. Denn ohne ihn wären sie nichts. Und in seiner offenbaren, seiner herrschenden Herrlichkeit wären sie wiederum nichts. Sie können nur sein, was sie sind, in und mit seiner d i e n e n d e n Kraft. „We r m i c h s i e h e t ( n ä m l i c h d e n a u s L i e b e D i e n e n d e n ) , d e r s i e h e t d e n Va t e r.“ P s i l . : Aber Sie sprachen von einem allerschwierigsten Punkt – vorhin schon – M o n t . : Von einem noch anderen Gegensatz zwischen extrem naturalistischer, evolutionistischer, vitaler Anschauung einerseits und einer scholastischen, platonischen, oder wie man sie nennen soll, andererseits – denn hier treffen sich alle diese letzteren, von oben her und nicht von unten her orientierten Auffassungen? P s i l . : Ja. Nur wegen dieses „Punktes“, scheint es mir, sind wir jetzt so tief in metaphysische Fragen hineingeraten. M o n t . : Wie die Insekten um das Licht schwirren wir immer wieder um den Mittelpunkt alles Seins herum, von ihm unwiderstehlich angezogen. P s i l . : Und verbrennen uns hoffentlich die Flügel nicht. {188} M o n t . : Und wenn auch. So ist es unser Geschick. Aber den Menschen, den Menschen, mein Freund, packen wir nicht ohne diese immer engeren Kreise. Doch nun zu unserem verwünschten Punkt. Wenn dem Urleben in der Ohnmacht seiner in sich selbst vergrabenen Wesenlosigkeit die Kraft zuströmt zur selbstherrlichen Wesung und Leibung, dann werden alle in ihm nichtig geistenden Qualitäten in Hunger und Gier hinauf- und hineinstürzen in das „Dasein“, in den „Tag“, in diese Möglichkeit der Gestaltung, Leibung und Manifestation? P s i l . : So könnte man es sich wenigstens vorstellen. M o n t . : Ist es nun aber denkbar, mein Freund, daß der natürliche Kosmos, daß alle Reiche der Natur in ihrer mannigfaltigen Gestalt in diesem wilden Drängen und Suchen von unten her sich fundieren ließen? P s i l . : Wenn Sie es so fassen, dann scheint viel eher ein Chaos als ein Kosmos herauszuspringen. M o n t . : Ein Chaos der Fülle, so wie vorher ein Chaos der Leere; ein Chaos des Tages, so wie vorher ein Chaos der Finsternis – P s i l . : In dem alles wird und doch nichts, weil eines das andere unaufhörlich von seinem Platze verdrängt? M o n t . : In dem „alles“ wird –? Auch Pflanzen, Tiere, Menschen? P s i l . : Das erscheint allerdings lächerlich –

272

Metaphysische Gespräche

M o n t . : Aber Stoffe? Denn sie sind ja der unmittelbar geleibte Ausdruck der puren Qualität. Ohne alle darüber hinaus liegende Gestaltung. {189} P s i l . : So habe ich es nicht gesehen. Aber es leuchtet mir ein. M o n t . : Doch auch die Fülle der Stoffe vielleicht noch nicht in gesonderter, jeweilig selbsteigener, geschlossener Leibung, in gesetzter Form, sondern – wie Sie gleich richtig sahen – eines das andere in Spannung und Unruhe unaufhörlich verdrängend und so alles in allem und nichts für sich – P s i l . : Das wenigstens schien mir das wesentliche Charakteristikum des Chaotischen zu sein. M o n t . : Und mit Recht. Wie eine ungeheure Lösung also – könnte man es sich etwa so vorstellen? P s i l . : Das Urwasser – zum erstenmal geht mir ein möglicher Sinn auf. M o n t . : Im Schöpfungsbericht scheint das „es werde licht“ und das Auftreten der Urwasser eng zusammenzuhängen. Wasser ist recht eigentlich das Symbol der puren, leibgewordenen Klarheit, in der noch keine gesonderte und fixierte Gestalt mit dem Akt der Selbstbeschließung wiederum eine Art „Finsternis“ gesetzt hat. Aber lassen wir die Hand von gewagten und unfundierten Exegesen.Wie immer wir das alles nun einzukleiden versuchen oder hier und dort eingekleidet zu finden glauben – es ist doch nichts anderes als Wesenserkenntnis, die uns immer begieriger macht und weiter treibt und uns immer Neues unter diesem oder jenem Bilde plötzlich aufleuchten läßt? {190} P s i l . : Und mich jetzt so sehr begierig macht auf das weitere. M o n t . : Wie nun also vom Chaos zum Kosmos, von dem alles vermischenden und lösenden „Urwasser“ zur gegliederten Natur, vom puren Stoff zu der unerschöpflichen Fülle der vor uns liegenden Gestalten und Gestaltungen gelangen? P s i l . : Ich weiß es nicht. M o n t . : Was fehlt diesem Chaos, um ein Kosmos zu werden? P s i l . : Die Sonderung, Gliederung, Gestaltung – M o n t . : Eine Art formenden Prinzips also müßte hinzukommen, das nun jede Wesenheit in das ihr eigene geleibte Sein einschließt, mit ihm selbst umgrenzt und in es selbst einsiegelt? P s i l . : Ein formendes Prinzip als viertes zu jenen drei? M o n t . : Aber weshalb bedurften wir bisher – so bei der Selbsterhebung der Gottheit in sich – nur dreier Prinzipien? War hier nicht auch von einer wahrhaftigen Gestaltung die Rede? P s i l . : Wir nahmen die Leibung zugleich als Gestaltung. M o n t . : Denn das sich in seiner Fülle Innern war eben das sich für sich selbst und in sich selbst Formen und Gestalten? P s i l . : Ja.

Um den Menschen

273

{191} M o n t . : Aber eben dies teilt sich sozusagen in zwei Momente: das Ausbreiten der Fülle oder das Fülle-G e w i n n e n als solches und das leibende Zurücknehmen und Einformen der Fülle in das sich mit sich umschließende und beschließende Selbst? P s i l . : Ist nicht das erste der beiden Momente schon in der Erhebung aus der potenzlosen Finsternis eo ipso gesetzt? Besteht nicht diese Tagwerdung, wie Sie sagten, oder diese Erhebung gerade aus dem Fülle-gewinnen schlechthin – M o n t . : Vielleicht haben Sie recht. Ich weiß es nicht. Aber in einem jedenfalls sind wir einig: daß die Formung, die leibende Innerung, die Selbstbeschließung in bestimmter Gestalt recht eigentlich das Prinzip dessen ist, den wir den „Sohn“ oder das „Wort“ nannten? P s i l . : Hiernach bestimmten wir ja sein Wesen selbst. M o n t . : Was also das Chaos zum Kosmos macht und beständig in jedem und jedem Augenblicke neu macht, wäre im eigentlichsten Sinne durch dieses leibende, innernde, umgrenzende, gestaltende „Wort“ hervorgebracht – P s i l . : Hier ist es aber wieder so: nimmt das Ding die gestaltende und innernde Kraft des Wortes nur in sich hinein, um sich nun aus sich heraus und von sich aus zur Gestaltung seiner selbst zu erheben oder ist es das Wort selbst, das sich in ihm leibt – so wenigstens verstand ich vorhin Ihre Alternative. {192} M o n t . : Sehr recht. Aber ich habe doch immer wieder das Gefühl, als wenn beides letztlich zusammenfiele. Doch ist vielleicht das erste mehr zu betonen als das zweite, weil die Natur zuerst in ihrer substanziellen Eigenständigkeit gesehen werden muß. Sonst benimmt man ihr allen Charakter. Aber, Psilander, wenn wir nun diese Potenz zur wahrhaftigen Selbstbeschließung setzen – findet sich nun das Urleben von sich aus und in blindem Drängen durch bis zu den höchsten Stufen, bis zum Menschen etwa, und in alle Gestaltungen hinein? P s i l . : Manchmal schienen Sie es selbst so fassen zu wollen, als ob alle Gestalten nur das blinde und zufällige Resultat eines Gestaltungsstrebens schlechthin seien – das wie immer im Dasein eine durch diese oder jene Bedingungen so oder so ausschlagende Manifestation sucht. Aber ich weiß, daß wir jetzt an dem Punkte sind, zu dem Sie hinführen wollten. Denn dann scheint ja plötzlich über jeder ausgewirkten Gestalt eine „Idee“ zu stehen, nach der sie geformt ist. M o n t . : Über jeder und jeder Pflanzenart also etwa eine andere und andere? P s i l . : Ich weiß nicht – M o n t . : Oder gibt es gewisse allgemeinere „Leitideen“, um mich vorläufig einmal so auszudrücken, die nun, in verschiedenen Arten mehr oder minder vollkommen realisiert, mehr oder minder vollkommen und rein ausgeleibt sind? P s i l . : Das würde jenem von Ihnen so oft betonten Moment vieler und oft mißglückter Würfe mehr entsprechen.

274

Metaphysische Gespräche

{193} M o n t . : Als wenn sie alle einer bestimmten Formidee nacheiferten, der sie doch ihrer verschiedenen Urqualität und anderer äußeren Bedingungen zufolge nur in sehr verschiedener Weise gerecht werden können? P s i l . : An verschiedene Urqualitäten dachte ich eben gar nicht. M o n t . : Aber immer sprachen wir doch von einem durchqualifizierten Urleben, das eben als solches zur Wesenhaftigkeit aufdrängt. Denken Sie an eine Palme. Ist das Schema ihrer Gestalt durch eine bestimmte Formidee aus einer für jeden Inhalt gleichgültigen Materie herausgezogen worden – oder hat sich eine bestimmte Urqualität, sich nährend von den ihr adäquaten Naturkräften, zu gerade dieser Gestalt durchgerungen – gezogen und geleitet allerdings von einer allgemeinsten Gestaltungsidee, ohne die, wie mir scheint, auch nicht die geringste Erhebung über den bloßen Stoff hinaus möglich wäre. Oder ist es die Konstellation der wirksamen Kräfte selbst, die diese und keine andere Urqualität erwecken? Ist es alles in merkwürdigem Ineinander, und wo liegen dann die Bestimmungsgrenzen des Einzelnen? P s i l . : Die Gestaltungsidee, ohne die auch nicht die geringste Erhebung über den bloßen Stoff hinaus möglich wäre, sagen Sie? {194} M o n t . : Die pure Leibung in gesonderter Umgrenzung und Selbstbeschließung kann nur zum Stoff führen. Er ist ja die reine, die schlicht gesetzte Substanzialisierung in immer neuer Form, in immer neuem Wurf. Hier genügt die leibende Potenz an und für sich, und diese Leibung ist eben die „Idee“, die über dieser niedersten Dimension steht, oder der Logos, der sich in ihr auswirkt. Aber die Pflanze? Wir nannten sie das Gestaltswesen katexochen. Inwiefern ist sie ein über die pure Leibung hinaus Gestaltetes? P s i l . : Insofern sie zu einer ganz bestimmten Form aufwächst und eben in dem Auswirken und immer wieder Neusetzen dieser bestimmten Form ihr Wesen besteht. M o n t . : Aber liegt nur in der Tatsache der lebendigen Gestaltung selbst eine „Erhebung“ über die pure Stoffleibung? Oder spricht auch die durch alle Einzelformen durchgehende allgemeine Gestaltungsart selbst diese Erhebung aus? P s i l . : Ich verstehe noch nicht. M o n t . : Sind alle die verschiedenen Formen ganz wahllos aneinandergereiht und nur faktisch hier so, dort anders beschaffen – oder läßt sich gleichsam eine Idee finden, nach der sie aufsteigen, wenn auch mit vielen Quer- und Seitwärtszügen? P s i l . : Goethe suchte nach der Uridee der Pflanze oder der Urpflanze. Ich bin nicht Botaniker genug, um eine Antwort auch nur zu versuchen. M o n t . : Benutzen Sie nur Ihren für das Wesentliche so durchdringenden Blick. Hier kommt es jetzt auf nichts weiter an. Soll man so etwas wie Seetang oder eine Blütenpflanze als das der Gestaltung nach Höhere bezeichnen?

Um den Menschen

275

{195} P s i l . : Die Blütenpflanze. Und weshalb? Wohl weil der Aufbau unendlich viel komplizierter ist. M o n t . : Ließe sich nicht zunächst auch das Umgekehrte vorstellen? Ließe sich nicht auch eine höchstausgebildete Blütenpflanze denken, die mit allereinfachsten Mitteln ihr herrliches Resultat erreicht, während eine Moospflanze etwa nur mit größtem immanentem Umstand das hervorbrächte, was sie ist? Und bliebe nicht trotzdem jene die „Königin“? P s i l . : Da sind irgendwelche ästhetischen Gesetze maßgebend? M o n t . : Ästhetische – vielleicht, wenn Sie so wollen; aber ästhetische in einem sehr tiefen Sinne, der das ganze Wesen umgreift – und deshalb nicht, wie Sie jetzt meinten, unsachliche, sondern im Gegenteil sachliche in eigentlichster Bedeutung. Sehen wir nicht deshalb, mein Freund, jene als die höhere an, weil in ihr das Wesen der Pflanze vollends aufgeschlossen und zur reinsten Manifestation gelangt erscheint. P s i l . : Jetzt sehe ich es so, als wenn schon in diesem Moment der Aufgeschlossenheit selber das eigentümlich Bedeutsame, das Höhere läge – M o n t . : Als wenn es eben gerade darauf ankäme, a u f z u s t e i g e n und in der entmaterialisiertesten Form, die möglich ist, zum Licht hin aufzubrechen? P s i l . : Ja, so etwa. Zum Licht hin – {196} M o n t . : Ist es ein Zufälliges oder ein für das Wesen eminent Bedeutsames, daß sich die Pflanze in ihrer Entwicklung auf die Richtung Erde– Himmel wie eine Magnetnadel mehr und mehr einstellt? P s i l . : Und zwar als eine aufsteigende v o n oder a u s der Erde z u m Himmel – M o n t . : Trefflich. Aus der verschlossenen Potenzialität im bergenden und verbergenden Schoß der Erde zur aufgeschlossenen Aktualität im Angesicht des strahlenden Himmels – wie ein Auge seinem Licht entgegengeöffnet. P s i l . : Wenn ich Sie recht verstehe, so sehen Sie hierin ein Symbol jener metaphysischen Tag- und Lichtwerdung, oder wie man sie nennen soll, von der wir schon so viel sprachen? M o n t . : Ein Symbol in der Ebene reiner Gestaltung! Aber nicht nur ein Symbol, Psilander. Denn es muß ja die wahrhaftige Kraft und Potenz in ihr, der Pflanze, sein, so aufzusteigen und sich dem Licht entgegen zu entfalten. P s i l . : Die Kraft auch, meinen Sie, der Entwicklung aus den niedersten Formen, in denen sie noch im Wasser und auf der Erde sich umherwindet bis zu den jeweilig höheren und höchsten, in denen die Aufrichtung erfolgt ist? Verstand ich Sie? M o n t . : O ja, Sie verstanden. Aber bei Ihrem Ausdruck „Aufrichtung“ – fällt uns da nicht der Mensch ein? {197} P s i l . : Der Mensch? Aber eine Aufrichtung ganz anderer Art –

276

Metaphysische Gespräche

M o n t . : Bei der Pflanze bleibt sie auf der Ebene der reinen Gestaltung. Beim Tier aber läßt sich dieser Ausdruck überhaupt nicht anwenden. Das dürfte wohl etwas bedeuten. P s i l . : Wir sagten allerdings schon einmal, daß das Tier gerade wegen und mit seiner höheren Stellung noch einmal wie zurückgesunken erscheine in das Urleben, in die zu ihm und in ihm frei durchgebrochene Quall. M o n t . : Und ich glaube, wir werden bald darauf zurückkommen. Jetzt aber – wir sprachen von der Potenz, nicht wahr, die dem sich leibenden Urleben innewohnen oder verliehen sein muß, um über die nur substanzielle Selbstbeschließung im Stoff hinaus zu den lichtorientierten Gestaltungen sich erheben und aufsteigen zu können? P s i l . : Ja. M o n t . : Die leibende Potenz ist die Potenz der Selbstbeschließung in der Fülle? P s i l . : Ja. M o n t . : Hier aber handelt es sich um eine Selbstbeschließung eigener Art, nicht wahr? Um eine solche, die nur in und mit dem Heraufsteigen ans Licht sich auswirkt, die in sich selbst diesen „Zug“ gleichsam nach oben, zur Aufrichtung, Aufschließung, Entmaterialisierung hat? {198} P s i l . : Und alle – primitiven wie komplizierten – Versuche und Würfe letztlich leitet – M o n t . : Ja, sie leitet. Die leibende Potenz, die beschließende, umgrenzende, gestaltende, i n e i n s s e t z e n d e war recht eigentlich die des Logos, des Sohnes, des Wortes? P s i l . : Ja. M o n t . : Hier also muß dieser Logos, indem er sich mit seiner leibenden Kraft einläßt und einsenkt in das zum Dasein aufsteigende Urleben und ihm so die Möglichkeit und Kraft der Selbstumgrenzung in immer neuen und neuen Gestalten verleiht und sie verleihend die Gestalten trägt und sichert – hier muß er sich zugleich als heraufziehender, zum Licht leitender auswirken! Die durch ihn neu und neu einströmende Potenz muß mit diesem Streben und Suchen wie mit einer Entelechie gleichsam beladen sein! P s i l . : Der Ausdruck „Entelechie“ wollte mir schon immer kommen, wenn Sie vom Leiten, vom Heraufziehen usw. sprachen. M o n t . : Was sind nun aber, von hier aus gesehen, die einzelnen mit sich selbst in ihrem Wesen beschlossenen und sich immer wieder neu setzenden Gestaltsarten? Sind es nicht mehr oder minder geglückte und vollkommene, hier „geratene“, dort groteske, hier noch auf vorbereitender, dort schon auf entfalteter Stufe stehende Manifestationen dieser einen Gestaltungsidee, die in der sie beherrschenden Entelechie lebendig wirksam ist?

Um den Menschen

277

{199} P s i l . : Also doch, Montanus, sprechen Sie nur von der einen Uridee in jedem Gestaltungsbereich wie hier dem vegetativen! Einzelgestaltung ist Zufall, Bedingtheit, Wurf, Weg – M o n t . : Bedingt durch das gerade hier von unten her Qualifizierende oder was immer? P s i l . : Ja. M o n t . : Wo und wie immer nun aber, Psilander, das Urleben eine Möglichkeit und einen Weg gefunden hat, sich – jener leitenden Idee n a c h – ins Dasein hineinzuleiben, da ist ja dann doch eine wahrhaftige Wesenheit entstanden, ein Ganzes, ein mit sich selbst Umschlossenes und in seinem bestimmten Gestaltungsmaß daseiend Ruhendes? Da i s t ja nun eine Manifestation zuwege gebracht, ein Symbol, ein sich selbst und durch sich selbst h i n d u r c h jene Uridee Bezeugendes und Aussprechendes – P s i l . : Die Idee, realisiert in einer bestimmten differenzierten Form. M o n t . : Auch das, wenn Sie so wollen. Aber sollte nicht der leibende Logos oder der eine jede solche Gestaltungsart in der Potenz zu ihrem faktischen Formwesen tragende und sichernde Logos eben diese zur Ruhe mit sich selbst gelangte Gestaltungsart segnen? P s i l . : Ich fühle fast, was Sie damit meinen – {200} M o n t . : Und auch ich kann es nicht viel genauer explizieren. Sehen Sie wiederum diese Hyazinthe. Sie ist aus vielen zufälligen und wesentlichen Bedingungen der Art nach so und nicht anders geworden. Und doch würde man ihr Unrecht tun, wenn man sie gewissermaßen nur so vom naturalistischen, vom wilden Standpunkt aus faßte und betrachtete. Das fühlten wir gleich. Sie ist dann doch wieder die Offenbarung von irgend etwas Wesentlichem – sie scheint genau so wie sie ist, einem in der Urweisheit von Ewigkeit zu Ewigkeit wesenden Gedanken zu entsprechen – und der Weg zu den apriorischen Gestaltseinheiten scheint wieder offenzuliegen. P s i l . : Da ist also der Widerspruch, von dem Sie immer sprachen. M o n t . : Ja. Aber enthält denn nicht, Psilander, der Logos, in dem das unendliche Wesen Gottes glühend in eins gesetzt ist – er, das Herz Gottes, oder sein als Sonne aufgehendes Wesen, wie Böhme sagt –, alle und jede Gestaltungsmöglichkeit in wesentlicher und wahrhaftiger, wenn auch ungesonderter und überzeitlicher Gestalt? Und wenn nun in und mit seiner wesenden, leibenden und leitenden Kraft im in sich selbst blinden Suchen und Drängen und Qualifizieren und Aufsteigen eine bestimmte Gestaltungsart sich leib- und wesenhaft ausgesondert und gesetzt hat, ist da nicht etwas von jenem in unerschöpflicher Herrlichkeit alles leibenden und wesenden Geist an seiner kleinen kreatürlichen und vergänglichen Stelle, a b e r e b e n a u c h w a h r h a f t i g u n d w e s e n h a f t , gesetzt und zu Leib und Leben geworden? Und muß nicht der Logos, der wie ein kraftspendender und lei-

278

Metaphysische Gespräche

tender Stern vor dem gestaltenden Suchen herzog, nun über dem glücklich Geborenen segnend stehen bleiben und es in seiner erreichten und gefundenen Eigenart mit dem Namen versiegeln, der ihm entspricht? {201} P s i l . : Und den die Pflanze aussprechen müßte, wenn sich ihr Wesen im geistigen Wort formen und setzen könnte – jetzt ist dieser eine Ring geschlossen worden, ich sehe es. Es war ein langer Weg. Aber, Montanus, jetzt scheint jener Widerspruch plötzlich verschwunden? M o n t . : Oder, mein Freund, wir haben nur eine kleine Abrundung, die uns ein wenig aufatmen läßt, einmal versuchsweise gewagt. Wir wollen alles im Flüssigen und Beweglichen lassen. Nur daß uns immer neue Anschauungen und Anschauungsmöglichkeiten aufgehen – und ich glaube, wir haben auf unserem Wege manches gesichtet.

M o n t . : Bei der sprechenden Pflanze, bei der Pflanze, deren Wesen sich im Wort formt und aushaucht, sind wir wiederum angelangt. Aber von einem eigentlichen „Sprechen“ kann ja doch hier die Rede nicht sein –? P s i l . : Von einem Sprechen im aktiven Sinne? M o n t . : Ja. Sie hat ja in sich selbst keine Stätte, in der sie ihr eigenes Wesen gesammelt besitzt – sie hat kein Innerungszentrum. {202} P s i l . : Und nur aus einem solchen Innerungszentrum heraus kann eigentlich gesprochen werden? M o n t . : Im Wort wird das Wesen nicht mehr nur in freier Geistigkeit ausgehaucht, sondern in gesammelter, gebundener, fixierter, in eins gesetzter. Wie aber soll eine Entität diesen Akt vollziehen, wenn sie sich nicht in gesammelter Form irgendwie und irgendwo besitzt, wenn sie nicht, in sich selbst in eins gesetzt, sich von hier aus und hier eben „hat“ und besitzt? P s i l . : Das Tier aber hat schon diese Sammlung in sich selbst, besitzt schon ein solches Innerungszentrum – M o n t . : Könnten wir nicht, Psilander, auch den „Logos“ des Tieres ein wenig aufspüren? Das Material haben wir auf unseren vielen Wegen und Versuchen schon beisammen. P s i l . : Sie lehrten mich, das Tier als Aktionswesen im prägnanten Sinne zu sehen – M o n t . : So wie die Pflanze als Gestaltswesen, ja. Aber beides drückt nur das formale Wesen aus. Bei der Pflanze sahen wir schon mehr. Wir sahen sie zum Licht aufsteigen, wir sahen den ewigen Fortschritt von Potenzialität zu Aktualität, von Verborgenheit zu manifester Aufgeschlossenheit an ihr gestaltungsmäßig verwirklicht. Und das Tier?

Um den Menschen

279

P s i l . : Oft schon kam uns der Ausdruck, daß es in sich oder in die Tiefe des Urlebens zurückgesunken erscheine. {203} M o n t . : Ja, aber doch nun nicht mit gänzlichem Verlust seiner selbst? P s i l . : Wie das? M o n t . : Indem es aus sich zurücksinkt, bleibt es doch es selbst oder wird sogar erst eigentlich es selbst. P s i l . : Meinen Sie wiederum jenes Moment, daß das Tier, wie Sie sagten, sich allererst „hat“, indem es in sich frei von sich wird? M o n t . : Ja. Die Pflanze steigt gewissermaßen unbekümmert um sich selbst zum Licht und zur Selbstmanifestation empor. So will es ihr leitender Logos. Das Tier aber muß sich erst mehr und mehr in sich selbst hineingraben, bis in die letzte Tiefe und Untiefe – ehe ein neuer Aufstieg gewagt werden kann. Aber nun ein ganz anderer, nicht mehr rein gestaltungsmäßiger. P s i l . : Ein neuer Aufstieg? Erst im Menschen? Oder auch schon im Tier selbst? M o n t . : Der Abstieg in die Tiefe setzt eo ipso ein immer größeres Freiwerden von der Beschwerung und Fesselung im eigenen geleibten Selbst, das doch nicht verloren oder aus der Hand gegeben wird. Und so auch einen möglichen freien Aufbruch aus diesem Selbst. Das höchste Tier, das in der freigelegten Untiefe des Urlebens selbst zu wohnen scheint, hat Augen, die nicht mehr nur passive Lichtorgane sind, sondern schon unmittelbar nach der Sonne verlangen. Aber eben nur verlangen. {204} P s i l . : Weil es aus dieser Untiefe doch nicht heraus- und herauffinden kann? M o n t . : Ja. Denn sein Logos ist der des Abstiegs, nicht der des Aufstiegs. Und also bleibt es formal-konstitutiv in dieser Ebene eingeschlossen. Es hat die formale Möglichkeit zur Erhebung aus sich selbst nicht in sich. P s i l . : Die der Mensch sodann in sich hat? M o n t . : Die der Mensch in sich hat. Er, der wiederum ein Lichtwesen katexochen ist. Aber nun auf so radikal anderer Basis. P s i l . : So wie also im Reiche des Vegetativen ein immer neues und anderes Suchen nach jenem rein gestaltungsmäßigen Aufstieg zum Licht vorliegt, ein Suchen von primitivsten und vorbereitenden Anfängen zu höchst vollendeten, mit vielen Ab- und Querwegen aber, so – meinen Sie – drückt sich in der Gestaltung des Tierreiches ein Suchen nach dieser eigenen Tiefe, nach dem Freiwerden in sich selbst von sich selbst bis zum Durchbruch in die Urtiefe qualifizierenden Lebens aus? {205} M o n t . : Ja. Ist es nicht so? Zuerst noch hinausgegeben an die Materialität des eigenen Leibes und wie verteilt an sie, da doch schon die ersten vagen Möglichkeiten eines persönlichen sich Regens in diesem Leibe auftreten, ankündigend den allerersten Anfang der Entzogenheit und Innerung – durch alle Stufen und

280

Metaphysische Gespräche

Versuche und Würfe hindurch, in denen bald die unmittelbare Aktionsmöglichkeit im Leibe durch eine förmliche Entleibung und Entsubstanzialisierung aufs höchste gesteigert wird, bald umgekehrt die Selbstbeschließung und sich tiefer und tiefer grabende Einnistung im eigenen Selbst durch Kapseln und Hüllen und Einleibungen bis zur Unbeweglichkeit getrieben wird (beides allem Pflanzenwesen so unähnlich wie nur möglich!) – bis zu den wunderbaren Gestaltungen höchster Tiere, in denen ein vollkommenes Gleichgewicht zwischen höchstmöglicher Beherrschbarkeit des Leibes und tiefstmöglicher Ein- und Inwohnung in sich selbst erreicht zu sein scheint. Hier führt der leitende Logos, aus dem die leibende Potenz unerschöpflich strömt, nicht zur Höhe, sondern zur Tiefe. P s i l . : Aber auch hier bleibt er segnend über jedem mutigen Wurf stehen. M o n t . : Ja, mein Lieber, mein Guter. Über jedem mutigen Wurf. Indem das Tier also in seiner Evolution mehr und mehr aus dem unpersönlichen Verfangensein in seine geleibte Gestalt zur freien Tiefe seines seelischen Grundes zurückgeht, wird es mehr und mehr persönlicher Beherrscher seines Leibes? P s i l . : In die freie Tiefe seines seelischen Grundes? Aber wächst ihm nicht eben die Seele als Seele erst dadurch zu, d a ß eine solche von ihm bewohnte Tiefe in ihm aufbricht? So wenigstens schien mir bisher Ihre Auffassung? {206} M o n t . : Sie haben recht. Aber wir können ja nun ,, Seele“ auch in einem erweiterten Sinne nehmen, ohne noch Verwirrung fürchten zu brauchen. Wir können im allgemeinen und rein objektiven Sinne das Qualifizierende selbst so nennen. Und ähnlich hat es wohl Aristoteles gemeint, wenn er von der Seele der Pflanzen spricht. Doch ist eben die Pflanze selbst noch ganz außerhalb ihrer Seele, wenn wir so sagen dürfen. Und erst das höhere Tier, das anfängt, in seiner qualifizierenden Tiefe zu wohnen und aus ihr heraus persönlich zu leben und zu agieren, hat eine Seele im prägnanten Sinne. P s i l . : „Persönlich zu leben“ – aber doch hat es noch keine persönliche Seele wie der Mensch? M o n t . : Sehr richtig. Aber inwiefern denn eigentlich? Da es doch persönlich in ihr lebt. Oder wenigstens wüßte ich mich nicht anders auszudrücken, um den Unterschied zum Pflanzenwesen zu kennzeichnen. P s i l . : Persönlich in ihr wohnt, ohne doch etwa eine Person zu sein. Hier ist die Kluft, nach deren Artung wir suchen. Ach, ich kann sie immer noch nicht übersteigen. M o n t . : Doch. Sie werden sehen, daß Sie es können. Die Pflanze ist, nicht wahr, ganz und gar eingetaucht in ihre geleibte Gestalt und daher eben nicht Herr über sie? P s i l . : Ja. {207} M o n t . : Das Tier aber, zurückgezogen aus dieser geleibten Gestalt und eingetaucht in seinen es qualifizierenden Grund, wird persönlicher Herr über sei-

Um den Menschen

281

nen Leib? Das heißt: hierdurch erst w i r d überhaupt die geleibte Gestalt zum Leibe im prägnanten Sinne. P s i l . :Ja. M o n t . : Aber eingetaucht in diesen seinen qualifizierenden Grund und aus ihm lebend, ist es ja keineswegs Herr auch über diesen –? P s i l . : So wenig wie die Pflanze ihrerseits über ihren Leib – M o n t . : Der deshalb hier ein unpersönlicher Leib bleibt –? P s i l . : Beim Tier aber zu einem persönlichen wird. Ich verstehe jetzt. Das Tier hat einen persönlichen Leib, aber keine persönliche Seele; denn es ist zwar Herr über diesen Leib, weil es seinen Standort nicht mehr in ihm, sondern in seiner Seele hat; aber nicht Herr über die Seele, weil es eben seinen Standort in ihr hat. M o n t . : Trefflich. Wie nun könnte auch die Seele zu einer persönlichen werden? P s i l . : Wenn der Standort auch aus ihr herausverlegt würde – M o n t . : Nur der Standort aber! Nicht etwa wird dadurch das Verhältnis des Einwohnens selbst wiederum verloren – P s i l . : So wie ja das Tier auch in seinem Leibe wohnen bleibt, obwohl der persönliche Standort herausverlegt ist – meinen Sie? Ja, nun erst eigentlich in seinem Leibe „w o h n t “. {208} M o n t . : So meine ich. Aber wohin, mein Freund, soll denn der Standort noch verlegt werden können? P s i l . : Das gerade fragte ich mich. Hier sind wir ja doch bei der letzten Tiefe des Selbst schon angelangt. Es sieht fast so aus, als müßte er ganz aus dem Selbst herausverlegt werden. M o n t . : Aber doch nicht einfach so ins „Leere“ hinein? Wenn wir bei der letzten Tiefe angelangt sind, so vergessen wir vielleicht über der Tiefe die mögliche Höhe? Gibt es denn nur Leib und Seele an der Naturentität? P s i l . : Und Geist. M o n t . : Weshalb denn haben wir uns so lange mit ihm beschäftigt? P s i l . : In den Geist, meinen Sie, wird beim Menschen der persönliche Standort verlegt? M o n t . : Wollen wir nicht einmal zusehen, ob es so ist? Jetzt ist es jedenfalls gut, daß wir lernten, von einem unpersönlichen Geist, vom Geist in rein objektivem Sinne zu sprechen. Das Wesen in seiner frei ausgeatmeten, in seiner der Leibung, Innerung, Sammlung, Verselbstung entgegengesetzten Form – das war es doch, was sich uns als Geist herausstellte? P s i l . : Ja. M o n t . : Und jede Naturentität, so schien es uns, muß konstitutiv etwas davon haben? Wenn sie nicht ganz und gar erstorben ist? P s i l . : Ja.

282

Metaphysische Gespräche

{209} M o n t . : Indem nun das Tier in seiner Seele haust und seinen Geist „ausatmet“, wie jedes lebendige Naturwesen, bleibt es doch gleichsam unterhalb dieses „Geistes“? P s i l . : Der über es hinaus und um es herum steigt, unerreichbar für es selbst – M o n t . : Genau so, ja – wenn man sich bei einer solchen Charakterisierung der bloßen Bildhaftigkeit der verräumlichenden Ausdrücke bewußt bleibt. Und wenn das Tier sprechen könnte, mein Freund, so würde es aus dieser Tiefe heraufsprechen – P s i l . : Und daher e s persönlich im eigentlicheren Sinne als es bei der Pflanze der Fall wäre. Und doch – M o n t . : Und doch wäre es, so meinen Sie, wiederum ein unpersönliches Wort. P s i l . : Ja. Wohl würde es aus der Tiefe des aufgebrochenen Selbst hervortönen, und das macht den Unterschied aus, aber aus dieser doch wiederum unpersönlich. M o n t . : Weil es von dieser Tiefe nicht persönlich frei, sondern ihr ganz und gar noch ausgeliefert ist. P s i l . : Ja. M o n t . : Wenn aber ein Dämon spricht? P s i l . : Das ist anders – freier – persönlicher – M o n t . : Und doch sahen wir auch ihn noch wesentlich in dem ersunkenen, in dem ewig und vergeblich heraufbegehrenden Zustand! Wegen dieser Ähnlichkeit gerade sprang uns ja aus dem höheren Tier das Moment des Dämonischen entgegen. {210} P s i l . : Und doch scheint es mir immer wieder, als ob ein Dämon so etwas wie Erkenntnis und Verstand und daher auch ein eigentlicheres Sprechen als das Tier haben könnte. M o n t . : Aber einen Verstand sozusagen „aus der Tiefe“, keinen freien, keinen geistigen? P s i l . : Einen „seelischen“ Verstand –? M o n t . : So könnte man vielleicht sagen. Nur was die Tiefe selbstigen Seins persönlichst tangiert, was persönlichst aufreizend in den Dämon hinunter- und hineindrängt, wird erfaßt. P s i l . : Aber es kann eben erfaßt und sprechend wiedergegeben werden. Weshalb nicht beim Tier? Und was ist das für ein merkwürdiger Unterschied zwischen „seelischem“ und geistigem Verstand? Ich verstehe ihn noch nicht. M o n t . : Jetzt müßten wir wohl erst zu ergründen versuchen, was denn „Verstand“ überhaupt sei! Aber, nicht wahr, wir haben jetzt keine rechte Ruhe und Geduld mehr zu langen Untersuchungen – so dicht, wie es scheint, vor unserem lang ersehnten Ziel? P s i l . : So dicht vor der Aufrichtung des Menschen? Allerdings ist die Ungeduld jetzt groß geworden.

Um den Menschen

283

M o n t . : Aber da man zu allen Zeiten gesagt hat, der Verstand gerade sei es, dessen Besitz den Menschen vom Tier unterscheidet, so wäre es merkwürdig, wenn wir hier erlahmen würden. {211} P s i l . : Das sehe ich ein. M o n t . : Doch vielleicht ist es nach allem, was wir gesagt und gesehen haben, gar nicht so schwierig, den Verstand gerade noch an seinem äußersten Zipfel zu packen und ihn so, wenn auch keineswegs von Grund auf, so doch vielleicht in seinem unterscheidenden Wesensmerkmal zu fassen! Wir haben schon oft den Ausdruck „Habe“ und „haben“ für alles Mögliche gebraucht und immer neue, wichtige Unterschiede in der Art und Weise dieses „Habens“ gefunden – ist nicht das Erkennen und Verstehen einer Sache auch so eine Art bestimmt charakterisierter Habe? P s i l . : Ich habe die Sache geistig, die ich verstehe – aber was es eben heißt, sie geistig und nicht anders zu haben, das ist die ausschlaggebende Frage. M o n t . : Mir scheint es schon eine ganz gute Grundlage zu sein, wenn wir wissen, daß es sich um eine Art der Habe handelt. Und um nun zu sehen, was dieses „geistige“ Haben von anderem möglichen unterscheidet – in welcher Beziehung haben wir denn sonst diesen Ausdruck angewendet? War es nicht die Pflanze, die, noch ganz und gar verteilt an sich selbst, sich noch gar nicht hat oder besitzt? das Tier aber – das in ein eigenes inneres Zentrum gesetzt und also von sich selber leiblich frei geworden – sich nun als ,,Habe“ hat und besitzt, weil es sich nicht mehr im brutalen und unmittelbarsten Sinne auf sich hat? {212} P s i l . : Ja. M o n t . : Und ist nicht das leibliche Empfinden eben gerade ein solches sich selber persönlich Haben und Besitzen im Leibe oder doch als Möglichkeit die unmittelbare Konsequenz desselben? Denn was in sich persönlich wohnt – nicht in jener objektiven und verteilten Weise, wie die Pflanze, sondern in der geinnerten, in der persönlichen und subjektiven wie das Tier – muß ja jedes Schicksal, das diese Habe äußerlich oder innerlich betrifft, m i t haben? P s i l . : Es spürend und fühlend, weil eben persönlich, nicht unpersönlich in dem Leibe wohnend – M o n t . : So ja. Aber verstehen kann ja deshalb das Tier seinen Leib nicht – weder, daß es überhaupt einen hat, noch was mit ihm vor sich geht und was es in ihm und durch ihn und an ihm erlebt, spürt und fühlt? P s i l . : Nein. Hier fehlt der Verstand, das Bewußtsein, der Intellekt – M o n t . : Aber was denn fehlt m i t diesem Verstand, mit diesem Intellekt? Was müßte da sein oder geschehen oder möglich sein, damit ein solcher da wäre? Empfinden kann sich das Tier, aber verstehen kann es sich nicht – gehen wir da nicht auf derselben Linie weiter, nur mit dem Verstehen etwas höher hinauf oder etwas weiter zurück –? Hier im Empfinden habe ich die Sache persönlich, indem ich

284

Metaphysische Gespräche

persönlich in sie hineinverwickelt bin und im Verstehen? Bin ich da ebenfalls persönlich in sie hineinverwickelt? {213} P s i l . : Ich bin und bleibe ihr fern – M o n t . : Und habe sie doch? P s i l . : Ja, geistig. M o n t . : Aber daß ich sie geistig habe, liegt es nicht eben gerade daran, daß ich sie habe und ihr doch fern bleibe oder in sie nicht persönlich und selbstisch hineinverwickelt bin? P s i l . : Als wäre ein nochmaliges sich Herausziehen aus der Sache nötig, ein noch radikaleres sich Freimachen von ihr – als jenes, das wir im Fortgang zur Empfindung notwendig fanden. So sehe ich es jetzt. M o n t . : Ein nochmaliges sich Herausziehen, das doch nicht etwa ein Verlieren dessen ist, wovon die Befreiung erfolgt? P s i l . : So wie ja auch jene erste Befreiung nur deshalb zur persönlichen Herrschaft und Empfindung führen konnte, weil die Einwohnung zugleich bestehen blieb. M o n t . : Diese Einwohnung auf der Basis der Empfindung aber ist und bleibt eine selbstische? P s i l . : In die das Selbst hineinverwickelt ist, wie Sie sagten –? M o n t . : In der das Selbst persönlich belastet von dem ist und bleibt, dem es entzogen ist; mit der es hineingebunden, hineinfixiert, hineingeleibt ist in die Sache, die es – ihr persönlich letztlich entzogen – empfindet. {214} P s i l . : Sonst könnte es ja auch nicht mehr der Leib z. B. des Tieres sein – wenn ihm das Tier in diesem Sinne selbstig ganz entzogen wäre. M o n t . : Sehr, sehr richtig. Denn das macht ja das Wesen des eigenen Leibes oder der Leibhaftigkeit aus, daß hier das Selbst in die Fülle seiner Selbstheit hineinfixiert erscheint. P s i l . : Hiernach sieht es fast so aus, als könnte nur der eigene Leib empfunden oder empfindungsmäßig gehabt werden. M o n t . : Und alles, was in seine Empfindungsnähe gelangt – was ihn unmittelbar berührend m i t in das Bereich des selbstisch Beherrschten und Gehabten kommt. Aber insofern haben Sie recht: der Leib oder das Selbst, in Leibhaftigkeit gesetzt, bleibt die unaufhebbare Basis aller Empfindungsmöglichkeit. Leib und Empfinden stehen in ebenso unauflöslichem Wesenszusammenhang wie – P s i l . : Geist und Verstehen. M o n t . : Trefflich. Aber Sie verkennen nicht, daß ,,Leib“ hier durchaus nicht auf den materiellen Leib beschränkt ist, sondern alles umfaßt, was in das leibhaft gesetzte Wesen im Vollmaß eingeht. P s i l . : Wofür schon die psychischen Empfindungen, die Gefühle sprechen.

Um den Menschen

285

M o n t . : O gut. Denn auch hier „habe“ und erlebe ich empfindungsmäßig, insofern ich in dem geinnerten Selbst – in letzter persönlicher Entzogenheit und Zentralität – leibhaft wohne. {215} P s i l . : Das Verstehen aber, Montanus, wollen Sie als ein Haben bezeichnen ohne jede selbstige Verquickung mit der betreffenden Sache? M o n t . : Ihr persönlich ein- und beiwohnend in vollkommener, selbstig persönlicher Entzogenheit „habe“ ich sie nicht mehr empfindungsmäßig, sondern geistig. Und welches Wunder ist das, Psilander. Welches Wunder diese Möglichkeit! P s i l . : Ein Paradox. M o n t . : Ein Paradox und Wunder, mit dem wir nun wohl gar nicht fertig werden würden, hätten wir nicht schon einen Einblick in jene Entität getan, deren Wesen es gerade ist, so zu „wesen“ wie es hier verlangt wird. P s i l . : In den Geist, wenn ich recht verstehe? M o n t . : Ja. Sahen wir nicht im Geist das Wesen einer Entität sich in radikal selbstloser Form entfalten und ausatmen? Das Leiben ist das Selbsten, das Geisten das Entselbsten. Im Leiben zieht die Wesenheit sich selber an, umkleidet sich mit sich, umgrenzt, beschließt sich, versiegelt sich in sich – konstituiert ihr von allem anderen abgeschiedenes, ihr monadisches, ihr s e l b s t i g e s Wesen. Im Geisten aber bietet sie nun wieder dieses ihr geleibtes Wesen dar, verströmt sich, ist ganz und gar hinaus- und fortgegeben, a u ß e r sich, frei von sich und von bewahrter und umgrenzter Beschwerung des eigenen Selbst. – Was sie also mit ihm berührt und umfängt, muß sie das nicht in eben jener radikal selbstlosen Weise berühren und umfangen, die sich uns als Charakteristikum des intellektuellen Habens, des Verstehens und Erkennens herausstellte? {216} P s i l . : Wenn aber doch jede Naturentität „Geist“ in diesem Sinne besitzen muß, wie Sie mich lehrten, so muß ja jede solche auch „Verstand“ haben – auch das Tier, auch die Pflanze, auch – der Stein? M o n t . : O Psilander, das durfte jetzt nicht kommen! Was für ein Wesen O r g a n sein soll, das muß es doch wohl irgendwie erst einmal „haben“ – P s i l . : Und zwar nicht im objektiven Sinne haben wie auch die Pflanze ihre geleibte Gestalt, mit der sie doch nichtsdestoweniger nicht empfindet, sondern im persönlichen subjektiven Sinne so wie das Tier seinen Leib – ich verstehe und erröte. M o n t . : Sagten wir nicht, der Geist stiege aus dem Tiere heraus und über es hinaus, unerreichbar für es selbst, das im seelischen Zentrum seines Selbst ersunken hinter ihm zurückbleibt? Und daher auch über dieses sein eigenes seelisches Zentrum, in dem es doch unmittelbar lebt, keine Herrschaft besitzt und keine freie Kenntnis von ihm hat – P s i l . : Die Konsequenz war längst gezogen – ich weiß. Wir sahen ja schon, daß der Mensch, um nun dem Tier gegenüber ebenso von seinem seelischen Selbst frei

286

Metaphysische Gespräche

zu werden wie das Tier der Pflanze gegenüber von seinem leiblichen, ebenso aus diesem seelischen Zentrum herausgesetzt werden muß wie das Tier aus der leiblichen Gestalt. Daß hier wie dort ein Standort „jenseits“ gegeben sein muß. Ja, daß dieser neue Standort beim Menschen nur der Geist und nichts anderes sein kann, stellten wir schon fest. {217} M o n t . : Allerdings noch etwas fragend. Jetzt aber sahen wir, daß es der Mensch eben in und mit diesem Geist vermag, selbstlos in alle Dinge, die der Geist an und für sich zu erreichen fähig ist, einzugehen und sie zu „haben“, ohne selbstig mit ihnen verquickt und belastet zu sein. Mit diesem Geist und in ihm geht der Mensch von sich selber aus und wohnt schauend und begreifend alledem bei, was dieser Geist umfängt. Oder ist es nicht so? Oder möchten Sie entgegnen, daß wir ja keineswegs einfach getragen und mitgenommen so ganz leicht und selbstverständlich und passiv alle Kenntnisse und Schauungen einatmen, sondern im Gegenteil durch mühsame und höchst aktive Akte des Denkens uns immer neu erheben und zu den Dingen hinbegeben und sie aufpflügen müssen, um nur ein ganz Kärgliches von ihnen zu erhaschen? P s i l . : Allerdings schwebte mir ein ähnlicher Einwand auf den Lippen. Und vielleicht hängt das mit einem anderen Punkt zusammen, der mich noch in Verwirrung setzt. Das Tier wird Herr über den Leib, indem es einen Standort jenseits dieses in seinem seelischen Zentrum gewinnt; hier aber gerade, wo es den Standort nun hat, ist es ja – so wie die Pflanze in ihrem leiblichen Sein – ersunken und n i c h t Herr und Besitzer. Und so müßte doch der Mensch, wenn er zwar durch seine Erhebung aus der Seele Herr über diese und ihr persönlicher Besitzer wird, in seinem Geist nun wiederum ebenso gefangen und ertrunken erscheinen wie das Tier in seiner Seele – es sei denn aufs neue ein jenseitiger Standort gewonnen? {218} M o n t . : Wenn wir nur Analogien ziehen wollten, ohne immer wieder auf die Sache selbst und die Modifikationen, die sie mit sich bringt, zu sehen, so könnte uns das allerdings ein wenig außer Fassung bringen. Aber vielleicht, Psilander, ist es mit diesem Aufsteigen in den Geist etwas anderes als mit jenem Ersinken in das seelische Zentrum – wenn es sich zwar beide Male um eine Standortsveränderung handelt und uns in diesem einen Punkt die Analogie bisher gute Dienste leistete. P s i l . : Schon mit der verschiedenen Ausdrucksweise haben Sie mir ja die Lösung nahe gelegt. Die Standortsverlegung in den Geist scheint eo ipso eine Erhebung, die in das seelische Zentrum eo ipso ein Versinken zu sein. M o n t . : Eine Erhebung nicht nur schlechthin, sondern, wie wir wissen, als solche eine Entselbstung, ein radikales Frei- und Loswerden von der Fixiertheit im umschließenden und bindenden Selbst. Wie sollte also derjenige, der nun einmal diesen persönlichen Höhenstandort gewonnen hat, in diesem wiederum gebunden erscheinen, da es ja das Wesen dieses Standorts ausmacht, in ihm und mit ihm entselbstet und frei zu sein?

Um den Menschen

287

{219} P s i l . : In den Geist erhoben wird also der Mensch nicht nur seinem eigenen seelischen Zentrum gegenüber frei und Herr, sondern auch diesem seinem eigenen Geist gegenüber –? M o n t . : Wobei sich dieses Freisein natürlich nur auf die Beherrschbarkeit des gegebenen und als solchen unveräußerlichen Wesens bezieht! P s i l . : Aber mit der faktischen Beherrschbarkeit, Montanus, dürfte es dennoch schlecht bestellt sein? M o n t . : Ach, mein Freund, rühren Sie jetzt schon an diesen dunklen Punkt? Nach welcher Wesensrichtung können wir vom Menschen sprechen, ohne an dieses brutale Faktum einer Korruptheit zu stoßen? So ist es ja mit jenem, mit dem Geist. Anstatt frei und „selig“ mit ihm ein- und auszugehen – frei in der Möglichkeit, sich wann immer und wohin immer hinzuwenden oder von ihm tragen zu lassen, wohin die selige Lust des Schauens und Erkennens gerade strebt – bleiben wir allüberall in dunkler Mühsal hinter ihm zurück und können nur gerade mit größter Anstrengung hier und da ein Lichtlein erhaschen. P s i l . : Als wenn wir doch wieder in uns und hinter uns zurückgesunken wären in das verdunkelnde Selbst? {220} M o n t . : So ist es. Ein wirklicher Sturz auch innerhalb unsrer selbst. P s i l . : Aber dennoch nicht ein Sturz, der uns der Freiheit des Denkens, der uns jenes Höhenstandorts überhaupt beraubt? M o n t . : Sonst wären wir wieder Tiere – so denken Sie richtig. O nein. Unser formaler Standort ist nach wie vor in der Höhe des Geistes – P s i l . : Das macht uns zur Person! M o n t . : Das macht uns zur Person. Es scheint mir auch, wir haben es jetzt gepackt. Das formale, das seinsmäßig-konstitutive Erhobensein in die entselbstete Höhe des Geistes – das macht die Person zur Person. P s i l . : Das bringt jenes Moment der Aufrechtheit und Nacktheit mit sich, das wir als Aspekt sofort faßten. M o n t . : Es scheint mir, wir werden auf dieses glücklich erreichte und wesentlichste Ziel zurückkommen. Aber jetzt, Psilander, beachten Sie noch einmal dieses Eigentümliche, das sich gar schwer fassen läßt: wie wir formal durchaus Personen geblieben sind, standortsmäßig durchaus nicht in das ganz und gar umhüllende „Wasser“ des seelischen Lebens zurückgesunken sind, in das Wasser, aus dem Tiere so vergeblich heraufzuseufzen scheinen – und dennoch zurückgesunken sind! Und dennoch nicht mehr selbstverständlich, nicht mehr frei und, wenn Sie mir noch einmal diesen hier so bezeichnenden Ausdruck erlauben, selig auf dieser Höhe wohnen und wohnen können, auf der wir doch leer und unvermögend gleichsam stehen geblieben sind. {221} P s i l . : Wir stehen noch auf ihr, aber wir können uns nicht mehr in ihr breiten –

288

Metaphysische Gespräche

M o n t . : Ja so – so ähnlich. Aber wie ist das möglich? Wie dieses Doppelte fassen und verstehen? Das wäre, mein Freund, einmal eine ganz besondere Aufgabe. P s i l . : Darf ich etwas bringen, was mir schon die ganze Zeit zu schaffen macht und vielleicht, vielleicht auch hierin ein kleiner Klärungsbeitrag sein mag? In diesem Fall komme nun ich einmal mit Ihren Dämonen. Was ist denn jetzt mit ihnen. Schien es uns nicht, als hätten auch sie eine Art Verstand? Aber haben wir nicht jetzt den Besitz des Verstandes an dem Moment des freien Erhobenseins über das selbstisch bindende Wesen orientiert? Die Dämonen sind aber doch nach unserer Orientierung die Ertrunkenen, Unerlösten, Unerhobenen katexochen? M o n t . : Die nicht einmal Geleibten –! P s i l . : Es scheint fast, als wollten Sie mit diesem prononzierten „nicht einmal“ schon einen Hinweis geben – M o n t . : Nannten wir nicht die Dämonen „Geister“? P s i l . : Hungergeister, Geister aus Mangel, Geister ohne Substanzialität. M o n t . : Sehr richtig. Und wenn auch Geister aus Mangel, wenn auch Geister, die sich nicht nur nicht aus der Fülle des substanziierten Selbst erheben, sondern dieses Selbst gar nicht erreichen können – so doch eben Geister. Das heißt in unfixierter, ungeleibter, selbstloser Wesenheit! {222} P s i l . : Einer Selbstlosigkeit wiederum aus Mangel und nicht aus überwundener Fülle – M o n t . : Und daher einer ewig hungernden, nicht aber einer in der Genüge beseligten Selbstlosigkeit. P s i l . : Und nun meinen Sie, weil Geist, daher auch eo ipso die Möglichkeit eines Verstandes? M o n t . : So ähnlich, ja. Mit seiner konstitutiven Ungeleibtheit und Unfixiertheit ist die Möglichkeit, einer Sache innezusein, ohne materialiter mit ihr verstrickt zu sein, eo ipso gegeben. So scheint es mir. Aber eines ist allerdings Voraussetzung: jenes Moment der Innerung, der Zentriertheit, das überhaupt erst eine Entität zu einer persönlichen macht – P s i l . : Aber nicht zu einer Person schon – M o n t . : Sehr wohl. Der Dämon ist ein persönliches Wesen, aber keine Person. Person kann er nie sein und werden, weil es ihm, dem ewig nach seinem Selbst Hungernden, versagt ist, sich über das gleichsam gesicherte Selbst zu erheben und – es hinter sich lassend – den Dingen in freier Selbstlosigkeit ein- und beizuwohnen. So nämlich frei von einem geleibten und fixierten Selbst, weil v o r aller Substanziierung und daher eo ipso, wenn ich so sagen darf, geistig begabt, ist doch der Dämon an dieses sein selbstloses und leibloses Selbst, an dieses sein Schattenselbst unauflöslich gebunden. Da er sich nicht einmal zu sich selbst erheben kann, wie sollte er sich aus sich selbst und über sich selbst hinaus in freier Hingabe erheben? Nein – nur das, was in den persönlichen Umkreis seiner begehrenden und hun-

Um den Menschen

289

gernden Selbstheit hineinfällt, was sie persönlichst tangiert, erregt und angeht, kann erlebt, gehabt und erfaßt werden. {223} P s i l . : Das nannten wir vorhin einen „seelischen“ Verstand. Und auch einen solchen hat das Tier nicht? M o n t . : Das faktische jedenfalls nicht. Und gebunden und fixiert in seiner materiellen Geleibtheit ist es nach dieser Richtung ein empfindendes und sinnlich erlebendes katexochen, nicht aber ein verstehendes. Doch, mein Freund, manchmal scheint es mir, als ob eine prononzierte seelische Innerung, d. h. eine solche, die sich nicht – die Seele als Wohnstätte voraussetzend – auf den Leib bezieht, sondern nun wiederum innerhalb dieser „Seele“ in persönlicher Zentralisation sich konstituiert, keine im Umkreis tierischer Konstitution wesenhafte Unmöglichkeit wäre. P s i l . : Und also auch eine Art „seelischen Verstandes“ nicht. M o n t . : Der doch niemals ein geistiger wäre und sein könnte. D e r d o c h niemals das Tier zu einer Person machen würde. {224} P s i l . : Von hier aus ist eigentlich erst die Möglichkeit eines wirklichen Sprechens der Tiere verständlich. M o n t . : Eines Sprechens, in dem nicht nur das Wesen objektiv verlautbart wird, sondern es, das Tier selbst, die Worte persönlich formt und verlautbart. P s i l . : Ja. M o n t . : Und das Tier könnte so aus seinem persönlich geinnerten Wesen heraus aussprechen, was es ist und begehrt, was es bewegt und was es bedrängt? Und wir erzählen hier keine Märchen? P s i l . : Wenn nicht eben die Märchen noch manche Wahrheit bergen, die das faktische Dasein verleugnet. M o n t . : Aber das Wichtigste bleibt, daß wir den Wesensunterschied zwischen Mensch und Tier, den unüberbrückbaren, nicht verwischen. Daß wir keine Anthropomorphisierung treiben. P s i l . : Das eben ist mir die neue Einsicht, daß „Verstand“ und Verstand, Sprechen und „Sprechen“ nicht dasselbe ist. Und daß man den Menschen nicht am Verstand und am Sprechen schlechthin orientieren kann, sondern – M o n t . : An der F r e i h e i t des Verstandes und an der Freiheit des Sprechens. P s i l . : Hier kommt der gleiche Unterschied in Betracht, der mir ganz zu Anfang unserer Gespräche an der Verschiedenheit der Leibesbewegungen aufging: das Tier müßte in diesem Fall sprechen, was es spricht und wäre insofern radikal unfrei; aber doch würde es persönlich und selbst sprechen, was es spricht! {225} M o n t . : In sich selbst geinnert könnte es persönlich sprechen, was es spricht, aber nicht über sich selbst erhoben könnte es nicht Herr sein über dieses mit der Gewalt seines drängenden Lebens und Wesens hervorbrechende sich Aussprechen. P s i l . : Ja.

290

Metaphysische Gespräche

M o n t . : Sein Wort würde aus der dunklen Umschlossenheit seines unerlösten Selbst stammen – P s i l . : So wie auch in den allermeisten Fällen unser eigenes Wort! M o n t . : Ja, mein Psilander. Und dennoch s o l l t e dieses aus der lichtvollen Aufgeschlossenheit des erlösten Selbst stammen. Denn der M e n s c h wohnt – so können wir sagen – seiner eigentlichen Bestimmung und formalen Wesenheit nach i n s e i n e m e i g e n e n Licht. P s i l . : Jetzt identifizieren Sie wiederum Licht und Geist – M o n t . : Nicht alles Licht ist Geist, aber aller Geist ist Licht. P s i l . : Insofern Geist das Wesen in entselbsteter und durch und durch unfixierter Form darstellt und offenbart? {226} M o n t . : „In entselbsteter Form offenbart“! Offenbart, eben weil hier die Wesenheit nicht mehr in selbsteigener Umgrenzung, Beschließung und Beschwerung mit sich selbst gegeben ist.Wenn aber der Stoff lichthaft aus sich hervorbricht, ist er dann nicht förmlich und wirklich in Ekstase versetzt? Strahlt er nicht nunmehr – durch und durch geöffnet und entselbstet – sich selber aus? Hat er nicht die Schranken verfinsternder Leibung durchbrochen, um sich frei und „selig“ zu verströmen, darzubieten, mitzuteilen? Ohne sich doch dabei selbst zu verlieren? P s i l . : Wenn Sie aber früher von einem möglichen „Geisten“ stofflicher Entitäten sprachen, meinten Sie doch nicht diese auf die Ebene des Stofflichen beschränkte „Lichtwerdung“? M o n t . : Gewiß nicht. Mit Recht sprechen Sie von der auf die Ebene des Stofflichen beschränkten Lichtwerdung. Es ist und bleibt ein „Geisten“ im Stofflichen und daher eben noch kein reelles Geisten, sondern die symbolische Vorstufe desselben. Beachten Sie jetzt nur Eines: wie der lichthaft gewordene Stoff oder das stoffliche Licht vermöge seiner entselbsteten Natur in alle stofflichen Dinge eindringen, sich ihnen gewissermaßen einschmiegen und wieder aus ihnen herausgehen kann, o h n e sich materialiter mit ihnen einzulassen, ohne sich materialiter mit ihnen zu verstricken, sich von ihnen beschweren und aufhalten zu lassen – auf dem Wege des Herein- und Herausgehens nur das Eigentümliche ihrer F o r m gleichsam mitnehmend, weil es eben ein immer anders seinsmäßig-konstitutiv geartetes Formganzes ist, bei dem es ein- und ausgeht! Muß es aber jetzt nicht mit und in seiner offenbarenden Funktion, die es auf seinen Wegen ja nicht verlieren kann, nun auch das in seiner formalen Wesenheit offenbaren, mit dem es also selbstlos gleichsam vermählt wurde? {227} P s i l . : Ungefähr ahne ich, wie hier deutlich werden kann, weshalb Licht eben „beleuchtet“, d. h. die Dinge, auf die es fällt, selbst offenbar macht. M o n t . : Und mehr als diese Ahnung brauchen wir auch nicht, um nun die Analogie recht deutlich werden zu sehen. Denn dieses Ein- und Ausgehen, das nur die Form der Dinge selbstlos mitnimmt, ohne sich materialiter mit ihnen zu ver-

Um den Menschen

291

stricken und zu beschweren, ist gerade, wie wir sahen, das Eigentümliche geistigen Habens. P s i l . : Dort aber nicht für das Licht selbst, dagegen für jeden, der die Dinge sieht; hier gerade für den Geist selbst, der jedoch durch sein geistiges Fassen die Dinge nicht auch ohne weiteres für andere offenbar macht! M o n t . : Das Licht allerdings kann die Dinge nicht „sehen“, die es doch offenbar macht, weil es sich selber nicht „hat“. Und ein anderer sieht die beleuchteten Dinge doch nur i n und m i t diesem Licht, an dem er durch seine leiblichen Augen ohne weiteres t e i l n i m m t ! Würden wir an dem Geist eines anderen ebenso teilnehmen, wie wir mit unseren leiblichen Augen an jeder Art stofflichen Lichtes teilnehmen, wären unsere geistigen Augen für objektiven Geist ebenso aufgetan, wir würden die Dinge nicht nur sehen durch uns selbst und so wie wir sie selber sehen, sondern auch mit einem jeden anderen Geist und durch ihn hindurch. So aber sind wir monadisch und selbstisch in unseren eigenen Geist eingeschlossen – {228} P s i l . : Auch das eine Folge jenes „Sturzes“ in die selbstisch beschwerende Tiefe hinab? M o n t . : Vielleicht. P s i l . : Aber, so wollen Sie sagen, wir wohnen immerhin in unserem eigenen Licht, „haben“ es in persönlich geinnerter Weise und können also mit ihm und in ihm an allem geistig teilnehmen, was es in sich selbst zu erreichen vermag. M o n t . : Wie sollten wir also uns selbst z. B. nicht in diesem eigenen Licht sehen und fassen können! P s i l . : So wird das Wesen des Selbstbewußtseins um einiges deutlicher. M o n t . : Allerdings. Aber, Psilander, vergessen wir nicht die Voraussetzung für dieses alles – die ontische Voraussetzung, die in ihrer höchst wunderbaren Artung das Wichtigste bleibt, was hier zu begreifen ist: dieses persönliche E r h o b e n s e i n selbst, die Möglichkeit dieses wahren E n t hobenseins aus selbstischer Beschließung. Einer selbstischen Beschließung, die doch deshalb bleibt, was sie ist und keineswegs aufgelöst wird: so daß sich das Merkwürdige konstituiert, daß der Mensch sowohl in der letzten Tiefe seiner selbst als a u c h über sich wohnt. Über sich wohnend, läßt er sich selbst unter sich. Aber eben s i c h s e l b s t , oder sein „Selbst“, d. h. sein ganzes zu gleicher Zeit – oder eben dadurch! – persönlichst erlebtes und gehabtes, in selbstischer Beschlossenheit fixiertes Wesen! In der Tiefe seiner selbst wohnend, thront er doch über sich. {229} P s i l . : Ist es so mit jeder Person als Person? M o n t . : Sie meinen, auch mit der rein geistigen z. B.? P s i l . : Ja, zum Beispiel. M o n t . : Allerdings ist das formal-konstitutiv ausschlaggebende Moment der Person dieses persönliche Enthobensein aus selbsthaft geleibter Umgrenzung, dieses freie Thronen ü b e r dem „Selbst“ – und hierin allein ist ja schon die seltsame

292

Metaphysische Gespräche

und formal ausschlaggebende Seinsparadoxie gegeben. Aber bei Personen, die an und für sich im Geistigen wesen, scheint uns diese Möglichkeit materialiter nicht so völlig unbegreiflich – denn „dem Geist ist alles möglich“ – ihm, dem an und für sich radikal freien, enthobenen, dem an und für sich aus der Höhe und aus dem Licht stammenden und in der Höhe und im Licht sich beschließenden. Denn wir sprechen hier natürlich nur von substanziellen Geistern, von Geistern aus Fülle, nicht aus Mangel. P s i l . : Da diese sich ja nie zu sich selbst, geschweige denn über sich selbst erheben können. {230} M o n t . : Sehr richtig. Bei jenen substanziellen Geistern also scheint es uns leichter zu fassen, wie sie zugleich in sich und über sich wohnen, zugleich sie selbst sein und doch über sich selbst sein können. Aber nun beim Menschen! Hier stehen wir auf dem Boden an und für sich abgründiger Natur. Hier konstituiert sich das Selbst nicht aus der Fülle des Geistigen, sondern aus der Fülle naturhafter und unterirdischer Gewalten! Hier ist Dunkel, Tiefe und Schwere der konstituierende Mutterboden, nicht Höhe und Licht. P s i l . : Jetzt rühren Sie an den Gegensatz, der uns in einem früheren Gespräch eben den notwendigen Besitz einer Seele beim Menschen gegenüber der wesenhaften Seelenlosigkeit jeglicher reiner Geister zu sichern schien –? M o n t . : Allerdings. Aber verstehen Sie wohl, daß man „Seele“ nun auch in einer weiteren und engeren Bedeutung nehmen kann. In der weiteren ist es der qualifizierende Grund jeglichen lebendigen Wesens – und in diesem Sinne hätten dann auch Geister eine Seele, nur eben eine „geistige“. Während Seele im prägnanten und engeren Sinn jenem naturhaften Grund und Zentrum zukommt, das seine Fülle und sein Leben aus der Tiefe und dem Dunkel nimmt. P s i l . : Und hier wieder unterschieden wir unpersönliche Seele und persönliche Seele – M o n t . : Erst mit letzterer sind wir an der eigentlichsten Bedeutung, der Bedeutung katexochen. {231} P s i l . : In bezug auf die man dann wirklich sagen kann, wie wir damals sagten, daß n u r der Mensch eine Seele hat. Nicht aber die übrigen Naturwesen und auch nicht die reinen Geister. Die ersteren weil ihre Seele eine unpersönliche, die zweiten, weil sie eine geistige ist. M o n t . : Sehr wohl. Und nun sehen Sie den Menschen – in abgründiger Tiefe wurzelnd und frei über sich erhoben! Auf dunkelstem Mutterboden erwachsend und im Licht thronend! Den Dämon zu seinen Füßen und den Engel über seinem Haupt. P s i l . : Wenn ihm nicht der Dämon über den Kopf wächst und der Engel entschwindet.

Um den Menschen

293

M o n t . : Wie es bei dem gefallenen Menschen eo ipso der Fall ist. Aber wir sagten schon: das formal-konstitutive Erhobensein bleibt dasselbe – P s i l . : Weshalb allein auch eine Errettung wiederum möglich ist –? M o n t . : Weshalb allein eine Wiedergeburt möglich ist. Als ein materiales Wiedergeborenwerden des Menschen dort, wo er formal und als Person immer seine Geburtsstelle hat. P s i l . : Seine Geburtsstelle? Sollte man von einer solchen nicht gerade in bezug auf die Tiefe sprechen? In bezug auf den dunklen Mutterboden, wie Sie es nannten? M o n t . : Der Mensch ist, so scheint mir, ein zweifach geborener. Darin besteht vielleicht gerade das Geheimnis seines Wesens. {232} P s i l . : Als wir über die „Seele“ sprachen, sagten Sie – es blieb mir deutlich in Erinnerung – der Mensch sei, wie notwendig alle Wesen – von einer einzigen „Stelle“ her gesetzt und auferbaut. M o n t . : Sagte ich das? Ach, Psilander, wir sind Suchende und Werdende. Vielleicht aber haben wir dort e t w a s gemeint und e t w a s hier – trotz des scheinbaren Widerspruchs. Denken Sie jetzt an das, was wir über die Evolution der Pflanzen und der Tiere sagten. An den gestaltenden Logos, der, gleichsam vor ihnen herziehend oder über ihnen stehend, sie zu dem werden läßt, was sie werden sollen. P s i l . : Der die Pflanze zum Licht heraufführt, im Tier den Abgrund seelischen Seins aufbrechen läßt. Und nun den Menschen aus diesem Abgrund wiederum hinaufhebt und -führt in das Licht – –? M o n t . : Welches Licht nun aber ein ganz und gar anderes, ein wahres Licht, das Licht des Geistes ist! P s i l . : Und damit zugleich sein persönliches Licht wird, weil er eben zu ihm hinaufgeführt wird. Verstehe ich recht? M o n t . : Das wollte ich sagen. Aber geschieht nun hiermit nicht etwas mit allem Bisherigen Unvergleichbares – bricht nicht hier die Linie von unten her notwendig ab, um einem Neuen und Unerhörten Platz zu machen? P s i l . : Ich verstehe noch nicht ganz. {233} M o n t . : Bei der Evolution der Pflanzen und Tiere bedurfte es der formenden, leitenden, durch und durch und immer aktuell einwirkenden Macht des „Wortes“, damit die Fülle der Gestalten heraufdringen und werden kann, die gegeben ist. Aber sie dringt eben von unten herauf, sie wächst ganz und gar und endgültig auf dem Boden der heraufbegehrenden Natur und schließt sich als solche in ihr ab. Schließt sich notwendig in ihr ab! Denn N a t u r – im irdischen, nicht mehr im unterirdischen Sinne –, ist das Geleibte, Fixierte, Beschlossene und Umschlossene: es kann wohl „Geist“ ausatmen, aber nie selbst und persönlich Geist w e r d e n . Denn das heißt: in Freiheit persönlich zu wesen, nicht mehr nur Gestaltetes und in der Gestalt Beschlossenes, sondern freies S e l b s t und damit nicht mehr „Natur“ zu sein.

294

Metaphysische Gespräche

P s i l . : Aber der Mensch gründet in der Natur und west doch in der Freiheit, ist doch ein freies und so erst ganz persönliches Selbst – M o n t . : Ja. Und wir sagen, daß er in sich selbst dazu erhoben, daß er hierzu in sich über sich selbst hinaus erhoben sein muß. Aber diese Erhebung – wie ist sie möglich ohne eben eine persönliche „Befestigung“ gleichsam in dieser Höhe, in diesem Reich des Geistes? Ohne eine „Geburt“ auch von hier aus? Um das ganz zu fassen, mein Psilander, muß man den mit allem sonstigen Sein und Setzungen unvergleichlichen Punkt der „I c h w e r d u n g “ im Auge haben – denn ein Geist im persönlichen Sinne zu sein oder einen Geist im persönlichen Sinne zu haben, ist nicht möglich, ohne ein I c h zu sein. Und damit dieses seltsame Unding des persönlich radikal neuen und freien „Anfangs“. Ein Selbst ohne Selbstigkeit, ein Anfang ohne Inhalt, ein Seiendes ohne doch zu sein, und mit dieser ganzen Leerheit und Ledigkeit und Freiheit erst das Persönliche katexochen! {234} P s i l . : Hierbei steigen unendliche Versuche in der Geschichte der Philosophie auf, dies zu fassen – bis zu Fichte, der es vielleicht am genialsten konzipierte. M o n t . : Unendliche Versuche! Aber Sie verstehen, daß es mit dem, was wir über das Wesen des Geistes sagten, engstens zusammenhängt. Denn was kann persönlich Geist sein und also in radikal entselbsteter Form persönlich wesen als allein ein solches „Ich“? P s i l . : Dieser Zusammenhang ist mir völlig deutlich. M o n t . : Aber auch, daß ein solcher Anfang nicht aus der Natur und mit ihr geschaffen, gesetzt oder geformt werden kann? Daß nur der Urzeuger selbst sich aus den Un- und Urgründen seiner Natur zu der radikalen Freiheit von sich selbst von Ewigkeit zu Ewigkeit erheben, sich zum freien Uranfang in sich selbst erzeugen kann? Und nun alles, was in der gleichen Freiheit, was als Geist wesen und leben soll, es nur in der persönlichen Teilnahme an diesem einen substanziellen Urgeist und Uranfang vermag? Denn wie sollte ein Endliches, ein Kreatürliches für sich allein als Anfang, für sich allein in radikaler Freiheit stehen und bestehen können? Nein, unmittelbar hervorgehend aus dem Ur-Ich – nicht als Geschaffenes, sondern als bleibend aus ihm Gezeugtes oder Geborenes oder in ihm Wohnendes – ist es selbst ein Ich, anders ist es unmöglich. {235} P s i l . : Ich begreife es von ferne. M o n t . : Und ich nicht anders. Lassen wir das alles in der Schwebe stehen. Aber wir müssen es streifen, um nur einmal eine erste schattenhafte Versuchsskizze von den ontischen Grundlagen des Menschen zu gewinnen. Denn jetzt ist es ja etwas deutlicher, was es heißen kann, wenn wir von seiner zweifachen Geburt sprechen. Aus den qualifizierenden Un- und Urgründen der Natur gezeugt und geformt ist er doch zugleich aus dem „Geist“ geboren – so von unten her und von oben her persönlich wesend.

Um den Menschen

295

P s i l . : Aber wenn Sie sagten, daß der Mensch als Mensch in seinem eigenen Licht, d. h. in seinem eigenen Geist wohne, so meinten Sie doch hiermit den Geist seines von unten her qualifizierten, seines selbstischen Wesens – M o n t . : Des eo ipso von ihm als lebendigem Naturwesen ausgehenden Geistes – P s i l . : Ja. M o n t . : Allerdings. {236} P s i l . : Aber jetzt sah es fast so aus, als wenn s e i n Geist sich nur in der unmittelbaren und persönlichen Teilnahme am Geiste Gottes konstituieren könne! M o n t . : Hier berühren Sie in der Tat den eigentümlichsten und schwierigsten Punkt. Er kann in seinem eigenen Geist persönlich nur wohnen, indem er – formaliter zunächst – im Geist Gottes wohnt. Er kann als freies Ich nur über sich und in seinem eigenen Geist wesen, indem er formaliter im „Ur-Ich“ west. P s i l . : Mit diesem „formaliter“ wollen Sie etwas Entscheidendes sagen? M o n t . : Ja. Daß der Mensch, der zwar formaliter „in der Höhe“ befestigt ist – von hierher die Möglichkeit nehmend, sich in radikaler Freiheit, Erhobenheit und Selbstherrlichkeit gegenüber sich selbst als Person zu fassen und zu besitzen – doch mit seinem gesamten materialen Wesen aus der Tiefe stammt und aus ihr heraus erzeugt ist. P s i l . : Vorhin schien es so, als ob nur beim „gefallenen“ Menschen dieser Gegensatz formaler Erhobenheit, der doch der materiale Gehalt fehle, statthabe. Der integre Mensch dagegen materialiter u n d formaliter auf der Höhe wohne und von ihr aus lebe. M o n t . : Gehen uns hier nicht zwei verschiedene Gegensätze von „formal“ und „material“ durcheinander? Daß der Mensch der gesamten persönlichen Materie seines Wesens nach aus der Tiefe stammt, von ihr her qualifiziert und „erboren“ ist – das scheint mir primäre und grundwesentliche Einsicht zu sein. Daß der Mensch qua Mensch naturgeborenes, n i c h t geistgeborenes Wesen ist! {237} P s i l . : Und das war es, was Sie in unserem damaligen Gespräch über die Seele vornehmlich fixieren wollten? M o n t . : Was wir allein damals im Auge hatten – und als erste starke Einsicht auch allein im Auge haben und fixieren durften. Der Mensch n i m m t sich ganz und gar von unten her; aber damit er sich von unten her als Person nehmen kann, muß er seine Freiheit im Geist von oben her nehmen. So wird nicht nur sein Geist, sondern auch seine Seele sein freies persönliches Eigentum. So wird er befähigt, alles, was im Dunkel seiner Seele lebt und drängt, herauf ans Licht und in die Freiheit zu führen. P s i l . : So ist also seine Geburt „aus Gottes Geist“ – darf man so sagen? – zunächst auch nur als formale zu denken?

296

Metaphysische Gespräche

M o n t . : Ja, so scheint es. Hier aber gibt es nun offenbar ein Zweierlei: jenes wahrhafte reelle Wohnen „in der Höhe“ beim integren Menschen und das nur noch schattenhafte des entglittenen und herabgesunkenen. Hier ist der zweite Gegensatz des formal-material, der einen ganz und gar anderen Sinn hat. Sehen Sie, Psilander, jene Stelle absoluter Freiheit, jene Stelle der freien Ichgeburt oder Ichkonstitution ist ja notwendig die metaphysisch offene Pforte, durch die Gottes Geist frei hindurchgehen kann. Der Mensch hat seinen eigenen, aus der Tiefe seines persönlichen Einzelwesens stammenden Geist; aber durch Gottes Geist soll dieser verklärt und ins Absolute hinein aufgehoben werden. Und nur durch ihn kann er es. Oder auch umgekehrt: Gottes Geist soll durch den menschlichen Geist in der eigentümlichen Färbung und Gebrochenheit wiedergegeben und ausgeatmet werden, die eben durch das in den Gründen der Natur in spezifischer Form qualifizierende Wesen des Menschen bedingt ist. {238} P s i l . : In furchtbarer Weise aber wird auf diesem Wege Gottes Geist verdunkelt und entstellt! Das aber eben nennen Sie Konsequenz jenes „Sturzes“, „Strafe“? M o n t . : In dem Augenblick, da sich der Mensch in seinem eigenen Geist verabsolutieren wollte, diesen nicht mehr als immerwährende Gabe dar- und zurückbringen wollte, mußte er die Möglichkeit, auf der freien und radikal entselbsteten Höhe seines eigenen Geistes substanzialiter zu wohnen, nun auch verlieren. So in die selbstische Tiefe und Untiefe seines geleibten Wesens hinabgesunken, kann er auch nur mehr einen selbstischen, nicht mehr einen freien und reinen Geist ausatmen. Statt der klare und nur färbende Spiegel des Geistes Gottes zu sein, läßt er diesen durch die schwelende, unreine, verstofflichte Flamme seines Geistes überhaupt nicht mehr durch. {239} P s i l . : In nahe persönliche Beziehung bringen Sie Mensch und Gott! M o n t . : Sagen nicht alle Mystiker, daß die dreieinige Gottheit persönlichst in der Seele des Menschen wohnt, daß der Begnadete sie hier fühlen, schauen, ja berühren kann? P s i l . : In der Seele? Widerspricht das nicht allen unseren Bestimmungen? M o n t . : Weil wir gerade den Geist als die Stätte der persönlichen Teilnahme an der Gottheit zu fixieren schienen? P s i l . : Ja. M o n t . : Nicht in der Naturseele, soweit und solange sie eine solche ist, kann die Gottheit in dieser höchst persönlichen Weise anwesend sein! So scheint es mir. Nur dort ist es möglich, wo die Seele des Menschen im Geist und aus dem Geist – als einer zweiten Geburtsstätte – hervorgeht oder in ihm befestigt ist! Vielleicht ist es so gemeint, wenn die mystischen Berichte von der „zartesten“ oder „äußersten Spitze“ der Seele sprechen, in der diese Erlebnisse stattfinden. Überhaupt ist ja, mein Freund, in diesem allen, was wir zu sagen wagten, die Totalität des Menschen in

Um den Menschen

297

ihrer wahren Einheit und Einheitlichkeit noch nicht einmal berührt. Lassen Sie mich jetzt nur Eines andeuten: mehrmals schon sprachen wir von den Wo r t e n , die das geistbegabte Wesen mit einer Art sich im Geist selbst vollziehender Innerung, Leibung und Fixierung aussprechen kann. „Im Geist“ – und doch kommen die Worte des Menschen „aus dem Herzen“. Wenigstens alle substanziellen, alle w a h r h a f t e n Worte. {240} P s i l . : Aus dem Herzen? Was ist das Herz? M o n t . : Scheint es Ihnen nicht, als ob der Mensch „ohne Herz“ ein Unding wäre – ohne diese Mitte nämlich, in die nun sein g a n z e s Wesen, wie es sich in Seele, Leib und Geist gebiert, auseinanderfaltet und verströmt, wiederum in eins genommen und gesetzt wird, in der es gleichsam zentral verknotet und befestigt ist? In der alle „Blutströme“, alle Wege des persönlichen Lebens zusammenlaufen, um von ihr wieder auszugehen? Nichts kann der Mensch a l s g a n z e r, e r g a n z p e r s ö n l i c h , sagen, wollen und tun, was nicht aus dieser Mitte seiner selbst stammt, in der allein eben sein ganzes Wesen in eins gesetzt ist. Alles andere ist leer, unsubstanziell und im persönlichen Sinne wesenlos. P s i l . : Nannten Sie nicht früher einmal – ich glaube nach einem Wort Jakob Böhmes – den Sohn Gottes das Herz des Vaters? M o n t . : O ja. Denn der Sohn Gottes i s t ja das glühend in eins gesetzte Wesen des Vaters. Beachten Sie, wie merkwürdig das ist: daß hier an höchster und letzter Stelle, daß hier im Zentrum schließlich alles zusammenfällt, was im Kreatürlichen gestaltungsmäßig auseinandertritt; daß der Sohn Gottes in dem gleichen prägnanten Sinne das Wo r t , der L e i b und das H e r z des Vaters genannt werden kann und dennoch selbst P e r s o n in der höchsten und eigentlichsten Bedeutung des Wortes ist. Aber nun, Psilander, scheint es mir, daß wir uns auf diesem Wege gleichsam zu Ende gesprochen haben und daß wir ganz von vorne anfangen müßten, wollten wir aus der Unendlichkeit möglicher Aufschlüsse wieder einiges Neue erhaschen.

Index action 7 f., 85 – 90, 97 f., 122 f., 139 – (a) being of action 9, 85, 88 f., 91, 137 activity 8 f., 11, 48 f., 105, 107 f., 115 actuality, see also reality 27, 32, 41, 61, 64 f., 95, 115, 117 – 119, 121, 135, 138 affect 78 angel 6, 10, 70 – 72, 75, 94, 97, 99, 101, 109, 111 f., 117, 119 – 121, 123 f., 151 animal 5, 8 – 15, 18, 25 f., 43 – 49, 51 – 54, 56, 59 f., 62, 80 – 92, 94 – 98, 100, 102 – 105, 111 – 113, 121 – 124, 131, 135, 137 – 148, 151 f. a priori 30, 40, 50, 93, 96, 126, 136 Aquinas, Thomas 12, 31 Aristotle 9, 30, 55, 139 Baader, Franz von 6, 69, 72, 88, 100, 107 being, see also essence and ontology 2 – 6, 8 – 15, 17, 19 f., 23 – 31, 34, 36 – 41, 43 – 56, 58 – 94, 96, 99 – 102, 104 – 141, 143 – 155 – beingness 106, 114, 120 Bergson, Henri 14, 92 bodiliness 20, 62, 115 f. – acting in body 20, 108, 113, 118, 125, 129, 144 – bodily 8, 44, 47 f., 54, 56 – 60, 89, 91 f., 95, 99, 106, 108, 111, 115, 121 f., 139, 142, 144 f., 148 f. – body 3 f., 7 – 11, 17 f., 20, 48, 51 f., 55 – 61, 66, 79, 85, 87, 89, 96, 101 f., 105 – 116, 121 – 123, 125, 129 f., 132, 137, 139 f., 142 – 145, 148, 155 – embodiment 10, 89, 92, 99 f., 104, 110, 115, 131 f., 139, 147 – 149 Böhme, Jakob 6, 12, 88, 107, 109, 137, 155 breath 10, 103 – 105, 109 f., 115, 124, 126, 137 – breathing 104 f., 115, 117 f., 124, 127, 129 – exhaling 105, 108, 110, 112, 124, 144 – inhaling 108, 110 causality, purposive color 3, 28, 117

33

configuration 11, 19, 44 f., 53 f., 56, 59, 66, 68, 77, 89, 91 – 96, 99 – 101, 107, 109, 111 f., 117 – 120, 125 – 128, 131 – 139, 152, 155 consciousness 11, 23 – 27, 36 – 38, 40, 43, 45, 49 f., 57, 59, 82, 86, 90, 96, 101, 123, 142, 150 corporeality 20, 50 – 52 cosmos 12 – 14, 27 – 29, 34, 131 f. – cosmos noetos 29 creation 2, 4, 12 – 14, 60, 93 f., 107, 131 Dasein 17, 20, 24 – 26, 118 demon/demonic 6, 10, 86, 88, 94, 97 – 101, 105 f., 111 – 114, 117, 119 – 121, 123 f., 141, 147, 151 depths 20, 52, 58 f., 82, 97 f., 100 f., 107, 113 f., 119, 127, 138 – 141, 150 f., 153 f. desire 52, 87, 146, 148, 155 divine, see also God 6, 14, 94 Driesch, Hans 33, 170 drive 64, 82, 85, 87 – 89, 91 f., 94, 100, 106, 132, 139 dwelling 8, 17 f., 20, 58, 89, 95, 98, 104, 113, 129, 131, 137, 139, 150, 153 eidos 23, 26, 159 embodiment, see body empirical 4 – 7, 14, 23, 27, 32 – 34, 37, 39 – 41, 71, 73, 75, 79, 81, 98 f. energy 28 – 31, 93 ensoulment, see soul entelechy 33, 136 epochē 37 – 41 essence, see also being 4, 10, 17, 29, 37, 70, 100, 127, 149 eternity 107, 118, 120, 129, 136, 153 evolution 12 – 14, 121, 139, 151 f. existence 6, 11 f., 20, 24 f., 27, 53 f., 56, 59 – 63, 65, 67 – 69, 71 – 73, 77, 79 f., 86 – 88, 91 f., 96 – 98, 100 f., 110 f., 113, 118 f., 131, 133, 136, 148 fashioning 19, 56, 59, 90 f., 97, 102, 108 f., 118, 128 – 130, 132, 135, 137

https://doi.org/10.1515/9783110763096-009

Index

figure/figuration 1, 5 f., 8, 10 f., 17, 19, 44, 50, 54, 59 f., 65 f., 71 f., 85, 88, 95, 98 – 100, 108, 112 f., 117 f., 120, 127, 132 – 134, 136, 138 – 141, 144 f., 152 Fink, Eugen 4, 35, 39 f. force 7, 18, 28 – 30, 60, 72, 82, 85, 87, 93, 95 f., 98, 100, 116, 119, 127 – 133, 135 – 137 formation 19, 33, 44, 50, 67, 95, 99, 110, 114 freedom, see also will, free 8, 10 f., 47, 49, 83, 86, 98, 100, 107, 120, 123, 146, 148, 152 – 154 givenness 18, 37, 39 God, see also divine 14, 27, 30, 41, 69 f., 73, 75, 80, 93, 101 f., 107 f., 111, 115 – 118, 120, 125, 129 f., 137, 153 – 155 – Godhead 116, 127, 129 f., 132, 155 – godly 30, 70 f. Goethe, Johann Wolfgang von 13, 110, 134 Göttingen circle/school/movement 1, 4, 35 grounding 38, 41, 60, 65, 90, 95, 129 f. heart 2, 17, 28, 137, 155 Heidegger, Martin 2 – 4, 6, 10, 24 f., 35, 40, 104 Husserl, Edmund 1 – 4, 17 f., 23 f., 27, 35 – 41 imagination 45, 70 impetus 4, 19, 92 integral (human) 6, 69, 72 f., 153 f. interiority 12, 97 – internalization 148 intuition 4 f., 27, 54, 56, 61, 70, 83, 93, 117 Landgrebe, Ludwig 4, 35, 40, 173, 179 light 3, 7, 28 – 31, 43, 53, 69, 75 f., 81, 100, 105, 114 – 117, 119, 129, 131 f., 134 – 136, 138 f., 142, 146, 148 – 154 – levity 65, 67 f., 75 – 77 – lightness 9, 61, 63, 65, 76 f. material 33, 81, 92, 95, 98 f., 101 – 105, 108 – 111, 126, 128, 133, 137, 144, 148 f., 151, 153 f. – matter 7, 12, 14 f., 18, 27 – 29, 31, 33 – 37, 56, 61 f., 64, 66 f., 78, 83, 86, 94 – 96, 102 f., 105 f., 110, 115 f., 118, 122, 127 f., 132 – 135, 137, 143, 145, 154

299

metaphysics/metaphysical 1 – 4, 6, 8, 10, 13 f., 17, 26, 40 f., 43, 45, 80, 84, 93 f., 98, 107, 131, 135 mimosa 46 – 49, 53 mind 7, 10 f., 18, 23 f., 55, 61, 88, 97, 104, 117, 152 mood 20, 61, 102 f. movement, autonomous 44 – 46, 48, 52 nature 3 – 8, 10, 12 – 15, 17, 19 f., 23 – 34, 36 – 39, 41, 43 – 47, 51 – 56, 60 – 67, 70 – 77, 80 – 89, 93 f., 96 – 101, 103, 105 – 112, 116 – 124, 126 – 134, 136 – 141, 143 – 146, 148 – 154 noema 38 noesis 37 ontology/ontological 2 – 5, 13 f., 20, 25 – 27, 29, 31, 34 – 42, 80 owning 11, 25, 52, 95 – 97, 107 – 109, 122, 128, 131, 149 passivity 48 f. person/personhood 9, 19, 24 – 26, 29, 40, 50, 57, 72, 77, 84, 101, 123 – 125, 140, 146 – 148, 150 f., 153 – 155 phenomenon/phenomenologist/phenomenology/phenomenological 1 – 8, 11 f., 14 f., 17 f., 20 f., 23 f., 26 f., 29 – 31, 35 – 42, 46, 64, 82, 89 f., 93 f., 104, 114 physicist 30 – 32 plant 5, 8 – 11, 13 – 15, 18, 43 – 56, 85, 87 – 91, 94 – 98, 104, 111 f., 121 f., 124 – 126, 131, 133 – 135, 137 – 142, 144 f., 151 f. polyp 46 – 49, 51, 88 primordial 13, 20, 24, 28, 36, 41, 50, 63, 67, 69 f., 84 – 86, 88, 90, 92 f., 100, 107, 110 – 114, 117 – 120, 125, 127 f., 131 – 136, 138 f., 153 psychic, see also spirit 30, 40, 47, 144 psychology 44 qualia 12, 27, 30 f., 88, 164 qualifying source 12, 20, 81, 88, 90 – 98, 104, 109, 111 f., 121 f., 135 quintessential 20, 85, 88 f., 134, 138, 151 reality, see also actuality 41, 45, 52, 101, 150

3, 7, 23 – 25, 27, 37 – 39,

300

Index

reason 7, 10, 13, 41, 47, 54, 56, 60, 65, 67, 78, 83, 113, 115, 123, 134, 151 reduction 36 f., 39 f. scholastic/Scholasticism 9, 12, 43, 66 f., 83 f., 90, 93, 126, 128, 130, science/scientist 3 – 5, 13 – 15, 18, 23, 28 – 35, 40, 44, 48, 90 f., 95 self 6, 10 – 12, 20, 25, 37 – 39, 49, 52, 59, 68, 70, 73 – 79, 82, 87, 95 – 97, 99 – 101, 107, 109 f., 117, 120, 122 – 124, 126 f., 129, 131 – 133, 135 f., 138 – 153, 155 – selfhood 11, 20, 59, 74, 76, 79, 120, 143, 147, 152 – selflessness 147 – self-realizing 141 sensation/sentience 30, 43, 46 f., 50, 52, 55, 126, 143 f. sense organs 43 f. soul 3 f., 7 – 12, 17 f., 20, 30, 50 – 62, 64, 66 f., 74 – 80, 88 f., 109, 111 – 114, 122 f., 139 – 141, 144 – 148, 151 f., 154 f. – acting in soul 20 – ensouled 20, 50, 58, 119, 146 – ensoulment 56 f. – of soul 3, 8, 12, 20, 56, 60, 113, 141, 148, 151 – soulful 8, 57, 78 – soul-middle 88 f. species 8, 13 f., 46, 66 f., 88, 90 – 92 speculation 3 f., 7, 20, 23, 30 – 34, 37 spirit, spirits 3 f., 7 – 12, 17 f., 20, 31, 53 f., 57 – 69, 72, 74, 76 f., 80, 82, 93 f., 100 – 121, 123 – 126, 129, 131, 137, 140 – 147, 149 – 155 – acting in spirit 20, 108 f., 113, 129, 144, 149 – born of spirit 65 – 68, 70 f., 112 f., 117, 119, 154

–

elemental spirits 10, 53 f., 60, 62, 66, 75 f., 111 f., 117 – of spirit 6, 8, 10, 20, 28, 56, 59 f., 62, 64 f., 68 – 76, 99, 103, 106 – 111, 116, 118 – 120, 126, 137, 141, 147 – 152 – spirit-being 20, 61, 63, 68 – 73, 75 stimulus 11, 43, 46 – 48, 79, 87 structure 6, 27, 43 – 45, 51, 54 f., 62, 81, 105 f. substantiality 93 f., 99, 101 f., 106 f., 111, 116, 119, 147 substantivizing 63 – 65, 90 – 92, 94 – 97, 99 f., 102, 122 transcendent 41, 45, 93, 96 transcendental 4, 20, 23 – 26, 28 f., 35 f., 39 – 41 understanding 7, 10, 24, 30 f., 109, 123 f., 127, 141 – 144, 147 f. vitalism/vitalist

14, 49, 130

weight 6, 9, 19, 61 – 63, 65, 67 – 69, 75 – 77, 151 Wesen 3, 5, 12, 15, 17 f., 20, 23, 27, 29, 33, 37 f., 45, 48, 59, 62, 64, 81, 84, 104 f., 112, 114, 117, 123, 144 Wesenserkenntnis 5, 17, 27, 29, 34 Wesensforschung 17, 29, 31, 34, 36 f., 39 Wesenswissenschaft 17 will/willing 4 – 6, 8, 10, 12 f., 18, 23, 29, 33, 47 – 49, 53, 55, 57, 64, 70 – 74, 77, 80, 82, 86, 89, 93, 101 f., 104 f., 108 – 112, 115, 117, 120, 123 f., 131, 135, 146 f., 152, 154 – free will 47, 49, 82 world 1 f., 11, 15, 23 – 28, 31, 35, 37 – 41, 67 – 69, 71, 74 – 77, 79, 82, 93, 100